HHsearch alignment for GI: 254780432 and conserved domain: PRK05994

>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated.
Probab=99.04  E-value=3.8e-09  Score=80.25  Aligned_cols=166  Identities=16%  Similarity=0.196  Sum_probs=113.3

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHH-HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             4506875781899999865201013331235655540356777-665432001347860023435465654321234553
Q gi|254780432|r   65 WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIK-TARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGG  143 (392)
Q Consensus        65 ~~~~~~~~~~~~~~la~~L~~~~~~~~v~f~~SGseA~e~Aik-lar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~  143 (392)
T Consensus        54 g~~YsR~gNPT~~~lE~~la~LEgg~~a~~~sSGmaAi~~~l~~ll--------~~Gd-~vv~~~~~Yggt~~~~~----  120 (426)
T PRK05994         54 GNIYTRITNPTTAVLEERVAALEGGTAALAVASGHAAQFLVFHTLL--------QPGD-EFIAARKLYGGSINQFG----  120 (426)
T ss_pred             CCEECCCCCHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHH--------CCCC-EEEECCCCCHHHHHHHH----
T ss_conf             9711499886699999999998599728994488999999999972--------7899-89984874268999999----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC
Q ss_conf             21134799986433322210026887541012332222333222211246210123221102234572131011003444
Q gi|254780432|r  144 KLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG  223 (392)
Q Consensus       144 ~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G  223 (392)
T Consensus       121 --~~l~~~Gi---~v~~~d~~d~~~~~~~i~~~T~lv~~EspsNP~-l~v~D---i~~ia~iA~~~g~~~vVDNT~a---  188 (426)
T PRK05994        121 --HAFKSFGW---QVRWADADDPASFEAAITPRTKAIFIESIANPG-GTITD---IEAIAEVAHRAGLPLIVDNTLA---  188 (426)
T ss_pred             --HHHHHCCE---EEEEECCCCHHHHHHHCCCCCEEEEEECCCCCC-CCCCC---HHHHHHHHHHCCCEEEEECCCC---
T ss_conf             --99860886---999978998388997368875499998789988-72347---8999999997199178635652---


Q ss_pred             CCCCCCCCCCCCCCCCEEE--CCCCCCC-CCCCCCCCC
Q ss_conf             4555310111245453021--0344444-434432100
Q gi|254780432|r  224 RTGKLFAYEWANVKPDIMT--IAKGMGG-GFPIGACLA  258 (392)
Q Consensus       224 RtG~~f~~e~~gi~PDi~~--~gK~l~g-G~P~sav~~  258 (392)
T Consensus       189 -t--P~~~~Pl~~GaDivvhS~TKyi~GHsDvlgG~vv  223 (426)
T PRK05994        189 -S--PYLIRPIEHGADIVVHSLTKFLGGHGNSMGGIIV  223 (426)
T ss_pred             -H--HHHCCHHHHCCCEEEEECCCCCCCCCCEEEEEEE
T ss_conf             -0--4315867748988999645103588763788885