HHsearch alignment for GI: 254780432 and conserved domain: PRK06917

>PRK06917 hypothetical protein; Provisional.
Probab=100.00  E-value=0  Score=748.34  Aligned_cols=387  Identities=30%  Similarity=0.478  Sum_probs=343.9

Q ss_pred             CCEE-CCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHHHH
Q ss_conf             3145-1558888748985010379967997646410226743578789999999999997314506-8757818999998
Q gi|254780432|r    4 NDFL-FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEIFAN   81 (392)
Q Consensus         4 ~~~~-~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~la~   81 (392)
T Consensus         2 ~~~~~~~~~~~p~Pvi~rg~G~~l~D~dG~~ylD~~sg~~~~~lGh~~p~i~~ai~~q~~~~~~~~~~~~~~~~~~~la~   81 (447)
T PRK06917          2 RDYLIKPLLGQPYPMISHGKGVYLYDQNGNKYFDGSSGAVTAGIGHGVKEIADVIKEQAEEVSFVYRSQFTSEPAEKLAK   81 (447)
T ss_pred             CCEECCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHH
T ss_conf             85003787899882699637799997997999983235898982899799999999998538873666424589999999


Q ss_pred             HHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             6520101--33312356555403567776654320013478600234354656543212345532113479998643332
Q gi|254780432|r   82 HLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFD  159 (392)
Q Consensus        82 ~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~  159 (392)
T Consensus        82 ~l~~~~p~~~~~~~f~~SGsEAvE~AiKlA~~y~~~r~~t~r~~Iis~~~syHG~T~ga~s~sg~~~~~~~~~~~~~~~~  161 (447)
T PRK06917         82 KLSDLSPGDLNWSFFVNSGSEANETAMKIAIQHWQERGIQGKHKILSRWMSYHGITMGALSMSGHPLRRQRFVSILEDYP  161 (447)
T ss_pred             HHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             99985788878799628789999999999999999838999848999505514666603662388211478788788977


Q ss_pred             CCCCHH-----------------HHHHHHHC----CCCCCCCCCCCCCCC-CCCCCCCHHHHHHHHCCCCCCCCEEEECC
Q ss_conf             221002-----------------68875410----123322223332222-11246210123221102234572131011
Q gi|254780432|r  160 QAKFCD-----------------LQSLKNQI----SNDTAAILIEPIQGE-GGVRKVPEEFLQQLRKICDDIDALLIFDE  217 (392)
Q Consensus       160 ~~~~~d-----------------~~~l~~~~----~~~iAavi~Epv~g~-~G~~~~~~~~l~~l~~lc~~~g~llI~DE  217 (392)
T Consensus       162 ~~~~p~~~r~~~~~~~~~~~~~~~~~le~~i~~~~~~~iAAvi~EPi~g~~Gg~~~p~~~yl~~lr~lc~~~gillI~DE  241 (447)
T PRK06917        162 TISAPYCYRCPVQKVYPTCQLACATELERSIERIGAEHIAAFIAEPIIGAAGGAVVPPKGYYKVIKDICSHYDILFIADE  241 (447)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEECCCCCEECCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             44898655777776540358999999999999738877469997130305797164687899999999652695289741


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             0034444555310111245453021034444443-4432100011122222332----2345321111001233455432
Q gi|254780432|r  218 VQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS----HGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       218 V~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~~----~~~T~~gnpl~~aaa~a~L~~l  292 (392)
T Consensus       242 V~tGfGRtG~~fa~e~~gv~PDii~~gK~l~gG~~Pl~av~~~~~i~~~~~~g~~~~~~g~Tf~gnpla~aaa~a~L~~l  321 (447)
T PRK06917        242 VMTGLGRTGAWFAMEHWGVEPDIMTLGKGLGAGYTPMAATVVSDRVMEPILRGSRSVMSGHTLSANPLSAATALAVIEYM  321 (447)
T ss_pred             CEECCCCCCCCCHHHHCCCCCCEEEECHHHCCCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             10078756874315335989778977401118987738998818988654058876201778989999999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------------HHHHHHHHHCCEEEEEC-
Q ss_conf             0122210112100002688999988679707550464009998724998-------------99999999689899626-
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------------ALLAAKFRDECLLTAPS-  358 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------------~~~~~~l~~~Gll~~~~-  358 (392)
T Consensus       322 ~~~~l~~~~~~~G~~l~~~L~~l~~~~-~~i~dVRG~GLm~giel~~d~~~~~~~~~~~~~a~~i~~~~~~~Gll~~~~~  400 (447)
T PRK06917        322 EKHNLPEKTAEKGEYLIKGLQEVQQQS-TIIGDVRGKGLLIGVEFVADQKTKKPFPQPFSKASELISVAAKNGLLLYPAV  400 (447)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECC
T ss_conf             864599999999999999999998639-9778765156169999842665567787248999999999997898898744


Q ss_pred             ------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             ------898899558986889999999999999999852
Q gi|254780432|r  359 ------SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       359 ------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
T Consensus       401 ~~~~g~~~~~lrl~PPL~it~~eid~~i~~l~~al~ev~  439 (447)
T PRK06917        401 SGQAGKEGSALLIAPPMTTTYSELDELLSIFAKSVEEMM  439 (447)
T ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             567789999899979922789999999999999999999