HHsearch alignment for GI: 254780432 and conserved domain: PRK05630

>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional.
Probab=100.00  E-value=0  Score=739.62  Aligned_cols=383  Identities=27%  Similarity=0.413  Sum_probs=339.2

Q ss_pred             CCCEECCCCCC---CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHH
Q ss_conf             43145155888---8748985010379967997646410226743578789999999999997314506-8757818999
Q gi|254780432|r    3 KNDFLFNTYDQ---SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEI   78 (392)
Q Consensus         3 ~~~~~~~~~~~---~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~   78 (392)
T Consensus        10 d~~~~~hp~~~~~~~p~vi~r~~G~~l~D~dG~~ylD~~~g~~~~~lGH~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~~   89 (423)
T PRK05630         10 DHRNIWHPYAAPGVRNRLVTKTDGVFLTLEDGSTVIDAMSSWWSAIHGHGHPRLKAAAQKQIDTMSHVMFGGLTHEPAIK   89 (423)
T ss_pred             HHHHCCCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHH
T ss_conf             88543789999999984499530488996998999984436887615369999999999998657673467757689999


Q ss_pred             HHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC
Q ss_conf             9986520101--33312356555403567776654320013478600234354656543212345532113479-99864
Q gi|254780432|r   79 FANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEG-FGPKI  155 (392)
Q Consensus        79 la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~-~~p~~  155 (392)
T Consensus        90 lae~L~~~~p~~~~~v~f~~SGsEAvE~AiKlAr~~~~~~g~~~r~~Ii~~~~~yHG~T~ga~s~t~~~~~~~~~~~~~~  169 (423)
T PRK05630         90 LTHKLLNLTGNPFDHVFYSDSGSVSVEVAIKMALQASKGQGHPERTKLLTWRSGYHGDTFTAMSVCDPENGMHSLWKGTL  169 (423)
T ss_pred             HHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHEECCCCCCCCCCCCCCC
T ss_conf             99999875447768899628728999999999999987438987634765558507766645411067666555557889


Q ss_pred             CCCCC--------CCCHH----HHHHHHHCCCCCCCCCCCCC-CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCC
Q ss_conf             33322--------21002----68875410123322223332-2221124621012322110223457213101100344
Q gi|254780432|r  156 EGFDQ--------AKFCD----LQSLKNQISNDTAAILIEPI-QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGY  222 (392)
Q Consensus       156 ~~~~~--------~~~~d----~~~l~~~~~~~iAavi~Epv-~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~  222 (392)
T Consensus       170 ~~~~~~p~p~~~~~~~~~~~~~l~~l~~~~~~~iAAii~EPi~qg~gG~~~p~~~yl~~lr~lc~~~gillI~DEV~TGf  249 (423)
T PRK05630        170 PEQIFAPAPPVRGSSPQAISEYLDSMELLIDETVSAIIIEPIVQGAGGMRFHDVALIEGVATLCKKHDRFLIVDEIATGF  249 (423)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEECCCCEECC
T ss_conf             87645689986788878999999999874388725999974677779956798799999998733068058636432058


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             44555310111245453021034444443-443210001112222233------22345321111001233455432012
Q gi|254780432|r  223 GRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG------SHGSTYGGNVLAMVLGEKVLNIIQSD  295 (392)
Q Consensus       223 GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~------~~~~T~~gnpl~~aaa~a~L~~l~~~  295 (392)
T Consensus       250 GRtG~~fa~e~~gV~PDivt~gK~l~gG~~Pl~av~~~~~i~~~~~~~~~~~~~~hg~T~~GnPl~~Aaa~a~l~~i~~~  329 (423)
T PRK05630        250 GRTGELFATLSNGVQPDIMCVGKALTGGFMSFAATLCTDKVAQLISTPNGGGALMHGPTFMANPLACAVSHASLEIIETG  329 (423)
T ss_pred             CCCCCCHHHHHCCCCCCEEEECCHHHCCCCCEEEEEECHHHHHHHCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             74565202765699776898762432886762799763899975427678876505479997889999999999999847


Q ss_pred             CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCH
Q ss_conf             221011210000268899998867970755046400999872499--899999999689899626898899558986889
Q gi|254780432|r  296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVVRILPPLTITA  373 (392)
Q Consensus       296 ~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~  373 (392)
T Consensus       330 ~l~~~~~~~g~~l~~~L~~L~-~~p-~V~dVRG~Glm~~vel~~~~~~~~~~~~~~~~Gl~~~~~g-~~l~i~PPL~it~  406 (423)
T PRK05630        330 MWQKQVKRIEAELIAGLSPLR-HLP-GVADVRVLGAIGVIEMEQNVNVEEATQAALDHGVWIRPFG-RLLYVMPPYITTS  406 (423)
T ss_pred             CHHHHHHHHHHHHHHHHHHHC-CCC-CEEEEEECCEEEEEEECCCCCHHHHHHHHHHCCCEEEECC-CEEEEECCCCCCH
T ss_conf             899999999999999999870-699-6787730554999995686569999999996994798539-9999938936899


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999999
Q gi|254780432|r  374 EEIHEGLERIERTAI  388 (392)
Q Consensus       374 ~eid~~i~~l~~al~  388 (392)
T Consensus       407 eei~~~~~~l~~alk  421 (423)
T PRK05630        407 EQCAQICTALHAAVK  421 (423)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             999999999999977