HHsearch alignment for GI: 254780432 and conserved domain: PRK07986

>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated.
Probab=100.00  E-value=0  Score=736.17  Aligned_cols=386  Identities=29%  Similarity=0.445  Sum_probs=338.2

Q ss_pred             CCCEECCCCCC----CCE-EEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHH
Q ss_conf             43145155888----874-89850103799679976464102267435787899999999999973145068-7578189
Q gi|254780432|r    3 KNDFLFNTYDQ----SDI-RFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQ   76 (392)
Q Consensus         3 ~~~~~~~~~~~----~p~-~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~   76 (392)
T Consensus         9 d~~~~~hp~t~~~~~~~~~~I~~a~G~~l~D~dG~~ylD~~sg~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~   88 (428)
T PRK07986          9 DQRHIWHPYTSMTSPLPVYPVASAEGCELILADGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFGGITHQPA   88 (428)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEECCEEEECCCCEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHH
T ss_conf             98517899766677889967696332889979999999866228750047996999999999997578703688677899


Q ss_pred             HHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             999986520101--3331235655540356777665432001347860023435465654321234553211-3479998
Q gi|254780432|r   77 EIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQ-YLEGFGP  153 (392)
Q Consensus        77 ~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~-~~~~~~p  153 (392)
T Consensus        89 ~~lae~L~~~~p~~l~~vff~~sGSEAvE~AlKlAr~y~~~~g-~~r~~ii~~~~syHG~T~gals~t~~~~~~~~~~~~  167 (428)
T PRK07986         89 IELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQYWQAKG-EPRQRFLTFRHGYHGDTFGAMSVCDPDNSMHSLYKG  167 (428)
T ss_pred             HHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHC-CCCCEEEEECCCCCCCCHHHEEECCCCCCCCCCCCC
T ss_conf             9999999984888758699648628999999999999999709-986449998387389971225731686444345577


Q ss_pred             CCCCCC-----------CCCCHHHHHHHHHC---CCCCCCCCCCCC-CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC
Q ss_conf             643332-----------22100268875410---123322223332-222112462101232211022345721310110
Q gi|254780432|r  154 KIEGFD-----------QAKFCDLQSLKNQI---SNDTAAILIEPI-QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV  218 (392)
Q Consensus       154 ~~~~~~-----------~~~~~d~~~l~~~~---~~~iAavi~Epv-~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV  218 (392)
T Consensus       168 ~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iAAviiEPi~qg~gG~~~p~~~yl~~lr~lc~~~gillI~DEV  247 (428)
T PRK07986        168 YLPENLFAPAPQSRFDGEWDERDIAPFARLMAAHRHEIAAVILEPIVQGAGGMRIYHPEWLKRIRKLCDREGILLIADEI  247 (428)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             79985013788766565557123999999997478870189983244676983538999999999999863963661100


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             034444555310111245453021034444443-443210001112222233-----22345321111001233455432
Q gi|254780432|r  219 QTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG-----SHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       219 ~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~-----~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
T Consensus       248 ~tGfGRtG~~fa~e~~gv~PDiit~gKgl~gG~~Pl~av~~~~~i~~~~~~~~~~~f~hg~Tf~Gnpla~Aaa~a~L~~i  327 (428)
T PRK07986        248 ATGFGRTGKLFACEHAGIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCFMHGPTFMGNPLACAVANASLSLL  327 (428)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             02788667865000047899889975201388775389998699996305687654101778999989999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEEEECCCCC
Q ss_conf             012221011210000268899998867970755046400999872499--899999999689899626898899558986
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVVRILPPLT  370 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~  370 (392)
T Consensus       328 ~~~~l~~~~~~~g~~l~~~L~~L~-~~-~~V~dVRg~Gl~~~ve~~~p~~~~~~~~~~~~~Gll~~~~g-~~i~l~PPLi  404 (428)
T PRK07986        328 ESGDWQQQVAAIESQLREELAPLR-DA-EMVADVRVLGAIGVVETTRPVNMAALQRFFVEQGVWIRPFG-KLIYLMPPYI  404 (428)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHH-CC-CCEEEEEECCEEEEEEECCCCCHHHHHHHHHHCCCEEEECC-CEEEEECCCC
T ss_conf             865699999999999999999875-59-95787742672899980794539999999997994897459-9999989914


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899999999999999998529
Q gi|254780432|r  371 ITAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       371 it~~eid~~i~~l~~al~~L~~  392 (392)
T Consensus       405 it~~ei~~~~~~l~~al~e~t~  426 (428)
T PRK07986        405 ILPEQLQRLTAAVNRAVQDETF  426 (428)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999975522