HHsearch alignment for GI: 254780432 and conserved domain: PRK07495

>PRK07495 4-aminobutyrate aminotransferase; Provisional.
Probab=100.00  E-value=0  Score=760.90  Aligned_cols=380  Identities=32%  Similarity=0.552  Sum_probs=344.8

Q ss_pred             CEECCCCC-CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCHHHHHHHHH
Q ss_conf             14515588-8874898501037996799764641022674357878999999999999731450687-578189999986
Q gi|254780432|r    5 DFLFNTYD-QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL-YQSTQQEIFANH   82 (392)
Q Consensus         5 ~~~~~~~~-~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~-~~~~~~~~la~~   82 (392)
T Consensus        10 ~~~~~~~~~~~pi~i~raeG~~l~D~dG~~ylD~~sg~~~~~lGh~~p~i~~Ai~~ql~~l~~~~~~~~~~~~~~~lae~   89 (422)
T PRK07495         10 AAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVVNTGHRHPKVIAAVKAQLDRFTHTCHQVVPYENYVRLAER   89 (422)
T ss_pred             HHCCCCCCCCCCEEEEECCCCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             75278778899879995503989989889999926088976345797999999999985466755665465799999999


Q ss_pred             HHHHCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             5201013---3312356555403567776654320013478600234354656543212345532-11347999864333
Q gi|254780432|r   83 LIHSTFA---DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK-LQYLEGFGPKIEGF  158 (392)
Q Consensus        83 L~~~~~~---~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~-~~~~~~~~p~~~~~  158 (392)
T Consensus        90 L~~~~p~~~~~~~~F~~SGsEAvE~AiKlAr~~------tgr~~iis~~~~yHG~T~~a~s~tg~~~~~~~~~~~~~~~~  163 (422)
T PRK07495         90 LNALVPGDFEKKTIFVTTGAEAVENAVKIARAA------TGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPPDV  163 (422)
T ss_pred             HHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHC------CCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             997568774547997278625999999975652------79987999878877864212431388765435678899993


Q ss_pred             CCCCCHH----------HHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC
Q ss_conf             2221002----------68875410-----12332222333222211246210123221102234572131011003444
Q gi|254780432|r  159 DQAKFCD----------LQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG  223 (392)
Q Consensus       159 ~~~~~~d----------~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G  223 (392)
T Consensus       164 ~~~p~p~~~~~~~~~~~~~~l~~~~~~~~~~~~iAAvIvEPiqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~TGfG  243 (422)
T PRK07495        164 FHVPFPVELHGVSVDQSLAALDKLFKADVDPQRVAAIIIEPVQGEGGFYPAPAAFMKALRELCDQHGILLIADEVQTGFA  243 (422)
T ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHCCCEEECCCCCCCCC
T ss_conf             67078832357766779999999987516877578999667647888663888999999999987396687763010887


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHH
Q ss_conf             45553101112454530210344444434432100011122222332234532111100123345543201222101121
Q gi|254780432|r  224 RTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN  303 (392)
Q Consensus       224 RtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~  303 (392)
T Consensus       244 RtG~~fa~e~~gv~PDiv~~gKgl~gG~Pl~av~~~~~i~~~~~~~~~~~Tf~Gnpla~aaa~a~L~i~~~~~l~~~~~~  323 (422)
T PRK07495        244 RTGKLFAMEHHEVAADLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPLGIAAAHAVLDVIEEEDLCERANQ  323 (422)
T ss_pred             CCCCCHHHHCCCCCCCEEEECHHHHCCCCCEEEEECHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHH
T ss_conf             66550265448999809996415428875168887399883558888666799898999999999999986489999999


Q ss_pred             HCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC---------HHHHHHHHHHCCEEEEECC--CCEEEECCCCCCC
Q ss_conf             0000268899998867970755046400999872499---------8999999996898996268--9889955898688
Q gi|254780432|r  304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS---------PALLAAKFRDE