HHsearch alignment for GI: 254780432 and conserved domain: PRK06209

>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional.
Probab=100.00  E-value=0  Score=606.41  Aligned_cols=351  Identities=19%  Similarity=0.300  Sum_probs=292.8

Q ss_pred             CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC-CCCC
Q ss_conf             874898501037996799764641022674357878999999999999731450687578189999986520101-3331
Q gi|254780432|r   14 SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF-ADRV   92 (392)
Q Consensus        14 ~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~-~~~v   92 (392)
T Consensus        30 ~P~~i~rg~G~~l~D~dG~~YlD~~~g~~~~~lGH~~p~i~~Ai~~Ql~~~~~~~--~~~~~~~~~ae~l~~~~p~~~~v  107 (431)
T PRK06209         30 APGFLQRGKGAHVWDVDGNEYIEYGMGLRAVGLGHAYPPVVEAVREALQDGCNFT--RPSAIELDAAELFLDLIDGAEMV  107 (431)
T ss_pred             CCCEEEEEECCEEEECCCCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCC--CCCHHHHHHHHHHHHHCCCCCEE
T ss_conf             9827996433989979879999846649989773796999999999997526554--76589999999999758986569


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCC-CCCCCCC---CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHH
Q ss_conf             23565554035677766543200134786002343-5465654---32123455321134799-9864333222100268
Q gi|254780432|r   93 FFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTF-EGAFHGR---TLATISAGGKLQYLEGF-GPKIEGFDQAKFCDLQ  167 (392)
Q Consensus        93 ~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~-~~~yHG~---t~~a~s~s~~~~~~~~~-~p~~~~~~~~~~~d~~  167 (392)
T Consensus       108 ~F~nSGsEA~e~AlklAR~~------tgr~~i~~~~~~~~~~~~~~~~g~~~~~~------g~~~~~~~~~~~~~y~d~~  175 (431)
T PRK06209        108 KFCKNGSDATSAAVRLARAY------TGRDLVARCADHPFFSTDDWFIGTTPMSA------GIPASVSALTKTFRYNDIA  175 (431)
T ss_pred             EECCCCCHHHHHHHHHHHHH------HCCCEEEECCCCCEEECCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCHH
T ss_conf             87278837899999999997------59953777057755643566557876557------8887545666564765599


Q ss_pred             HHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             875410---12332222333222211246210123221102234572131011003444455531011124545302103
Q gi|254780432|r  168 SLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA  244 (392)
Q Consensus       168 ~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g  244 (392)
T Consensus       176 ~le~~~~~~~~~iAAvIvEPi~g~----~p~~~fl~~lr~lc~~~giLLI~DEV~TGf-R~g~~~a~~~~gv~PDi~t~g  250 (431)
T PRK06209        176 SLEALFEDYPGRIACVILEPATAD----EPQDNFLHEVQRLCHENGALFILDEMITGF-RWHMRGAQKLYGIVPDLSCFG  250 (431)
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCC----CCCHHHHHHHHHHHHHCCCEEEECCCCCCC-CCCCCCHHHHCCCCCCEEEEH
T ss_conf             999987645566678885031377----897899999999998729079970560266-167522766208998799870


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC--------CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHH
Q ss_conf             44444434432100011122222--------3322345321111001233455432012221011210000268899998
Q gi|254780432|r  245 KGMGGGFPIGACLATNEVAACMN--------QGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIK  316 (392)
Q Consensus       245 K~l~gG~P~sav~~~~~i~~~~~--------~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~  316 (392)
T Consensus       251 K~iggG~Pi~Av~g~~eim~~~~~~~~~~~~~f~~~~T~~g~p~~~AAalatL~~~~~~~l~~~~~~~G~~L~~~l~~l~  330 (431)
T PRK06209        251 KAMGNGFSISALAGKREYMELGGLEHTDFERVFLLSTTHGAETHALAAAIATMAIYREEDVIERLWEQGAKLAAGVNEAA  330 (431)
T ss_pred             HHHHCCCCCEEEEEHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             13228888057778699764035556786654110457788879999999999999854499999999999999999999


Q ss_pred             HHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             8679707550464009998724998----------999999996898996268988995589868899999999999999
Q gi|254780432|r  317 NRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLLT