HHsearch alignment for GI: 254780432 and conserved domain: PRK04260

>PRK04260 acetylornithine aminotransferase; Provisional.
Probab=100.00  E-value=0  Score=767.56  Aligned_cols=374  Identities=41%  Similarity=0.695  Sum_probs=356.4

Q ss_pred             CEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             14515588887489850103799679976464102267435787899999999999973145068757818999998652
Q gi|254780432|r    5 DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLI   84 (392)
Q Consensus         5 ~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~   84 (392)
T Consensus         2 ~~~~~~y~~~Pi~~~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh-~p~i~~ai~~q~~~~~~~~~~~~~~~~~~la~~l~   80 (375)
T PRK04260          2 TYLFSNYKRAAIEFVKAEGNYLIDTTGKTYLDFSSGIGVTNLGF-HPQVQQALTDQAGLIWHSPNLYLSSLQEEVAQKLT   80 (375)
T ss_pred             CCCCCCCCCCCCCEEEEECCEEEECCCCEEEEECCCHHHHCCCC-CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCC
T ss_conf             70556689999888985749999697799999153787640278-99999999999856569874778899999998523


Q ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             01013331235655540356777665432001347860023435465654321234553211347999864333222100
Q gi|254780432|r   85 HSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFC  164 (392)
Q Consensus        85 ~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~  164 (392)
T Consensus        81 ~~~-~~~~~f~~SGSEAve~AlklAr~~------tgr~~ii~~~~~yHG~t~ga~s~tg~~~~~~~~~~~~p~~~~~~~~  153 (375)
T PRK04260         81 GDK-DYLAFFCNSGAEANEAAIKLARKA------TGKQEIITFQNSFHGRTFGAMSATGQDKIKQGFGDGVPHFSYAIFN  153 (375)
T ss_pred             CCC-CCEEEECCCHHHHHHHHHHHHHHC------CCCCEEEEECCCCCCCCCHHHHHCCCCCCCCCCCCCCCCEEEECCC
T ss_conf             666-747997086789999999987654------7998699977889967440122048743345778899873452104


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             26887541012332222333222211246210123221102234572131011003444455531011124545302103
Q gi|254780432|r  165 DLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA  244 (392)
Q Consensus       165 d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g  244 (392)
T Consensus       154 d~~~~~~~~~~~iAAiiiEpiqg~~G~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~g  233 (375)
T PRK04260        154 DLNSVKALVNKNTAAVMLELVQGESGVLPADKAFVKALADYCQETGILLIVDEVQTGIGRTGKLYAFEHYGIEPDIFTLA  233 (375)
T ss_pred             CHHHHHHHHCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCHHHCCCCCCCEEEEC
T ss_conf             58899986377835999981058898757898999999999998476257301211787656865543169888789871


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEE
Q ss_conf             44444434432100011122222332234532111100123345543201222101121000026889999886797075
Q gi|254780432|r  245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFL  324 (392)
Q Consensus       245 K~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~  324 (392)
T Consensus       234 Kglg~G~P~sav~~~~~i~~~~~~~~h~~T~~gnpla~aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~~~~~~~-~i~  312 (375)
T PRK04260        234 KGLANGLPVGAMLGKSSLGGAFGYGSHGSTFGGNKLSMAAAKATLEIMLTAGFLETVLSKGNKLQEQLQEALQDKE-TVT  312 (375)
T ss_pred             HHCCCCCCEEEEEECHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCC-CEE
T ss_conf             0104886439999867874466787857779989899999999999998646999999999999999999985399-737


Q ss_pred             EECCCEEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             504640099987249989999999968989962689889955898688999999999999999
Q gi|254780432|r  325 EVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       325 ~vRG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
T Consensus       313 ~vRG~Gl~~gie~~~~~~~~~~~~~~~Gll~~~~g~nvi~~~Ppl~it~~eid~~~~~l~~vF  375 (375)
T PRK04260        313 TVRGLGYMIGIETTADLSQLVQAARDKGLIILTAGTNVIRLLPPLTISKAEIEKGIAILSEIF  375 (375)
T ss_pred             EEEEEEEEEEEEECCCHHHHHHHHHHCCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             630557999999578999999999968969940799989998993488999999999999869