HHsearch alignment for GI: 254780432 and conserved domain: PRK00950

>PRK00950 histidinol-phosphate aminotransferase; Validated.
Probab=99.65  E-value=2.6e-14  Score=114.05  Aligned_cols=324  Identities=18%  Similarity=0.236  Sum_probs=194.7

Q ss_pred             EECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCC-CCCCCCHH
Q ss_conf             96799764641022674357878999999999999731450687578189999986520101--3331235-65554035
Q gi|254780432|r   27 FSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFT-NSGAESVE  103 (392)
Q Consensus        27 ~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~-~SGseA~e  103 (392)
T Consensus        30 ~g~~~~~ii~ls~n--enp~gp~-p~v~~a~~~~~~~~----~~YPd~~~~~Lr~aiA~~~gv~~e~ii~~gnGs~e~i~  102 (369)
T PRK00950         30 YGIDPESIIKLGSN--ENPLGPS-PKAVEALIDEAPNI----HQYPEPDAPELREAISKYTGVPVENIIVGGDGADEIID  102 (369)
T ss_pred             CCCCCCCEEEECCC--CCCCCCC-HHHHHHHHHHHHCC----CCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCHHHHHH
T ss_conf             09896898881298--9986788-99999999875325----87999888999999999868197587997564999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-C
Q ss_conf             677766543200134786002343546565432123455321134799986433322210026887541012332222-3
Q gi|254780432|r  104 CAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL-I  182 (392)
Q Consensus       104 ~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi-~  182 (392)
T Consensus       103 ~l~~~~~-------~~Gd-~vl~~~P~y~~Y~~~a~~~G~~~~~-v---~~~~--~~~f~~d~~~l~~~i~~~tklv~l~  168 (369)
T PRK00950        103 VLMRILI-------DEGD-EVIIPIPTFTYYEISARACGAKPVY-A---KFDR--EEDFKLDVESVLNAITDKTKIIFLC  168 (369)
T ss_pred             HHHHHHH-------CCCC-EEEECCCCCHHHHHHHHHCCCEEEE-C---CCCC--CCCCCCCHHHHHHHCCCCCEEEEEE
T ss_conf             9999995-------7999-9998988730369999983982022-3---6771--2499889999997367676089980


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCCC
Q ss_conf             33222211246210123221102234572131011003444455531011124545302---1034444-4434432100
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GGFPIGACLA  258 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~  258 (392)
T Consensus       169 nPnNP-TG~~-~~~~---el~~l~~~~~~~vv~DEaY~ef~~--~~~~-~l~~~~~n~iv~~SfSK~~~laGlRlGy~i~  240 (369)
T PRK00950        169 TPNNP-TGNL-IPEE---DIRKIVESTDALVFVDEAYIEFAE--YDLT-ELALEYDNVLVLRTFSKVFGLAGMRIGYGIM  240 (369)
T ss_pred             CCCCC-CCEE-ECHH---HHHHHHHCCCEEEEECCCHHHHCC--CCHH-HHHHHCCCEEEEEECCHHHHCCCCEEEEEEC
T ss_conf             89998-7832-4799---987898718879994242675257--9715-6787458658984121554057750467646


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEEC
Q ss_conf             01112222233223453211110012334554320122210112100002688999988679707550464009998724
Q gi|254780432|r  259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV  338 (392)
Q Consensus       259 ~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~  338 (392)
T Consensus       241 ~~~li~~l~~~~--~~~~v~~~aq~aa~aaL~---~~~~~~~~~~~~~~~R~~l~~~L~~l~~~~v-~ps~anFil~~~~  314 (369)
T PRK00950        241 PKWIIEYMMRIK--PPFSLTRLSQAAAIAALR---DKEFIEKSIELGIESREYLYEGLKKFKPLKV-YPSEANYVLVDVK  314 (369)
T ss_pred             CHHHHHHHHHHC--CCCCHHHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHCCCCEE-CCCCCEEEEEECC
T ss_conf             999999999856--875706999999999950---9588999999999999999999985799778-7898618999899


Q ss_pred             C--CHHHHHHHHHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9--9899999999689899626------898899558986889999999999999999
Q gi|254780432|r  339 F--SPALLAAKFRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       339 ~--~~~~~~~~l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
T Consensus       315 ~~~~~~~~~~~Ll~~gI~Vr~g~~f~~~~~~~iRis---igt~~en~~ll~al~~il~  369 (369)
T PRK00950        315 PGMTAKEFTEELLKKGVIVRDCTSFEGLGDYYIRVS---IGTLEENERFLEILKEIVE  369 (369)
T ss_pred             CCCCHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE---ECCHHHHHHHHHHHHHHHC
T ss_conf             999999999999969959996877777898989998---0899999999999999859