HHsearch alignment for GI: 254780432 and conserved domain: PRK05958

>PRK05958 8-amino-7-oxononanoate synthase; Reviewed.
Probab=99.97  E-value=2.4e-29  Score=212.31  Aligned_cols=340  Identities=20%  Similarity=0.226  Sum_probs=239.8

Q ss_pred             CCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCC--CC---CCCHHHHHHHHHHHH
Q ss_conf             8887489850103799679976464102267435787-89999999999997314506--87---578189999986520
Q gi|254780432|r   12 DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVS--NL---YQSTQQEIFANHLIH   85 (392)
Q Consensus        12 ~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~--~~---~~~~~~~~la~~L~~   85 (392)
T Consensus        20 ~r~~~~~~~~~g~~i~-i~gr~~lnFsSn---dYLGL~~hp~v~~a~~~a~~~yG~g~~~SRl~~G~~~~h~~LE~~lA~   95 (387)
T PRK05958         20 YRRLRPREGAQGRWLV-VDGRRMLNFASN---DYLGLANHPELIAAAQQAARRYGVGSGGSRLVTGNSPAHEALEAELAE   95 (387)
T ss_pred             CCCCCCCCCCCCCEEE-ECCEEEEEEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHCCCCHHHHHHHHHHHH
T ss_conf             8615544688888599-899799985665---424778999999999999998389886563230686999999999999


Q ss_pred             HCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             10133312356555403567776654320013478600234354656543212345532113479998643332221002
Q gi|254780432|r   86 STFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCD  165 (392)
Q Consensus        86 ~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d  165 (392)
T Consensus        96 ~~g~e~allf~SGy~An~~~i~al---------~~~~d~ii~D~~~HaSi~dG~~ls~------------a~~~~f~HnD  154 (387)
T PRK05958         96 WFGAERALLFSSGYAANLAVLTAL---------VGKGDLIVSDKLNHASLIDGARLSR------------AEVRRYPHND  154 (387)
T ss_pred             HHCCCCEEEECCCHHHHHHHHHHC---------CCCCCEEEEECCCCHHHHHHHHHCC------------CCEEEECCCC
T ss_conf             868996796455238666566532---------7899789971004698999887279------------9289968999


Q ss_pred             HHHHHHHCC---CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCC-CC-CCCCCCCCCCCCCCCCC--
Q ss_conf             688754101---233222233322221124621012322110223457213101100-34-44455531011124545--
Q gi|254780432|r  166 LQSLKNQIS---NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQ-TG-YGRTGKLFAYEWANVKP--  238 (392)
Q Consensus       166 ~~~l~~~~~---~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~-tG-~GRtG~~f~~e~~gi~P--  238 (392)
T Consensus       155 ~~~Le~~L~~~~~~~~~iv~egvySMdGd~ap----L~~i~~L~~~y~~~L~vDeAH~~Gv~G~~G~G~-~e~~~~~~~v  229 (387)
T PRK05958        155 VDALEALLAKWRAGRALIVTESVFSMDGDLAP----LAELVALARRHGAWLLVDEAHGTGVLGPQGRGL-AEAAGLAGEI  229 (387)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCCCCC----HHHHHHHHHHCCEEEEECCHHHCCCCCCCCCCH-HHHHCCCCCC
T ss_conf             99999999738898759997466577887668----999999999708478842622226337999848-9984788886


Q ss_pred             CEE--ECCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHHHHHH
Q ss_conf             302--10344444434432100011122222332--2345321111001233455432012-221011210000268899
Q gi|254780432|r  239 DIM--TIAKGMGGGFPIGACLATNEVAACMNQGS--HGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILFEGLT  313 (392)
Q Consensus       239 Di~--~~gK~l~gG~P~sav~~~~~i~~~~~~~~--~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~~~L~  313 (392)
T Consensus       230 di~~gTlsKA~gs~--GG~i~g~~~~i~~l~~~a~~~ifStalpP~~~aa~~~al~~i~~~~~~~~~L~~n~~~~~~~l~  307 (387)
T PRK05958        230 VILVGTLGKALGSS--GAAVLGSETLIDYLINRARPFIFTTALPPAQAAAARAALRILREEPERRERLAALIARLRAGLR  307 (387)
T ss_pred             EEEECCCCCCCCCC--CEEEEECHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
T ss_conf             89976054445677--4399507899999987390203158887799999999999986095999999999999986457


Q ss_pred             HHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             998867970755046400999872499--899999999689899626-------89889955898688999999999999
Q gi|254780432|r  314 AIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPS-------SDNVVRILPPLTITAEEIHEGLERIE  384 (392)
Q Consensus       314 ~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i~~l~  384 (392)
T Consensus       308 ~~g~~~~~s------~spIipi~ig~~~~~~~~~~~L~~~Gi~v~~i~~PtVp~~~~rlRi~i~a~ht~~dId~l~~~l~  381 (387)
T PRK05958        308 ALGLGLPDS------ESAIQPLIVGDNERALALAAALQAQGFWVGAIRPPTVPAGTSRLRITLTAAHTEADIDRLLEALA  381 (387)
T ss_pred             HCCCCCCCC------CCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             539985899------99879999699999999999999779528317899889998449999787799999999999999


Q ss_pred             HHHHH
Q ss_conf             99998
Q gi|254780432|r  385 RTAIK  389 (392)
Q Consensus       385 ~al~~  389 (392)
T Consensus       382 e~~~~  386 (387)
T PRK05958        382 EALAA  386 (387)
T ss_pred             HHHHH
T ss_conf             99950