HHsearch alignment for GI: 254780432 and conserved domain: PRK08056

>PRK08056 threonine-phosphate decarboxylase; Provisional.
Probab=99.51  E-value=1.5e-12  Score=102.45  Aligned_cols=320  Identities=17%  Similarity=0.187  Sum_probs=189.4

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHH
Q ss_conf             99764641022674357878999999999999731450687578189999986520101--3331235655540356777
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIK  107 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aik  107 (392)
T Consensus        18 ~~~~iidlssN--eNP~g~-p~~v~~ai~~~~~~~----~rYPd~~~~~Lr~~iA~~~gv~~~~I~vgnGs~Eli~~i~~   90 (356)
T PRK08056         18 SPDQLLDFSAN--INPLGM-PVSVKRALIDNLDCI----ERYPDADYFHLHQALARHHQVPASWILAGNGETESIFTVAS   90 (356)
T ss_pred             CHHHEEEECCC--CCCCCC-CHHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHH
T ss_conf             97667773799--999899-999999999747577----41998248999999999829888998875878999999998


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCC-CCCCCCC
Q ss_conf             665432001347860023435465654321234553211347999864333222100268875410123322-2233322
Q gi|254780432|r  108 TARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAA-ILIEPIQ  186 (392)
Q Consensus       108 lar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAa-vi~Epv~  186 (392)
T Consensus        91 ---~~-----~~~~~~i--~~Ptf~~Y~~~a-~~~g~~v~~~---~l~~~---~~~~~~~~~~~~~~~~~~lv~i~nPNN  153 (356)
T PRK08056         91 ---GL-----KPRRAMI--VTPGFAEYGRAL-AQVGCEIRRW---SLREA---DGWQLTDAILEALTPDLDCLFLCTPNN  153 (356)
T ss_pred             ---HC-----CCCCEEE--ECCCHHHHHHHH-HHCCCEEEEE---ECCHH---HCCCCCHHHHHHCCCCCCEEEECCCCC
T ss_conf             ---54-----8996699--788749999999-9859769998---67733---158976999973367888899818999


Q ss_pred             CCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCCC-CCCCCCCCCCCC-
Q ss_conf             2211246210123221102234572131011003444455531011124545302---10344444-434432100011-
Q gi|254780432|r  187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMGG-GFPIGACLATNE-  261 (392)
Q Consensus       187 g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~g-G~P~sav~~~~~-  261 (392)
T Consensus       154 PT-G-~~~~~~~l~~l~~~~~~~~~~vvvDEAY~ef~~~~~s~~-~~~~~~~nlivlrTfSK~~glaGlRiGy~i~~~~~  230 (356)
T PRK08056        154 PT-G-LLPERQLLQAIADRCKSLNINLILDEAFIDFIPHETGFI-PALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDA  230 (356)
T ss_pred             CC-C-CCCCHHHHHHHHHHHHCCCEEEEEEHHHHHHCCCCCCHH-HHHHCCCCEEEEEECCHHCCCCCCCHHHHHCCCHH
T ss_conf             98-8-758999999999872404939997445576435861357-99845997899841416406852000111058899


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHH----HHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEE
Q ss_conf             12222233223453211110012334554320122210112----10000268899998867970755046400999872
Q gi|254780432|r  262 VAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI----NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT  337 (392)
Q Consensus       262 i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~----~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~  337 (392)
T Consensus       231 ~i~~l~~~~--~p~~vn~~a~~aa~~al~---d~~~~~~~~~~i~~~r~~l~~~L~~----l~g~-~v~ps~aNFil~~~  300 (356)
T PRK08056        231 AVARMRRQQ--MPWSINALAALAGEVALQ---DSAWQQATWHWLREEGARFYQALCQ----LPLL-TVYPGRANYLLLRC  300 (356)
T ss_pred             HHHHHHHHC--CCCCCCHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHC----CCCC-EECCCCCCEEEEEC
T ss_conf             999999615--899811999999999836---9999999999999999999999865----8997-88989887899988


Q ss_pred             CCCHHHHHHHHHHCCEEEEECC------CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             4998999999996898996268------988995589868899999999999999998
Q gi|254780432|r  338 VFSPALLAAKFRDECLLTAPSS------DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       338 ~~~~~~~~~~l~~~Gll~~~~~------~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
T Consensus       301 ~~~~~~~~~~L~~~gIlVR~~~~f~gl~~~~lRis---igt~~en~~ll~aL~~iL~g  355 (356)
T PRK08056        301 EREDIDLQRRLLTQRILIRSCANYPGLDSRYYRVA---IRSAAQNERLLAALRNVLTG  355 (356)
T ss_pred             CCCHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE---CCCHHHHHHHHHHHHHHHCC
T ss_conf             99999999999968909976788899999989997---59999999999999999737