HHsearch alignment for GI: 254780432 and conserved domain: PRK07550

>PRK07550 hypothetical protein; Provisional.
Probab=99.68  E-value=5.8e-15  Score=118.29  Aligned_cols=327  Identities=18%  Similarity=0.210  Sum_probs=198.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC---CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314---50687578189999986520101----3331235655540
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW---HVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAES  101 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~---~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA  101 (392)
T Consensus        27 ~~G~~vI~L~~G--~Pdf~-~p~~i~~a~~~a~~~~~~~~Y~~~~G~~~LR~aia~~~~~~~g~~~~pe~I~it~G~~~a  103 (387)
T PRK07550         27 PAGRPLIDLSQA--VPVYP-PPPELRRALAEAAGDPAAHLYGPVEGLPELREAYAAQYSRLYGAAINPGQVAITSGCNQA  103 (387)
T ss_pred             CCCCCEEECCCC--CCCCC-CCHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHH
T ss_conf             699971589898--89898-789999999999669888889898571999999999999986889967988987678999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             35677766543200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       102 ~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
T Consensus       104 l~~~~~al~-------~pG-D~Vli~~P~Y~~y~~~~~~~G~~~~~----vp~~~--~~~~~~d~~~le~~~~~~tk~ii  169 (387)
T PRK07550        104 FWAAMVTLA-------GAG-DEVILPTPWYFNHKMWLDMLGIRAVL----VPLDT--GPGLLPDPEAAAALITPRTRAIV  169 (387)
T ss_pred             HHHHHHHHC-------CCC-CEEEEECCCCCCHHHHHHHCCCEEEE----CCCCC--CCCCCCCHHHHHHHCCCCCCEEE
T ss_conf             999999971-------898-98998279675379999976998973----47775--67987799999975565783770


Q ss_pred             C-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCC-CCCCCCCCCCCC-------EEECCCCCC-CCC
Q ss_conf             3-332222112462101232211022345721310110034444555-310111245453-------021034444-443
Q gi|254780432|r  182 I-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGK-LFAYEWANVKPD-------IMTIAKGMG-GGF  251 (392)
Q Consensus       182 ~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~-~f~~e~~gi~PD-------i~~~gK~l~-gG~  251 (392)
T Consensus       170 l~~P-~NPtG~-v~s~e~l~~l~~la~~~~~~iI~DEiY~~~~~~~~~~~~~--~-~~~~~~~~vI~i~S~SK~~~~~G~  244 (387)
T PRK07550        170 LVTP-NNPTGV-VYPPELLHELYDLARRRGLALILDETYRDFDSRGGAPHDL--F-ADPDWGDTLVHLYSFSKAYRLTGH  244 (387)
T ss_pred             CCCC-CCCCCC-CCCHHHHHHHHHHCCCEEEEEEECCCHHHHHCCCCCCCCH--H-HCCCCCCEEEEECCCCCCCCCCCC
T ss_conf             3899-699885-1077985346543033158999417578753388777667--6-533667559997467644567542


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             4432100011122222332234532111100123345543201--22210112100002688999988679707550464
Q gi|254780432|r  252 PIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQ  329 (392)
Q Consensus       252 P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~  329 (392)
T Consensus       245 RiG~i~~~~~~i~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~~~~rr~~l~~~l~----~~~~~--~~~~~  318 (387)
T PRK07550        245 RVGALAASPARLAEIEKFLDTMAICAPRIGQIAVLWGIRNLADWVAGNRAEILRRRDALRAGFS----RLPGW--ELLAS  318 (387)
T ss_pred             EEEEEEECHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHH----HCCCC--EECCC
T ss_conf             1799983999999999999760367877999999999863099999999999999999999886----46896--54788


Q ss_pred             EEEEE-EEE---CCCHHHHHHHH-HHCCEEEEEC------CCCEEEECCCCC-CCHHHHHHHHHHHHH
Q ss_conf             00999-872---49989999999-9689899626------898899558986-889999999999999
Q gi|254780432|r  330 GLLIG-LKT---VFSPALLAAKF-RDECLLTAPS------SDNVVRILPPLT-ITAEEIHEGLERIER  385 (392)
Q Consensus       330 Gl~~~-ie~---~~~~~~~~~~l-~~~Gll~~~~------~~~~irl~Ppl~-it~~eid~~i~~l~~  385 (392)
T Consensus       319 G~~f~w~~~~~~~~~~~~~~~~ll~e~gV~v~PG~~Fg~~g~~~vRls--fa~~~~~~i~ea~~RL~~  384 (387)
T PRK07550        319 GAYFAYVRHPFPDASSDEVARRLAKEAGILCLPGTMFGPGGERYLRLA--FANIDVAGIAELVERLRG  384 (387)
T ss_pred             CEEEEEEECCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCCHHHHHHHHHHHHH
T ss_conf             347998837889989999999999869999978753388998979999--467999999999999986