HHsearch alignment for GI: 254780432 and conserved domain: PRK06173

>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional.
Probab=100.00  E-value=0  Score=744.12  Aligned_cols=387  Identities=27%  Similarity=0.457  Sum_probs=339.6

Q ss_pred             CCCEECCCCCC----CCE-EEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHH
Q ss_conf             43145155888----874-8985010379967997646410226743578789999999999997314506-87578189
Q gi|254780432|r    3 KNDFLFNTYDQ----SDI-RFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQ   76 (392)
Q Consensus         3 ~~~~~~~~~~~----~p~-~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~   76 (392)
T Consensus        10 d~~~~~h~~~~~~~~~p~~~i~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~ql~~l~~~~~~~~~~~~~   89 (429)
T PRK06173         10 DRQHIWHPYSSVTDPIPLYPVERADGVMITLKDGRRLIDGMSSWWAALHGYNHPRLNAAATNQLSKMSHIMFGGFTHEPA   89 (429)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEECCCCEEEECCCCEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHH
T ss_conf             99657888766678899701684621789979999999856328853237998999999999997577855677577799


Q ss_pred             HHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC
Q ss_conf             999986520101--33312356555403567776654320013478600234354656543212345532113-479998
Q gi|254780432|r   77 EIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQY-LEGFGP  153 (392)
Q Consensus        77 ~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~-~~~~~p  153 (392)
T Consensus        90 ~~lae~L~~~~p~~l~~v~f~~SGsEAvE~AiKlA~~y~~~~g~~~r~~ii~~~~~yHG~T~~a~s~~~~~~~~~~~~~~  169 (429)
T PRK06173         90 VELAQLLLEILPPELNKIFFADSGSVAVEVAMKMALQYQQAKGEVQRTKFATIRSGYHGDTWHAMSVCDPVTGMHGLFNS  169 (429)
T ss_pred             HHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHCCCCCCCCCCCCCC
T ss_conf             99999999847977587997186599999999999999997289876526750588588757677605764466666678


Q ss_pred             CCCC-----CCCCC------CHHHHHHHH---HCCCCCCCCCCCCC-CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC
Q ss_conf             6433-----32221------002688754---10123322223332-222112462101232211022345721310110
Q gi|254780432|r  154 KIEG-----FDQAK------FCDLQSLKN---QISNDTAAILIEPI-QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV  218 (392)
Q Consensus       154 ~~~~-----~~~~~------~~d~~~l~~---~~~~~iAavi~Epv-~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV  218 (392)
T Consensus       170 ~~p~~~~~p~~~~~~~~~~~~~~~~~l~~~~~~~~~~iAavi~EPi~qg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV  249 (429)
T PRK06173        170 SLPVQYFLPQPSVKFGEAWRDEAIEPLQDLLEQHGDEIAALILEPVVQGAGGMYFYSPTYLVKARELCDQYGVLLIFDEI  249 (429)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             89865346899876565422779999999998558863699998644678986678999999999875124855773013


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             034444555310111245453021034444443-443210001112222233-----22345321111001233455432
Q gi|254780432|r  219 QTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG-----SHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       219 ~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~-----~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
T Consensus       250 ~tGfGRtG~~fa~e~~gv~PDivt~gKglggG~~P~~avi~~~~i~~~~~~g~~~~f~hg~T~~Gnpla~Aaa~a~L~~i  329 (429)
T PRK06173        250 ATGFGRTGKLFALEHAGVVPDIMCIGKALTGGYLTLSATITTEEIAQTICSGEAKCFMHGPTFMANPLACAIAAESIRLL  329 (429)
T ss_pred             CCCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             20687366844532368999789855445688776178987689996424687666352789986899999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEEEECCCCC
Q ss_conf             012221011210000268899998867970755046400999872499--899999999689899626898899558986
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVVRILPPLT  370 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~  370 (392)
T Consensus       330 ~~~~l~~~~~~~g~~l~~~L~~~~-~~~-~v~dVRG~Gl~~~iel~~~~~~~~l~~~~~~~Gll~~~~g-~~l~l~PPL~  406 (429)
T PRK06173        330 LESPWQQNIQRIERQLRQELSPAA-EFD-YVAEVRVLGAIGVVEMKSPVDMATLQPRFVEHGIWVRPFG-KLVYLMPPFI  406 (429)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHC-CCC-CEEEECCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEECC-CEEEEECCCC
T ss_conf             864699999999999999999631-699-6687423572999994684569999999996995898349-9899958936


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899999999999999998529
Q gi|254780432|r  371 ITAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       371 it~~eid~~i~~l~~al~~L~~  392 (392)
T Consensus       407 it~~ei~~~~~~l~~aL~e~~~  428 (429)
T PRK06173        407 ISQDELTQLTSGLLRVLTQEYN  428 (429)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHC
T ss_conf             8999999999999999999854