HHsearch alignment for GI: 254780432 and conserved domain: PRK04152

>PRK04152 consensus.
Probab=99.59  E-value=1.6e-13  Score=108.79  Aligned_cols=321  Identities=16%  Similarity=0.213  Sum_probs=192.3

Q ss_pred             ECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHH
Q ss_conf             6799764641022674357878999999999999731450687578189999986520101--33312356555403567
Q gi|254780432|r   28 SENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECA  105 (392)
Q Consensus        28 d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~A  105 (392)
T Consensus        27 g~~p~~ii~ls~N--eNP~g~p-~~~~~ai~~~~~~~~----~YPd~~~~~Lr~~iA~~~gv~~~~I~vgnGs~e~i~~~   99 (364)
T PRK04152         27 GIDPKDVIKLASN--ENPFGTS-PKVIEAIRKNASKAH----LYPDDSMFELKSALASKFDVESENIIIGAGSDQVIEFA   99 (364)
T ss_pred             CCCCCCEEEECCC--CCCCCCC-HHHHHHHHHHHHHCC----CCCCCCHHHHHHHHHHHHCCCHHEEEECCCHHHHHHHH
T ss_conf             9681247881799--9999999-999999998787376----79996799999999998695830099856999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHC-CCCCC-CCCCC
Q ss_conf             77665432001347860023435465654321234553211347999864333222100268875410-12332-22233
Q gi|254780432|r  106 IKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SNDTA-AILIE  183 (392)
Q Consensus       106 iklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~-~~~iA-avi~E  183 (392)
T Consensus       100 ~~~~~-------~~g-~~vl~~~Ptf~~Y~~~a~-~~g~~v~~------~~~~----~~dl~~~~~~~~~~~~~lv~l~n  160 (364)
T PRK04152        100 IHAKL-------NEK-SSVLMAGVTFAMYEIYAK-QCGAKIYK------TQSV----EHDLNEFLELYKSHKPKIIFLCL  160 (364)
T ss_pred             HHHHH-------CCC-CEEEECCCCHHHHHHHHH-HCCCEEEE------CCCC----CCCHHHHHHHHHCCCCCEEEECC
T ss_conf             99983-------899-844658987268999999-83987996------6874----33989999986377985899879


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC---CCCC-CCCCCCCCCEE---ECCCCCC-CCCCCCC
Q ss_conf             3222211246210123221102234572131011003444455---5310-11124545302---1034444-4434432
Q gi|254780432|r  184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTG---KLFA-YEWANVKPDIM---TIAKGMG-GGFPIGA  255 (392)
Q Consensus       184 pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG---~~f~-~e~~gi~PDi~---~~gK~l~-gG~P~sa  255 (392)
T Consensus       161 PNNP-TG~~-~~~~~l~~~~~~~~~-~~~vvvDEAY~ef~~~~~~~~~~~~~~l~~~~~nlivlrsfSK~~glaGlRlGy  237 (364)
T PRK04152        161 PNNP-LGEC-LDASEVYKFIKGIDE-DTLVVIDAAYMEFAKFKDSKKHIEPKELIKLFPNVIYLGTFSKAYGLGGMRVGY  237 (364)
T ss_pred             CCCC-CCCC-CCCCCHHHHHHHCCC-CCEEEEEHHHHHHHHCCCCCCCCCHHHHHHHCCCEEEEECCHHHCCCCCCCCCC
T ss_conf             9998-6724-665124999975455-776874167788860377534558899874279789983260523787773520


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEE
Q ss_conf             10001112222233223453211110012334554320122210112100002688999988679707550464009998
Q gi|254780432|r  256 CLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL  335 (392)
Q Consensus       256 v~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~i  335 (392)
T Consensus       238 ~ia~~~~i~~l~k~~--~p~~vn~~a~~aa~~aL~---~~~~~~~~~~~~~~er~~~~~~~~~~-g~-~~~ps~aNFil~  310 (364)
T PRK04152        238 GIANAEIISALYKLR--PPFNVTTLSLKAAIEALK---DEEFVEKTLENNFKEMKRYEEFAKEQ-GI-EFIDSYTNFITF  310 (364)
T ss_pred             CCCCHHHHHHHHHHC--CCCCCCHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCCEEEE
T ss_conf             138999999999853--898867999999999937---99999999999999999999998858-88-489998878989


Q ss_pred             EE--CCCHHHHHHHHHHCCEEEEEC---CCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             72--499899999999689899626---89889955898688999999999999999
Q gi|254780432|r  336 KT--VFSPALLAAKFRDECLLTAPS---SDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       336 e~--~~~~~~~~~~l~~~Gll~~~~---~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
T Consensus       311 ~~~~~~~a~~l~~~L~~~gI~VR~~~~~g~~~iRIs---vg~~een~~li~aL~~vL  364 (364)
T PRK04152        311 FFDERKNSTEISQKLLKKGIIVRNLKSYGLNAIRIT---IGTPEQNDRVFEELDKEL  364 (364)
T ss_pred             ECCCCCCHHHHHHHHHHCCEEEEECCCCCCCEEEEE---CCCHHHHHHHHHHHHHHC
T ss_conf             899999999999999968919985798996979997---399999999999999759