HHsearch alignment for GI: 254780432 and conserved domain: PRK00854

>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed.
Probab=100.00  E-value=0  Score=778.64  Aligned_cols=384  Identities=33%  Similarity=0.589  Sum_probs=364.3

Q ss_pred             CCCCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             84314515588887489850103799679976464102267435787899999999999973145068757818999998
Q gi|254780432|r    2 NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFAN   81 (392)
Q Consensus         2 ~~~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~   81 (392)
T Consensus        14 ~~~~~~~~~y~p~Pivi~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~l~~   93 (404)
T PRK00854         14 TEQRLGAHNYKPLDVVLTRGEGVWVWDTDGRRYLDCLSAYSAVNQGHCHPKILAAMVEQAGRLTLTSRAFRNDQLAPLYE   93 (404)
T ss_pred             HHHHHCCCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
T ss_conf             99874588889898479985759999799999988262999775427979999999999856786555426579999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             652010133312356555403567776654320013--478600234354656543212345532113479998643332
Q gi|254780432|r   82 HLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG--KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFD  159 (392)
Q Consensus        82 ~L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g--~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~  159 (392)
T Consensus        94 ~l~~~~~~~~v~f~~SGsEAve~AiklAr~~~~~~~g~~tgr~~ii~~~~~yHG~t~~~~s~s~~~~~~~~~~~~~~~~~  173 (404)
T PRK00854         94 ELAALTGSHKVLPMNSGAEAVETAIKAVRKWGYEVKGVPEGQAEIIVCADNFHGRTLSIVGFSTDPDARGGFGPFAPGFR  173 (404)
T ss_pred             HHHHCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             99740376848855877999999999999987650378789855999645667860135434677433568889999815


Q ss_pred             CCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22100268875410123322223332222112462101232211022345721310110034444555310111245453
Q gi|254780432|r  160 QAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD  239 (392)
Q Consensus       160 ~~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD  239 (392)
T Consensus       174 ~~p~~d~~~l~~~~~~~~aAviiEPiqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~TGfGRtG~~fa~e~~gv~PD  253 (404)
T PRK00854        174 VVPFGDAAALEAAITPNTVAFLIEPIQGEAGVIIPPAGYFRRVRELCTANNVTLILDEIQTGLGRTGKLLAEEHEGIEAD  253 (404)
T ss_pred             EECCCCHHHHHHHHCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCCCC
T ss_conf             50566689999863987489999177577896179989999999999970764457500017863557414554248979


Q ss_pred             EEECCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHH
Q ss_conf             021034444443-4432100011122222332234532111100123345543201222101121000026889999886
Q gi|254780432|r  240 IMTIAKGMGGGF-PIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR  318 (392)
Q Consensus       240 i~~~gK~l~gG~-P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~  318 (392)
T Consensus       254 ii~~gKgl~gG~~Pl~av~~~~~i~~~~~~~~h~~T~~gnpla~aaa~a~l~~i~~e~l~~~~~~~g~~l~~~L~~l~--  331 (404)
T PRK00854        254 VTLIGKALSGGFYPVSAVLSNSEVLGVLRPGQHGSTFGGNPLACAVARAALRVLVEEGMIENAAEQGAYFLEGLRAIR--  331 (404)
T ss_pred             EEEECCCCCCCCCCCCEEECCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC--
T ss_conf             897564445887653202047999950679887788898989999999999999865899999999999999998504--


Q ss_pred             CCCEEEEECCCEEEEEEEECCCH---HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             79707550464009998724998---99999999689899626898899558986889999999999999999
Q gi|254780432|r  319 FPNMFLEVRGQGLLIGLKTVFSP---ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIE