HHsearch alignment for GI: 254780432 and conserved domain: PRK08088

>PRK08088 4-aminobutyrate aminotransferase; Validated.
Probab=100.00  E-value=0  Score=748.17  Aligned_cols=382  Identities=34%  Similarity=0.534  Sum_probs=341.3

Q ss_pred             CCCEECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHH
Q ss_conf             43145155888-87489850103799679976464102267435787899999999999973145068-75781899999
Q gi|254780432|r    3 KNDFLFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFA   80 (392)
Q Consensus         3 ~~~~~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la   80 (392)
T Consensus        12 ~~~~~~~~~~~~~Pi~i~ra~G~~l~D~dG~~YLD~~~g~~~~~lGH~hp~i~~Av~~q~~~l~~~~~~~~~~~~~~~la   91 (426)
T PRK08088         12 RSAAVPRGVGQIHPIFADRAENCTVWDVEGREYIDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYEPYLELC   91 (426)
T ss_pred             HHHHCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             99755898898999339973529899699899999151688651089969999999999864788567755667999999


Q ss_pred             HHHHHHCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             865201013---331235655540356777665432001347860023435465654321234553211-3479998643
Q gi|254780432|r   81 NHLIHSTFA---DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQ-YLEGFGPKIE  156 (392)
Q Consensus        81 ~~L~~~~~~---~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~-~~~~~~p~~~  156 (392)
T Consensus        92 e~l~~~~p~~~~~~v~f~~sGsEAve~AiklAR~~------tgr~~ii~~~~syHG~t~~a~s~tg~~~~~~~~~~~~~~  165 (426)
T PRK08088         92 EKMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAA------TKRSGVIAFTGAYHGRTHYTLALTGKVNPYSAGMGLMPG  165 (426)
T ss_pred             HHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHHH------HCCCCEEEECCCCCCCCCCHHHHCCCCCCCCCCCCCCCC
T ss_conf             99998577555655885497699999999998776------436663663577489852125424887776677889998


Q ss_pred             CCCCCCC----------HHHHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCC
Q ss_conf             3322210----------0268875410-----123322223332222112462101232211022345721310110034
Q gi|254780432|r  157 GFDQAKF----------CDLQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTG  221 (392)
Q Consensus       157 ~~~~~~~----------~d~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG  221 (392)
T Consensus       166 ~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~iAAvi~EPi~g~gG~~~~~~~yl~~lr~lc~~~g~llI~DEV~tG  245 (426)
T PRK08088        166 HVYRALYPCPLHGVSEDDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADEVQTG  245 (426)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHCCCEEECCCCCCC
T ss_conf             74026688623578816799999999974478776789997775677886638879999999999876905876330228


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHH
Q ss_conf             44455531011124545302103444444344321000111222223322345321111001233455432012221011
Q gi|254780432|r  222 YGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV  301 (392)
Q Consensus       222 ~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~  301 (392)
T Consensus       246 fGRtG~~fa~~~~gv~PDii~~gK~l~gG~Plsav~~~~~i~~~~~~~~~~~T~~gnpla~Aaa~a~L~~l~~e~l~~~~  325 (426)
T PRK08088        246 AGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAGNPIACAAALAVLEVFEEENLLQRA  325 (426)
T ss_pred             CCCCCCHHHHHHCCCCCCEEEHHHHHCCCCCCCCEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHH
T ss_conf             77667413566419897620121440388875000003999953368887888898989999999999999865899999


Q ss_pred             HHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEECC--CCEEEECCCC
Q ss_conf             2100002688999988679707550464009998724998----------999999996898996268--9889955898
Q gi|254780432|r  302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRD