HHsearch alignment for GI: 254780432 and conserved domain: PRK08117

>PRK08117 4-aminobutyrate aminotransferase; Provisional.
Probab=100.00  E-value=0  Score=752.21  Aligned_cols=382  Identities=39%  Similarity=0.648  Sum_probs=347.3

Q ss_pred             CCCEECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHH
Q ss_conf             43145155888-87489850103799679976464102267435787899999999999973145068-75781899999
Q gi|254780432|r    3 KNDFLFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFA   80 (392)
Q Consensus         3 ~~~~~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la   80 (392)
T Consensus        11 ~~~~~~~~~~~~~P~~i~~g~G~~l~D~dG~~yiD~~~g~~~~~lGh~~p~i~~Av~~q~~~~~~~~~~~~~~~~~~~la   90 (429)
T PRK08117         11 IKRVLAPALAKDHPLPVEKGEGCYYYGVDGKEYLDFTSGIAVLNVGHNHPKVVQAIKEQADRLVHGGSGVIYYESILKLA   90 (429)
T ss_pred             HHHHCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             98651765787899218985769999699799999650877534258969999999999863477677754776999999


Q ss_pred             HHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC
Q ss_conf             86520101--333123565554035677766543200134786002343546565432123455321-134799986433
Q gi|254780432|r   81 NHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFGPKIEG  157 (392)
Q Consensus        81 ~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~p~~~~  157 (392)
T Consensus        91 e~L~~~~p~~~~~v~f~~sGsEAve~AiklAr~~------tgr~~ii~~~~~yHG~t~~a~s~t~~~~~~~~~~~~~~~~  164 (429)
T PRK08117         91 EELAEITPGGLDMFFFSNSGAEAIEGALKLAKHV------TKRQGIISFTGAFHGRTLGALSVTTSSSKYRKRYQPLLPS  164 (429)
T ss_pred             HHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCEEEEEECCCCCCCCCEEEECCCCCCCCCCCCCCCCC
T ss_conf             9999848788788999487468999999999986------3898599984577888660455316753234577899998


Q ss_pred             CCCCCCHH-----------------HHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEE
Q ss_conf             32221002-----------------68875410-----123322223332222112462101232211022345721310
Q gi|254780432|r  158 FDQAKFCD-----------------LQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIF  215 (392)
Q Consensus       158 ~~~~~~~d-----------------~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~  215 (392)
T Consensus       165 ~~~~p~p~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~iAAviiEPi~g~gG~~~~~~~fl~~lr~lc~~~gillI~  244 (429)
T PRK08117        165 VYHAPYPYCFRCPIGRDPESCSLECLRDLESLFKRQIAPEEVAAIIIEPVLGEGGYIVPPKEFLQKVREICDEHGILLIF  244 (429)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHCCCEEEC
T ss_conf             36637886325656788056689999999999986248887899999646678893738889999999998763917973


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             11003444455531011124545302103444444344321000111222223322345321111001233455432012
Q gi|254780432|r  216 DEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD  295 (392)
Q Consensus       216 DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~  295 (392)
T Consensus       245 DEV~tGfGRtG~~fa~~~~gv~PDiv~~gK~lggG~Plsav~~~~~i~~~~~~~~~~~T~~gnp~~~aaa~a~L~~~~~~  324 (429)
T PRK08117        245 DEVQSGFGRTGKWFAAETFGVVPDIMTVAKGIASGFPLSAVVASKELMDQWPLGAHGTTFGGNPVACAAALATLEVIKEE  324 (429)
T ss_pred             CCCCCCCCCCCCCCHHHCCCCCCCEEEEEECCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             43110777667732654049899878871014478986422147999706688886858998989999999999999755


Q ss_pred             CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--------HHHHHHHHHHCCEEEEECC--CCEEEE
Q ss_conf             221011210000268899998867970755046400999872499--------8999999996898996268--988995
Q gi|254780432|r  296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--------PALL