HHsearch alignment for GI: 254780432 and conserved domain: PRK07324

>PRK07324 transaminase; Validated.
Probab=99.74  E-value=1.6e-16  Score=128.42  Aligned_cols=306  Identities=18%  Similarity=0.212  Sum_probs=190.5

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             14506875781899999865201013331235655540356777665432001347860023435465654321234553
Q gi|254780432|r   64 LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGG  143 (392)
Q Consensus        64 ~~~~~~~~~~~~~~~la~~L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~  143 (392)
T Consensus        56 l~Y~~~~G~~~LR~~Ia~~y-~~v~~d~IlvT~Ga~~Al~l~~~~l~-------~pG-D~Viv~~P~Y~~~~~~~~~~G~  126 (373)
T PRK07324         56 LTYGWIEGSPEFKEAVASLY-QNVKPDNILQTNGATGANHLVLYALI-------EPG-DHVISVYPTYQQLYDIPESLGA  126 (373)
T ss_pred             CCCCCCCCCHHHHHHHHHHH-CCCCHHHEEECCCHHHHHHHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHCCC
T ss_conf             77788889899999999986-69986788986878999999999975-------999-9899889985779999998398


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC
Q ss_conf             21134799986433322210026887541012332222333222211246210123221102234572131011003444
Q gi|254780432|r  144 KLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG  223 (392)
Q Consensus       144 ~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G  223 (392)
T Consensus       127 ~v~~----~~l~~--~~~~~~Dl~~l~~~i~~~tkliil~nP~NPTG~-v~s~e~l~~l~~la~~~~i~iisDEiY~~l~  199 (373)
T PRK07324        127 EVDY----WKLRE--ENGWLPDLDELKRLVRPNTKLICINNANNPTGA-LMDRAFLEEIVEIAKSVDAYVLSDEVYRPLD  199 (373)
T ss_pred             EEEE----CCCCC--CCCCCCCHHHHHHHCCCCCEEEEECCCCCCCCC-CCCHHHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             7654----07672--259887999999618878769997999798897-7889999999987541785998125542235


Q ss_pred             CCCCCCCCCCCCCCCC---EEECCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             4555310111245453---021034444-443443210001112222233223453211110012334554320122210
Q gi|254780432|r  224 RTGKLFAYEWANVKPD---IMTIAKGMG-GGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE  299 (392)
Q Consensus       224 RtG~~f~~e~~gi~PD---i~~~gK~l~-gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~  299 (392)
T Consensus       200 ~~~~~~s~--~~~~~~~I~~~S~SK~~~l~GlRiGwiv~~~~li~~~~~~~~~~~i~~~~~~~~~a~~al~~--~~~~l~  275 (373)
T PRK07324        200 EEGSFPSI--ADLYEKGISTNSLSKTYSLPGIRVGWIATNEEVIDIFRKYRDYTMICAGVFDDMLASLALEH--RDAILE  275 (373)
T ss_pred             CCCCCCHH--HHHHHCEEEECCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC--HHHHHH
T ss_conf             79750105--65755758971541125677743799966999999999998653556656999999999968--399999


Q ss_pred             HHHHHCCHHHHHHHHHHHHCCCEEEEECCCEE---EEEEEECCCHHHHHHHHH-HCCEEEEECC----CCEEEECCCCCC
Q ss_conf             11210000268899998867970755046400---999872499899999999-6898996268----988995589868
Q gi|254780432|r  300 NVINIAKILFEGLTAIKNRFPNMFLEVRGQGL---LIGLKTVFSPALLAAKFR-DECLLTAPSS----DNVVRILPPLTI  371 (392)
Q Consensus       300 ~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl---~~~ie~~~~~~~~~~~l~-~~Gll~~~~~----~~~irl~Ppl~i  371 (392)
T Consensus       276 ~~~~~~~~n~~~l~~~l~~~~~-~~~~~P~gg~~~~~~~~~~~~~~~~~~~ll~~~gV~v~PG~~F~~~g~~Ri~--fa~  352 (373)
T PRK07324        276 RNRKIVRTNLAILDEWVAKEPR-VSYVKPKAVSTSFIKLDVDMDSEEFCEKLLKETGVLLVPGNRFDLEGHVRIG--YCC  352 (373)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCC-CEEECCCCCEEEEEECCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--EEC
T ss_conf             9999999999999999973888-5376358614799878999899999999999689999748865899949999--819


Q ss_pred             CHHHHHHHHHHHHHHHHHHCC
Q ss_conf             899999999999999998529
Q gi|254780432|r  372 TAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       372 t~~eid~~i~~l~~al~~L~~  392 (392)
T Consensus       353 ~~~~l~egl~RL~~~l~~l~~  373 (373)
T PRK07324        353 DTKTLKKGLKKLSEFLRKLDS  373 (373)
T ss_pred             CHHHHHHHHHHHHHHHHHHCC
T ss_conf             899999999999999997369