HHsearch alignment for GI: 254780432 and conserved domain: PRK04870

>PRK04870 histidinol-phosphate aminotransferase; Provisional.
Probab=99.45  E-value=1.7e-11  Score=95.68  Aligned_cols=314  Identities=18%  Similarity=0.204  Sum_probs=189.4

Q ss_pred             CCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCC--C-CCCCCCCCCCCHHHHHH
Q ss_conf             97646410226743578789999999999997314506875781899999865201013--3-31235655540356777
Q gi|254780432|r   31 GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFA--D-RVFFTNSGAESVECAIK  107 (392)
Q Consensus        31 G~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~~--~-~v~f~~SGseA~e~Aik  107 (392)
T Consensus        25 ~~~~ikL~~N--Enp~g~~-~~v~~ai~~~~~~~~--lnrYPd~~~~~Lr~~lA~~~gv~~~~~Ii~GnGSdElI~~i~~   99 (356)
T PRK04870         25 AAGFVKLDAM--ENPYPLP-AELQAELGERLAEVA--LNRYPDPRAAALKAALRAAMGVPAGADVLLGNGSDELIQLIAL   99 (356)
T ss_pred             CCCCEEEECC--CCCCCCC-HHHHHHHHHHHHCCC--CCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHH
T ss_conf             9998883278--8999989-999999999751224--3779899899999999998687987769981679999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC-CCCCC-CCCCC
Q ss_conf             66543200134786002343546565432123455321134799986433322210026887541012-33222-23332
Q gi|254780432|r  108 TARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-DTAAI-LIEPI  185 (392)
Q Consensus       108 lar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~-~iAav-i~Epv  185 (392)
T Consensus       100 ~~~-------~pg-d~vl~~~Ptf~~Y~~~a~~~g~~~-~~v---pl~~d~----~~d~~~~~~~i~~~~~klv~i~nPN  163 (356)
T PRK04870        100 ACA-------KPG-AKVLAPVPGFVMYRMSAKFAGLEF-VGV---PLTADF----TLDLPAMLAAIAEHRPALVYLAYPN  163 (356)
T ss_pred             HHH-------CCC-CEEEECCCCHHHHHHHHHHCCCEE-EEE---ECCCCC----CCCHHHHHHHHCCCCCCEEEECCCC
T ss_conf             981-------898-989976777668999999829879-998---468765----6212889987414687389976899


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCC
Q ss_conf             22211246210123221102234572131011003444455531011124545302---1034444-4434432100011
Q gi|254780432|r  186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GGFPIGACLATNE  261 (392)
Q Consensus       186 ~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~  261 (392)
T Consensus       164 NP-TG~~-~~~~---~l~~l~~~~~~lvVvDEAY~eF~~--~s~-~~~~~~~~nlivlRTfSK-~glaGlRvGy~ia~~~  234 (356)
T PRK04870        164 NP-TGNL-FDDA---DVEAIIAAAPGLVVIDEAYQPFAG--RSW-LPRAAEFPNVLVMRTVSK-LGLAGLRLGYLAGHPA  234 (356)
T ss_pred             CC-CCCC-CCHH---HHHHHHHCCCCEEEEECCCHHHCC--CCC-CHHHHCCCCEEEEECCCC-CCCCCCCEEEEEECHH
T ss_conf             97-6633-6878---899998506986552254075567--862-101203796899860541-0136566277750999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHH---CCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEEC
Q ss_conf             1222223322345321111001233455432012221011210---0002688999988679707550464009998724
Q gi|254780432|r  262 VAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI---AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV  338 (392)
Q Consensus       262 i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~---g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~  338 (392)
T Consensus       235 ~i~~l~k~~--~p~~vn~~a~~aa~~aL~d~--~~~~~~~~~~~~~R~~l~~~L~~l----~g~-~v~pS~aNFil~~~~  305 (356)
T PRK04870        235 WIAELDKVR--PPYNVNVLTQATALFALEHV--DVLDAQAAELRAERTRLAAALAAL----PGV-TVFPSAANFILVRVP  305 (356)
T ss_pred             HHHHHHHHC--CCCCCHHHHHHHHHHHHHCH--HHHHHHHHHHHHHHHHHHHHHHHC----CCC-EECCCCCEEEEEECC
T ss_conf             999997734--89873399999999997495--889999999999999999999836----997-888998808999889


Q ss_pred             CCHHHHHHHHHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99899999999689899626------89889955898688999999999999999
Q gi|254780432|r  339 FSPALLAAKFRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       339 ~~~~~~~~~l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
T Consensus       306 -~a~~l~~~L~~~gIlVR~~~~~~~~~~~~lRIs---igt~een~~ll~aLk~~L  356 (356)
T PRK04870        306 -DAAAVFDGLKTRRVLVKNVSGMHPLLANCLRVT---VGSPEENAQFLAALKLAL  356 (356)
T ss_pred             -CHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE---CCCHHHHHHHHHHHHHHC
T ss_conf             -999999999969909998898888899989998---399999999999999859