HHsearch alignment for GI: 254780432 and conserved domain: PRK07812

>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated.
Probab=98.94  E-value=5.4e-08  Score=72.71  Aligned_cols=167  Identities=17%  Similarity=0.188  Sum_probs=112.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             45068757818999998652010133312356555403567776654320013478600234354656543212345532
Q gi|254780432|r   65 WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK  144 (392)
Q Consensus        65 ~~~~~~~~~~~~~~la~~L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~  144 (392)
T Consensus        60 g~~YsR~gNPT~~~LE~~la~LEg~~~a~~~sSGmaAi~~~ll-~ll------~~G-dhiv~~~~~YggT~~l~~-----  126 (436)
T PRK07812         60 GNIYTRIMNPTQDVVEQRIAALEGGVAALFLASGQAAETFAIL-NLA------GAG-DHIVSSPRLYGGTYNLFH-----  126 (436)
T ss_pred             CCEECCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHH-HHH------CCC-CEEEEECCCCCCHHHHHH-----
T ss_conf             9642089886699999999998299878996479999999999-961------889-889994886687899999-----


Q ss_pred             CCCCCCCCCCCCCCCCC-CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC
Q ss_conf             11347999864333222-10026887541012332222333222211246210123221102234572131011003444
Q gi|254780432|r  145 LQYLEGFGPKIEGFDQA-KFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG  223 (392)
Q Consensus       145 ~~~~~~~~p~~~~~~~~-~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G  223 (392)
T Consensus       127 -~~l~~~Gi---~v~fv~d~~d~~~~~~~i~~~Tklv~~EtpsNP~-l~v~D---i~~ia~iA~~~g~~~vVDNTfa---  195 (436)
T PRK07812        127 -YTLPKLGI---EVSFVEDPDDLDSWRAAVRPNTKAFFAETISNPQ-IDILD---IPGVAEVAHEAGVPLIVDNTIA---  195 (436)
T ss_pred             -HHHHHCCC---CEEEECCCCCHHHHHHHCCCCCEEEEEECCCCCC-EECCC---HHHHHHHHHHCCCEEEEECCCC---
T ss_conf             -99765287---4169679988999997458674399996489986-05236---6999999998599299626864---


Q ss_pred             CCCCCCCCCCCCCCCCEEE--CCCCCCC-CCCCCCCCC
Q ss_conf             4555310111245453021--0344444-434432100
Q gi|254780432|r  224 RTGKLFAYEWANVKPDIMT--IAKGMGG-GFPIGACLA  258 (392)
Q Consensus       224 RtG~~f~~e~~gi~PDi~~--~gK~l~g-G~P~sav~~  258 (392)
T Consensus       196 -t--P~~~~Pl~~GaDivihS~TKyi~GHsDvlgG~vv  230 (436)
T PRK07812        196 -T--PYLIRPLEHGADIVVHSATKYLGGHGTAIAGVIV  230 (436)
T ss_pred             -C--CCCCCCCCCCCCEEEEECCEECCCCCCCEEEEEE
T ss_conf             -6--2303764148988999645031589770436998