HHsearch alignment for GI: 254780432 and conserved domain: PRK02610

>PRK02610 histidinol-phosphate aminotransferase; Provisional.
Probab=99.42  E-value=1.1e-11  Score=96.78  Aligned_cols=326  Identities=16%  Similarity=0.169  Sum_probs=186.6

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHH----------CCCCCCCCCCCCC
Q ss_conf             997646410226743578789999999999997314506875781899999865201----------0133312356555
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHS----------TFADRVFFTNSGA   99 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~----------~~~~~v~f~~SGs   99 (392)
T Consensus        23 ~~~~~ikL~~N--Enp~g~-p~~v~eai~~~~~~~~~-~~rYPd~~~~~Lr~aiA~~~~~~~~~~~~v~~e~I~vgnGs~   98 (369)
T PRK02610         23 TAPALDRLDTN--ESPYDL-PTDLKQKLAWLYQQGIA-SNRYPDGGHLALKQAIAEYVNESTAGSWQITPANISVGNGSD   98 (369)
T ss_pred             CCCCCEECCCC--CCCCCC-CHHHHHHHHHHHHCCHH-CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCHH
T ss_conf             78782572398--989999-98999999999870312-065999987999999998857554555689815699848999


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCC---
Q ss_conf             40356777665432001347860023435465654321234553211347999864333222100268875410123---
Q gi|254780432|r  100 ESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND---  176 (392)
Q Consensus       100 eA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~---  176 (392)
T Consensus        99 eli~~l~~a~~-------~~~~~~vl~~~Ptf~~Y~~~a-~~~g~~~~~v~~~~--~~f----~~d~~~~~~~i~~~~~~  164 (369)
T PRK02610         99 ELIRSLLIATC-------LGGEGSILVAEPTFSMYGILA-QTLGIPVVRVGRDP--ENF----EIDLAAAQTAIEQTQNP  164 (369)
T ss_pred             HHHHHHHHHHH-------CCCCCEEEECCCCHHHHHHHH-HHCCCEEEEECCCC--CCC----CCCHHHHHHHHHHCCCC
T ss_conf             99999999995-------489985996787655899999-97596279945764--366----56989999999855598


Q ss_pred             -C-CCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CC
Q ss_conf             -3-2222333222211246210123221102234572131011003444455531011124545302---1034444-44
Q gi|254780432|r  177 -T-AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GG  250 (392)
Q Consensus       177 -i-Aavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG  250 (392)
T Consensus       165 ~~klv~l~nPNNPT-G~~-~~~~~l~~l~~~~~--~~~vvvDEaY~ef~~--~s-~~~~~~~~~NlivlrTfSK~~glaG  237 (369)
T PRK02610        165 PVRVVFVVHPNSPT-GNP-LTAAELEWLRSLPE--DILVVIDEAYFEFSQ--TT-LVPELAQHPNWVILRTFSKAFRLAA  237 (369)
T ss_pred             CCEEEEECCCCCCC-CCC-CCHHHHHHHHHCCC--CEEEEECCCEEECCC--CC-CCHHHHCCCCEEEEECCCHHHCCCC
T ss_conf             82399978996972-656-79999999984699--769983367602155--53-2102431787589852634406766


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCE
Q ss_conf             34432100011122222332234532111100123345543201222101121000026889999886797075504640
Q gi|254780432|r  251 FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQG  330 (392)
Q Consensus       251 ~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G  330 (392)
T Consensus       238 lRlGy~ia~~~~i~~l~~~~--~p~~v~~~a~~aa~~aL~~~--~~~~~~~~~~~~-eR~~l~~~L~~l~g~-~v~ps~a  311 (369)
T PRK02610        238 HRVGYAIGHPELIAVLEKVR--LPYNLPSFSQAAAQLALEHR--DELLAAIPEILQ-ERDKLYRALQELPQL-RVWPSAA  311 (369)
T ss_pred             CCCEECCCCHHHHHHHHHHC--CCCCCCHHHHHHHHHHHCCH--HHHHHHHHHHHH-HHHHHHHHHHHCCCC-EECCCCC
T ss_conf             55131117999999999824--99884899999999997694--999999999999-999999999867997-7899986


Q ss_pred             EEEEEEEC--CCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             09998724--9989999999968989962689889955898688999999999999999985
Q gi|254780432|r  331 LLIGLKTV--FSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       331 l~~~ie~~--~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
T Consensus       312 NFil~~~~~~~~~~~~~~~L~~~Gi~VR~~~-~~lRIs---vgt~een~~~l~~Lk~~L~~~  369 (369)
T PRK02610        312 NFLFLRLQGAQDLAALHQALKNQGTLVRHTA-GGLRIT---IGTPEENQRTLARLQAALTQL  369 (369)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCEEECCCC-CEEEEE---ECCHHHHHHHHHHHHHHHHHC
T ss_conf             0899988997569999999982990999899-908999---499999999999999999619