HHsearch alignment for GI: 254780432 and conserved domain: PRK06836

>PRK06836 aspartate aminotransferase; Provisional.
Probab=99.54  E-value=5.4e-13  Score=105.39  Aligned_cols=329  Identities=19%  Similarity=0.219  Sum_probs=190.8

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC-----CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             7646410226743578789999999999997314-----50687578189999986520101----33312356555403
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW-----HVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~-----~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
T Consensus        34 ~dVI~l~iG--~Pdf-~~P~~i~~a~~~a~~~~~~~~~~Y~~~~G~~eLReaIa~~~~~~~g~~~~pe~Iiit~Ga~~al  110 (396)
T PRK06836         34 ENVFDFSLG--NPDV-EPPAAVKEALRELAEEEDPGMHGYMPNAGYPEVREAVAESLNARFGTPLTADHIVMTCGAAGAL  110 (396)
T ss_pred             CCEEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHHH
T ss_conf             985886895--9899-9779999999999967998888779874769999999999999868899589889858879999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
T Consensus       111 ~~~~~~ll-------~pG-D~Vlvp~P~y~~y~~~~~~~g~~~v~v----~~~~--e~-~~~d~~~l~~~i~~~tk~iil  175 (396)
T PRK06836        111 NVVLKALL-------NPG-DEVIIFAPYFVEYKFYVDNHGGKLVVV----PPDT--ED-FQPDLDALEAAITPKTKAVII  175 (396)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHCCCEEEEE----CCCC--CC-CCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999966-------999-989982786506899999849979993----1676--56-767999999736756629998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCC------CCCEEEECCCCCCCCCCCCCCCC--CCCCCCCCEEECCCCCC-CCCC
Q ss_conf             -33222211246210123221102234------57213101100344445553101--11245453021034444-4434
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDD------IDALLIFDEVQTGYGRTGKLFAY--EWANVKPDIMTIAKGMG-GGFP  252 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~------~g~llI~DEV~tG~GRtG~~f~~--e~~gi~PDi~~~gK~l~-gG~P  252 (392)
T Consensus       176 nsP-~NPTG~-v~s~e~l~~i~~l~~~~~~~~~h~i~vIsDEiY~~l~fd~~~~~s~~~~~d~~i~i~S~SK~~~m~G~R  253 (396)
T PRK06836        176 NSP-NNPTGV-IYSEETLKALGALLEEKSKEYGRPIYLISDEPYREIVYDGAEVPYIFKYYKNSIVVYSFSKSLSLPGER  253 (396)
T ss_pred             CCC-CCCCCC-CCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHCCCCCCCCCHHHCCCEEEEEECCCCCCCCCCCC
T ss_conf             689-898998-679999999999999865752886799805740753138987899577478299996464220467311


Q ss_pred             CCCCCCCCCCCCCC---CCCCCC-CCC--CCCCCCH-HHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             43210001112222---233223-453--2111100-1233455432012221011210000268899998867970755
Q gi|254780432|r  253 IGACLATNEVAACM---NQGSHG-STY--GGNVLAM-VLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLE  325 (392)
Q Consensus       253 ~sav~~~~~i~~~~---~~~~~~-~T~--~gnpl~~-aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~  325 (392)
T Consensus       254 iG~iv~~~~i~~~~~~~~~~~~~~~~~~~v~a~~~~q~a~~~~~~---~~~~~~~y~~rrd~l~~~L~~~-----g~-~~  324 (396)
T PRK06836        254 IGYIAVNPEMEDADDLMAALVFANRILGFVNAPSLMQRVVAKLQD---ATVDISIYKRRRDLLYDALTEL-----GF-EF  324 (396)
T ss_pred             EEEEEECHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCC---CCHHHHHHHHHHHHHHHHHHHC-----CC-EE
T ss_conf             699986889999999999999876550556588999999999746---7266999999999999999984-----98-63


Q ss_pred             ECCCEEEEEE-EE-CCCHHHHHHHHHHCCEEEEEC----CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             0464009998-72-499899999999689899626----898899558986889999999999999999852
Q gi|254780432|r  326 VRGQGLLIGL-KT-VFSPALLAAKFRDECLLTAPS----SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       326 vRG~Gl~~~i-e~-~~~~~~~~~~l~~~Gll~~~~----~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
T Consensus       325 ~~P~Gafyl~~~~p~~d~~~f~~~l~e~gV~vvPG~~Fg~~g~vRls--~a~~~e~i~eal~rl~~~~~e~k  394 (396)
T PRK06836        325 VKPQGAFYLFPKSPIEDDVAFVEKAQKYNILLVPGSGFGAPGYFRLA--YCVDTEQIERSLPAFEKLAKEYK  394 (396)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHCCEEEEECCCCCCCCCEEEE--ECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             17881689986189999999999999699999827435999808999--70899999999999999999863