HHsearch alignment for GI: 254780432 and conserved domain: PRK03262

>PRK03262 consensus.
Probab=98.92  E-value=4.8e-08  Score=73.07  Aligned_cols=286  Identities=16%  Similarity=0.213  Sum_probs=159.6

Q ss_pred             CCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             87578189999986520101--3331235655540356777665432001347860023435465654321234553211
Q gi|254780432|r   69 NLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQ  146 (392)
Q Consensus        69 ~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~  146 (392)
T Consensus        52 nrYPD~~~~~Lr~aiA~~~gv~~~~I~vGnGSdE~I~~i~~~f-------~~pg~d~vl~~~PtF~~Y~~~a-~~~g~~~  123 (355)
T PRK03262         52 NRYPECQPKAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAF-------CEPGKDAILYCPPTYGMYAVSA-ETIGVEI  123 (355)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCHHHEEEECCHHHHHHHHHHHH-------HCCCCCEEEECCCCHHHHHHHH-HHCCCEE
T ss_conf             0398998899999999986858557999378999999999998-------6389977997788859999999-9739838


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC
Q ss_conf             34799986433322210026887541012332222333222211246210123221102234572131011003444455
Q gi|254780432|r  147 YLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTG  226 (392)
Q Consensus       147 ~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG  226 (392)
T Consensus       124 ~~---vp~~~~~----~~dl~~~~~~~~~~klv~l~nPNNPT-G~~-~~~~el~~l~~~~~~-~~lvVvDEAY~eF~~~~  193 (355)
T PRK03262        124 RT---VPTLENW----QLDLQAIADNLDGVKVVYVCSPNNPT-GNL-INPQDLRTLLELTRG-KAIVVADEAYIEFCPQA  193 (355)
T ss_pred             EE---EECCCCC----CCCHHHHHHHCCCCCEEEECCCCCCC-CCC-CCHHHHHHHHHHCCC-CCEEEEECHHHHHCCCC
T ss_conf             99---6465566----76899999640488889976899987-644-699999999976876-72898730255436562


Q ss_pred             CCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH--
Q ss_conf             531011124545302---1034444-4434432100011122222332234532111100123345543201222101--
Q gi|254780432|r  227 KLFAYEWANVKPDIM---TIAKGMG-GGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN--  300 (392)
Q Consensus       227 ~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~--  300 (392)
T Consensus       194 s--~~~l~~~~~NliVlRTfSK~~gLAGlRlGy~ia~~~ii~~l~k~~~--p~~vn~~~~~~a~~al~~~~~~~~~~~i~  269 (355)
T PRK03262        194 S--LAGWLAEYPNLVILRTLSKAFALAGLRCGFTLANEEVINLLLKVIA--PYPLSTPVADIAAQALSPQGIEAMRERVA  269 (355)
T ss_pred             C--HHHHHHCCCCEEEEECHHHHHCCCCCCEEEEECCHHHHHHHHHHCC--CCCCCHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             1--5567640774467612677724665350543179999999998438--99877999999999972265999999999


Q ss_pred             -HHHHCCHHHHHHHHHHHHCCCEEEEE-CCCEEEEEEEECCCHHHHHHHHHHCCEEEEECC-----CCEEEECCCCCCCH
Q ss_conf             -12100002688999988679707550-464009998724998999999996898996268-----98899558986889
Q gi|254780432|r  301 -VINIAKILFEGLTAIKNRFPNMFLEV-RGQGLLIGLKTVFSPALLAAKFRDECLLTAPSS-----DNVVRILPPLTITA  373 (392)
Q Consensus       301 -~~~~g~~l~~~L~~l~~~~~~~v~~v-RG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~-----~~~irl~Ppl~it~  373 (392)
T Consensus       270 ~i~~~R~~l~~~L~~l----~-~~~~v~pS~aNFvl~~~-~~~~~~~~~L~~~gIlVR~~~~~~gl~~~lRis---igt~  340 (355)
T PRK03262        270 QINANRAWLIAALKEI----A-CVEQVFDSETNYILARF-TASSAVFKSLWDQGIILRDQNKQPSLSNCLRIT---IGTR  340 (355)
T ss_pred             HHHHHHHHHHHHHHHC----C-CCCEECCCCCCEEEEEC-CCHHHHHHHHHHCCCEEEECCCCCCCCCEEEEE---CCCH
T ss_conf             9999999999999848----9-98606899782899978-999999999996993896688878999989996---6999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999999
Q gi|254780432|r  374 EEIHEGLERIER  385 (392)
Q Consensus       374 ~eid~~i~~l~~  385 (392)
T Consensus       341 een~~~l~aLka  352 (355)
T PRK03262        341 EECQRVIDALRA  352 (355)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999999713