HHsearch alignment for GI: 254780432 and conserved domain: PRK07179

>PRK07179 hypothetical protein; Provisional.
Probab=99.95  E-value=7.5e-27  Score=196.03  Aligned_cols=323  Identities=17%  Similarity=0.223  Sum_probs=226.3

Q ss_pred             CCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCC---CCC--CCHHHHHHHHHHHHHCCCCCCCCCCCCCCCH
Q ss_conf             79976464102267435787-89999999999997314506---875--7818999998652010133312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVS---NLY--QSTQQEIFANHLIHSTFADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~---~~~--~~~~~~~la~~L~~~~~~~~v~f~~SGseA~  102 (392)
T Consensus        51 ~~G~~~i~fsSN---dYLGLs~hp~v~~a~~~ai~~~G~g~~~Srl~~G~~~~h~~LE~~LA~~~g~e~allf~SGy~AN  127 (408)
T PRK07179         51 TPGPDAIILQSN---DYLNLSGHPDIIKAQIAALQEYGDGLVMSAVFLHDDSPKPQFEKKLAAFTGFESGLLCQSGWAAN  127 (408)
T ss_pred             CCCCCEEEEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHH
T ss_conf             899735685766---63478899999999999999849998746803167589999999999986899299987538999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCC-CCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123-32222
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND-TAAIL  181 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~-iAavi  181 (392)
T Consensus       128 ~g~i~aL---------~~~~d~I~~D~~~HaSi~dG~rls~------------a~~~~f~HND~~~Le~~L~~~~~~iIv  186 (408)
T PRK07179        128 VGLLQTI---------ADPNTPVYIDFFAHMSLWEGVRAAG------------AQAHPFRHNDVDHLRRQIERHGPGIIV  186 (408)
T ss_pred             HHHHHHH---------CCCCCEEEEECCCCHHHHHHHHHCC------------CCEEEECCCCHHHHHHHHHHCCCCEEE
T ss_conf             9999996---------7999889998877888987676148------------857994799999999999846997799


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC---CCCCCCCCCCCCC--CCCEE--ECCCCCCC-CCCC
Q ss_conf             333222211246210123221102234572131011003444---4555310111245--45302--10344444-4344
Q gi|254780432|r  182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG---RTGKLFAYEWANV--KPDIM--TIAKGMGG-GFPI  253 (392)
Q Consensus       182 ~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G---RtG~~f~~e~~gi--~PDi~--~~gK~l~g-G~P~  253 (392)
T Consensus       187 ~egVfSMdGDiap----L~~l~~la~~y~a~L~VDEAH-~~Gv~G~~G~G-~~~~~gl~~~vdi~~gTlsKA~G~~G---  257 (408)
T PRK07179        187 VDSVYSTTGTIAP----LVDIVDIAEEFGCVLVVDESH-SLGTHGPQGAG-LVAELGLTSRVHFITASLAKAFAGRA---  257 (408)
T ss_pred             EEECCCCCCCCCC----HHHHHHHHHHHCEEEEEECCC-EEEEECCCCCC-HHHHCCCCCCCEEEEEEHHHHHHHCC---
T ss_conf             9742357887668----999999998726798861435-05236799987-79984998787289937178676376---


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC--CCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEEC-CC
Q ss_conf             3210001112222233223453--21111001233455432012-22101121000026889999886797075504-64
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTY--GGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILFEGLTAIKNRFPNMFLEVR-GQ  329 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~--~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vR-G~  329 (392)
T Consensus       258 Gfi~gs~~~id~L~~~ar~~IfStal~P~~~aa~~aal~ii~~~~~~r~~L~~n~~~~r~~L~~~G~-------~i~~s~  330 (408)
T PRK07179        258 GIITCPAELAEYFPFVSYPAIFSSTLLPHEIAGLEATLEVIESADERRARLHANARFLREGLSELGY-------NIRSSE  330 (408)
T ss_pred             CCEECCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCC-------CCCCCC
T ss_conf             6342379999999971877455666789999999999999862999999999999999999983799-------978999


Q ss_pred             EEEEEEEECCC--HHHHHHHHHHCCEEEE-------ECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             00999872499--8999999996898996-------26898899558986889999999999999999852
Q gi|254780432|r  330 GLLIGLKTVFS--PALLAAKFRDECLLTA-------PSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       330 Gl~~~ie~~~~--~~~~~~~l~~~Gll~~-------~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
T Consensus       331 spIvpi~~G~~~~a~~~~~~L~~~Gi~v~~i~~PtVP~g~~rlRislsA~ht~~dId~ll~~l~~~~~e~~  401 (408)
T PRK07179        331 SQIIALETGSERNTEVLRDALEERNVFGAVFCAPATPKNRALIRLSLNADLTKSDLDRVLEVCREARDEVD  401 (408)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99799985999999999999997896284167998999981699874877999999999999999999809