HHsearch alignment for GI: 254780432 and conserved domain: PRK03158

>PRK03158 histidinol-phosphate aminotransferase; Provisional.
Probab=99.66  E-value=1.7e-14  Score=115.30  Aligned_cols=319  Identities=14%  Similarity=0.183  Sum_probs=202.6

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHH
Q ss_conf             764641022674357878999999999999731450687578189999986520101--333123565554035677766
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTA  109 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aikla  109 (392)
T Consensus        29 ~~ii~ls~N--enp~g~-~~~v~~a~~~~~~~~~~----YPd~~~~~Lr~~iA~~~gv~~~~I~v~nGs~e~i~~~~~~~  101 (359)
T PRK03158         29 SKIVKLASN--ENPFGC-SPRVTEALASEASQYAL----YPDGYAFELRTKVAKHLGVKEEQLIFGNGSDEVIQIISRAL  101 (359)
T ss_pred             CCEEEEECC--CCCCCC-CHHHHHHHHHHHHHCCC----CCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHHHH
T ss_conf             976895089--999999-99999999987873676----96988899999999986848677998478899999999998


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCCCCCC
Q ss_conf             543200134786002343546565432123455321134799986433322210026887541012332222-3332222
Q gi|254780432|r  110 RRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL-IEPIQGE  188 (392)
Q Consensus       110 r~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi-~Epv~g~  188 (392)
T Consensus       102 ~-------~~g~~-vvi~~P~f~~Y~~~a~~~g~~~~-~---vpl~d-----~~~dl~~~~~~i~~~tklv~l~nPn-NP  163 (359)
T PRK03158        102 L-------HEGTN-TVMANPTFSQYRHNAVIEGAEVR-E---VPLKD-----GIHDLDAMLEAIDENTKIVWICNPN-NP  163 (359)
T ss_pred             H-------CCCCE-EECCCCEEEHHHHHHHHCCCEEE-E---ECCCC-----CCCCHHHHHHHCCCCCCEEEECCCC-CC
T ss_conf             0-------79981-11379820555999976285379-9---62677-----7669999997507588789974899-99


Q ss_pred             CCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-CCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             1124621012322110223457213101100344445553101-1124545302---1034444-443443210001112
Q gi|254780432|r  189 GGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-EWANVKPDIM---TIAKGMG-GGFPIGACLATNEVA  263 (392)
Q Consensus       189 ~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~i~  263 (392)
T Consensus       164 TG~-~~~~~~l~~l~~~~~~~-~~vvvDEaY~ef~~~~~~~~~~~l~~~~~nviv~rsfSK~~~laGlRlGy~ia~~~li  241 (359)
T PRK03158        164 TGT-YVEKQKLLAFLEKVPKS-VLVVLDEAYYEYVTAEDYPQTLPLLEKYENLMILRTFSKAYGLAALRVGYGIADEELI  241 (359)
T ss_pred             CCC-CCCCHHHHHHHHHCCCC-EEEEEEHHHHHHHCCCCCCCHHHHHHHCCCEEEECCCCHHCCCCCCCCEECCCCHHHH
T ss_conf             888-76523489999748577-2999722788873257862035676532562365156541068888522031899999


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCHHH
Q ss_conf             22223322345321111001233455432012221011210000268899998867970755046400999872499899
Q gi|254780432|r  264 ACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL  343 (392)
Q Consensus       264 ~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~~~  343 (392)
T Consensus       242 ~~l~~~~--~~~~v~~~aq~aa~aal~---d~~~~~~~~~~~~~~~~~~~~~l~~~-g~-~~~ps~anF~l~~~~~~~~~  314 (359)
T PRK03158        242 GQLEPAR--LPFNTSTIAQAAALAALE---DQAFIQECVKKNAEGLKQYYAFCKEY-GV-FYYPSQTNFVLIDLGIPGDE  314 (359)
T ss_pred             HHHHHHC--CCCCCHHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCCEEEEECCCCHHH
T ss_conf             9999853--886856999999999957---99999999999999999999999868-88-89999850899868999999


Q ss_pred             HHHHHHHCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             9999996898996268----9889955898688999999999999999
Q gi|254780432|r  344 LAAKFRDECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       344 ~~~~l~~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
T Consensus       315 ~~~~L~~~gi~Vr~g~~fg~~~~iRIs---vgt~~en~~ll~aL~~il  359 (359)
T PRK03158        315 VFEYLLKKGYIVRSGAALGFPTGIRIT---VGLKEENDEIIELLAELL  359 (359)
T ss_pred             HHHHHHHCCEEEEECCCCCCCCEEEEE---ECCHHHHHHHHHHHHHHC
T ss_conf             999998199399968989998989999---489999999999999869