HHsearch alignment for GI: 254780432 and conserved domain: PRK06108

>PRK06108 aspartate aminotransferase; Provisional.
Probab=99.68  E-value=6e-15  Score=118.21  Aligned_cols=335  Identities=17%  Similarity=0.169  Sum_probs=198.5

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCHH
Q ss_conf             99764641022674357878999999999999731--450687578189999986520101----333123565554035
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESVE  103 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~--~~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~e  103 (392)
T Consensus        22 ~~~dvi~l~vg--dpDf-~~p~~i~~a~~~~~~~g~~~Y~~~~G~~~lreaia~~~~~~~g~~v~~d~I~it~G~~~al~   98 (382)
T PRK06108         22 GREDVLPFWFG--ESDL-PTPDFIRDAAAAALADGETFYTHNLGIPELREALARYVSRLHGATTPPERIAVTSSGVQALM   98 (382)
T ss_pred             CCCCCEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHHHH
T ss_conf             89991788898--9899-98899999999998479983799988699999999999998788986684998078999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-
Q ss_conf             6777665432001347860023435465654321234553211347999864333222100268875410123322223-
Q gi|254780432|r  104 CAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI-  182 (392)
Q Consensus       104 ~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~-  182 (392)
T Consensus        99 ~~~~~~~-------~pG-D~Vlv~~P~Y~~~~~~~~~~g~~~~~----vpl~~~-~~~~~~d~~~le~~~~~~~k~iil~  165 (382)
T PRK06108         99 LAAQALV-------GPG-DEVVAVTPAWPNLVAAPKILGARVVC----VPLQYG-GGGWQLDVDRLLAAITPRTRALFIN  165 (382)
T ss_pred             HHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEE----CCCCCC-CCCCCCCHHHHHHHCCCCCEEEEEC
T ss_conf             9999966-------999-98998168786569999973882785----345666-7886679999996457566499988


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCC--C-CCCCCCCCE---EECCCCCC-CCCCCCC
Q ss_conf             332222112462101232211022345721310110034444555310--1-112454530---21034444-4434432
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA--Y-EWANVKPDI---MTIAKGMG-GGFPIGA  255 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~--~-e~~gi~PDi---~~~gK~l~-gG~P~sa  255 (392)
T Consensus       166 ~P-~NPtG~-v~s~e~l~~l~~la~~~~v~iisDEiY~~l~f~~~~~~ps~~~~~~~~~~~i~~~S~SK~f~~~G~RiG~  243 (382)
T PRK06108        166 SP-NNPTGW-TASRDDQQAILAHCRRHGLWIVADEVYERLYYGGGGRAPSFLDIAEPDDRIIFVNSFSKNWAMTGWRLGW  243 (382)
T ss_pred             CC-CCCCCH-HCCHHHHHHHHHHHHCCCCEEECHHHHHHHCCCCCCCCCHHHHHCCCCCEEEEEECCCHHCCCCCCEEEE
T ss_conf             99-699662-0447889999998762697535334333301389988834665236676499980430310476761799


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEE
Q ss_conf             100011122222332234532111100123345543201--222101121000026889999886797075504640099
Q gi|254780432|r  256 CLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLI  333 (392)
Q Consensus       256 v~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~  333 (392)
T Consensus       244 ii~~~~~~~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~~~~~r~~l~~~l~~----~~~~-~~~~P~g~~y  318 (382)
T PRK06108        244 LVAPPSLGQDLEKLIEYNTSCVPQFVQRAAVAALDEGEDFVAQLVARLRRARDHLVDALRA----LPGV-EVPKPDGAMY  318 (382)
T ss_pred             EEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH----CCCC-EECCCCEEEE
T ss_conf             9979999999999998703777689999999999686265899999999999999999973----7996-8737882799


Q ss_pred             -EEEEC--CCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             -98724--99899999999-689899626------8988995589868899999999999999998
Q gi|254780432|r  334 -GLKTV--FSPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       334 -~ie~~--~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
T Consensus       319 ~w~~~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~g~~~iRl~--~a~~~~~l~eal~RL~~~l~k  382 (382)
T PRK06108        319 AFFRLDGATDSLALAKRLVDEAGLGLAPGTAFGPGGEGFLRWC--FARDPARLDEGVERLRRFLAR  382 (382)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHCC
T ss_conf             9887999999999999999969999987841188999979999--629999999999999999667