HHsearch alignment for GI: 254780432 and conserved domain: PRK06938

>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional.
Probab=100.00  E-value=0  Score=741.06  Aligned_cols=377  Identities=28%  Similarity=0.515  Sum_probs=336.3

Q ss_pred             EECCCC-CCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHH
Q ss_conf             451558-88874898501037996799764641022674357878999999999999731450-6875781899999865
Q gi|254780432|r    6 FLFNTY-DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV-SNLYQSTQQEIFANHL   83 (392)
Q Consensus         6 ~~~~~~-~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~-~~~~~~~~~~~la~~L   83 (392)
T Consensus        36 ~~~~~~~~~~P~~i~ra~G~~l~D~dG~~yLD~~sg~~~~~lGh~~p~i~~Ai~~ql~~~~~~~~~~~~~~~~~~la~~L  115 (464)
T PRK06938         36 SNARSYPRRIPLALKRARGIYVEDVEGRQFIDCLAGAGTLALGHNHPVVIEAIQQVLADELPLHTLDLTTPVKDQFVQDL  115 (464)
T ss_pred             HHHHCCCCCCCCCEEEEECCEEEECCCCEEEEECHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECCCCCHHHHHHHHHH
T ss_conf             12422588899627983648899798899999164088656707959999999999860898126785868999999999


Q ss_pred             HHHCCC-----CCCCC-CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             201013-----33123-565554035677766543200134786002343546565432123455321134799986433
Q gi|254780432|r   84 IHSTFA-----DRVFF-TNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEG  157 (392)
Q Consensus        84 ~~~~~~-----~~v~f-~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~  157 (392)
T Consensus       116 ~~~~p~~~~~~~~v~f~~~SGSEAvE~AiKlAR~~------tgr~~Iis~~~~YHG~T~gals~tg~~~~~~~~~~~~~~  189 (464)
T PRK06938        116 FGSLPEAFAKEAKIQFCGPTGTDAVEAALKLVKTA------TGRSTVLSFQGGYHGMSQGALSLMGNLGPKKPLGALLPG  189 (464)
T ss_pred             HHHCCHHHHCCCEEEEECCCCHHHHHHHHHHHHHC------CCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             99620555304408984798089999999998646------798859998347889706556541787555567888999


Q ss_pred             CCCCCCH-----------------HHHHHHHHCC------CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEE
Q ss_conf             3222100-----------------2688754101------2332222333222211246210123221102234572131
Q gi|254780432|r  158 FDQAKFC-----------------DLQSLKNQIS------NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLI  214 (392)
Q Consensus       158 ~~~~~~~-----------------d~~~l~~~~~------~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI  214 (392)
T Consensus       190 ~~~~p~p~~~r~p~~~~~~~~~~~~~~~le~~i~~~~~g~~~iAAvi~EpIqg~gGvi~~p~~yl~~lr~lc~~~giLlI  269 (464)
T PRK06938        190 VQFLPYPYDYRCPFGLGGEAGVRANLHYLENLLDDPESGVQLPAAVILEVVQGEGGVIPADDEWLRGLRRITEEAGIPLI  269 (464)
T ss_pred             CEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             67816886446766776156788889999999740540688248999888568779864998999999999866791598


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             01100344445553101112454530210344444434432100011122222332234532111100123345543201
Q gi|254780432|r  215 FDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS  294 (392)
Q Consensus       215 ~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~  294 (392)
T Consensus       270 ~DEVqtGfGRTG~~fa~e~~gv~PDiit~gKglgGg~Plsavi~~~~i-~~~~~g~h~~T~~gnpla~AaalavL~iie~  348 (464)
T PRK06938        270 VDEIQSGFGRTGKMFAFEHAGIIPDVVVLSKAIGGSLPLAVVVYREWL-DTWQPGAHAGTFRGNQMAMAAGSATLRYIKE  348 (464)
T ss_pred             CCCCCCCCCCCCCCHHHHHCCCCCCEEEECHHCCCCCCEEEEEECHHH-HHCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             642012677436840643236888879863000487734999982776-5047887487289998999999999999986


Q ss_pred             CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC----------------HHHHHHHHHHCCEEEEEC
Q ss_conf             2221011210000268899998867970755046400999872499----------------899999999689899626
Q gi|254780432|r  295 DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS----------------PALLAAKFRDECLLTAPS  358 (392)
Q Consensus       295 ~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~----------------~~~~~~~l~~~Gll~~~~  358 (392)
T Consensus       349 e~l~~~a~~~G~~l~~~L~~l~~~~p-~V~dVRG~GLm~giElv~~~~~~d~~~~~p~~~~~~~~v~~~~l~~Gll~~~~  427 (464)
T PRK06938        349 HRLAEHAAAMGERLLEHLRQLQRDYP-QLGDVRGRGLMLGVEIVDPQGEPDALGHPPANGELASRIQRECLRRGLILELG  427 (464)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEECCCEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             44999999999999999999985399-87976416069999984166664433356555899999999999789289646


Q ss_pred             C--CCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8--9889955898688999999999999999985
Q gi|254780432|r  359 S--DNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       359 ~--~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
T Consensus       428 g~~g~virl~PPL~it~eeid~~~~~l~~al~~a  461 (464)
T PRK06938        428 GRHGSVVRFLPPLIITAEQIDEVAEIFAEAVYAA  461 (464)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             8899989997991288999999999999999998