HHsearch alignment for GI: 254780432 and conserved domain: PRK01278

>PRK01278 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Provisional.
Probab=100.00  E-value=0  Score=808.02  Aligned_cols=384  Identities=62%  Similarity=1.060  Sum_probs=376.0

Q ss_pred             ECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             51558888748985010379967997646410226743578789999999999997314506875781899999865201
Q gi|254780432|r    7 LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHS   86 (392)
Q Consensus         7 ~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~   86 (392)
T Consensus         6 ~~~~y~~~Pi~i~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~ai~~q~~~l~~~~~~~~~~~~~~la~~L~~~   85 (389)
T PRK01278          6 LLPVYNRADLRFERGEGVWLIDEDGERYLDFASGIAVNSLGHAHPHLVEALKEQAEKLWHVSNLYRIPEQERLAERLVEN   85 (389)
T ss_pred             CCCCCCCCCCCEEEEECCEEEECCCCEEEECCCCHHHCEECCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             43558999977799765999979989999936098861228997899999999986566765653687999999997533


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             01333123565554035677766543200134786002343546565432123455321134799986433322210026
Q gi|254780432|r   87 TFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDL  166 (392)
Q Consensus        87 ~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~  166 (392)
T Consensus        86 ~~~d~v~f~~sGsEAve~AlklAr~~~~~~g~t~r~~ii~~~~~yHG~t~~~~s~sg~~~~~~~~~p~~~~~~~~~~~d~  165 (389)
T PRK01278         86 SFADKVFFTNSGAEAVECAIKTARRYQYGKGHPERYRIITFEGAFHGRTLATIAATGQEKYLEGFGPLVDGFDQVPFGDI  165 (389)
T ss_pred             CCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCHHHCCCCCCCCCCEEECCCCCH
T ss_conf             67687999687489999999999998885399997289998888886763511357884433666899888246778978


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             88754101233222233322221124621012322110223457213101100344445553101112454530210344
Q gi|254780432|r  167 QSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG  246 (392)
Q Consensus       167 ~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~  246 (392)
T Consensus       166 ~~l~~~~~~~iAaviiEPi~g~gG~~~~~~~yl~~l~~lc~~~g~llI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gK~  245 (389)
T PRK01278        166 EALKAAITPNTAAILIEPIQGEGGIRPLPDEFLKGLRQLCDENGLLLIFDEVQCGVGRTGKLFAHEWAGVTPDIMALAKG  245 (389)
T ss_pred             HHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCHHHCCCCCCCEEEECCC
T ss_conf             99998628881799996888888960699999999999998606538742100077755664220036768986787012


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             44443443210001112222233223453211110012334554320122210112100002688999988679707550
Q gi|254780432|r  247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEV  326 (392)
Q Consensus       247 l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~v  326 (392)
T Consensus       246 l~gG~P~sav~~~~ei~~~~~~g~~~~T~~gnp~~~aaala~L~~i~~~~l~~~v~~~G~~l~~~L~~l~~~~p~~i~~v  325 (389)
T PRK01278        246 IGGGFPLGACLATEEAAKGMTPGTHGSTYGGNPLAMAVGNAVLDVVLAPGFLDNVQKMGLYLKQKLESLVDRFPDVIEEV  325 (389)
T ss_pred             CCCCCCEEEEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             46887427998638878543688767799979999999999999998646999999999999999999987686713556


Q ss_pred             CCCEEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             4640099987249989999999968989962689889955898688999999999999999985
Q gi|254780432|r  327 RGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       327 RG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
T Consensus       326 RG~Gl~~gie~~~~~~~i~~~~~~~Gll~~~~g~~~lr~~PpL~it~~ei~~~~~~l~~al~~v  389 (389)
T PRK01278        326 RGEGLMLGLKCVVPSRDLVAALRDEGLLTVPAGDNVVRLLPPLIITEEEIDEALERLERAAESL  389 (389)
T ss_pred             EEEEEEEEEEECCCHHHHHHHHHHCCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             4503699999458899999999979938972799979997881398999999999999999759