HHsearch alignment for GI: 254780432 and conserved domain: PRK08555

>PRK08555 consensus.
Probab=100.00  E-value=0  Score=740.30  Aligned_cols=378  Identities=36%  Similarity=0.639  Sum_probs=341.5

Q ss_pred             CCEECCC---CCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHH
Q ss_conf             3145155---8888748985010379967997646410226743578789999999999997314506-87578189999
Q gi|254780432|r    4 NDFLFNT---YDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEIF   79 (392)
Q Consensus         4 ~~~~~~~---~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~l   79 (392)
T Consensus        21 ~~~~~~~~~~~~~~P~~i~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~ql~~l~~~~~~~~~~~~~~~l  100 (443)
T PRK08555         21 HKYLATTTQDPESLPLVIERGEGVYVYDVDGNVYLDFSSGIGVNNLGHSHPRVIEAVEEQLHKLWHAAGTDFYNEYQVEL  100 (443)
T ss_pred             HHHCCCCCCCCCCCCCEEEEEECCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHH
T ss_conf             86538866778887817998465999979889999905327642124897999999999986176746564368899999


Q ss_pred             HHHHHHHCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             9865201013---33123565554035677766543200134786002343546565432123455321-1347999864
Q gi|254780432|r   80 ANHLIHSTFA---DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFGPKI  155 (392)
Q Consensus        80 a~~L~~~~~~---~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~p~~  155 (392)
T Consensus       101 ae~L~~~~p~~~~~~v~f~~SGSEAvE~AiklAr~~------tgr~~ii~~~~~yHG~t~g~~s~t~~~~~~~~~~~p~~  174 (443)
T PRK08555        101 AKKLVEIAPGDFEKKVFFSNSGTEANEAALKIAKWY------TGRKMFIAFIGAFHGRTQGSLSLTASKPVQRSGFFPTM  174 (443)
T ss_pred             HHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCEEEEEECCCCCCCCCCEEEECCCCHHCCCCCCCC
T ss_conf             999998577565655998087788999999998873------79988999958707897211687258501104778999


Q ss_pred             CCCCCCCCHH---------------------HHHHHHHC------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCC
Q ss_conf             3332221002---------------------68875410------12332222333222211246210123221102234
Q gi|254780432|r  156 EGFDQAKFCD---------------------LQSLKNQI------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDD  208 (392)
Q Consensus       156 ~~~~~~~~~d---------------------~~~l~~~~------~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~  208 (392)
T Consensus       175 ~~~~~vp~p~~~r~p~~~~~~~~~~~~~~~~~~~ie~~i~~~~~~~~~iAavi~EPi~g~gG~~~pp~~yl~~l~~lc~~  254 (443)
T PRK08555        175 PGVEHVPYPNPYRNPWGIDGYENPDELVNRVIDYIEEYLFEHYVPPEEVAGIFFEPIQGEGGYVVPPKNFFKELKKLADK  254 (443)
T ss_pred             CCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99368168862246445666569999999999999999986257989889999958768889875887887899999997


Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             57213101100344445553101112454530210344444434432100011122222332234532111100123345
Q gi|254780432|r  209 IDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKV  288 (392)
Q Consensus       209 ~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~  288 (392)
T Consensus       255 ~gillI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gKgl~~G~Pl~av~~~~e~-~~~~~~~h~~T~~gnpla~aaa~a~  333 (443)
T PRK08555        255 YGILLIDDEVQMGLGRTGKMFAIEHFGVEPDIITLAKALGGGIPIGATIFRADL-DFKKPGLHSNTFGGNALASAAGLAV  333 (443)
T ss_pred             CCCEEECCCCCCCCCCCCCCCEECCCCCCCCEEEECCCCCCCCCEEEEEEHHHH-CCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             494696354412787024741231688899889977424488750899982453-5577777376888548999999999


Q ss_pred             HHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEEC
Q ss_conf             54320122210112100002688999988679707550464009998724998----------99999999689899626
Q gi|254780432|r  289 LNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLLTAPS  358 (392)
Q Consensus       289 L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~Gll~~~~  358 (392)
T Consensus       334 L~~i~-e~l~~~~~~~g~~l~~~L~~l~~~~~-~v~dvRG~Gl~~gielv~~~~~~~~~~~~~~~i~~~~~~~Gll~~~~  411 (443)
T PRK08555        334 IEEIK-EGLLENVQKLGKYFRERLEELKEKYE-IIGDVRGLGLAWAIEFVKDRKTKEPNPKLRDRVVVEAFKRGLILLGC  411 (443)
T ss_pred             HHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCC-CEEEECCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCEEEEEC
T ss_conf             99999-77999999999999999999886199-77872326679999982377656779899999999999789099737


Q ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             89889955898688999999999999999985
Q gi|254780432|r  359 SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       359 ~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
T Consensus       412 g~n~ir~~PPL~it~~eid~~~~~l~~al~~V  443 (443)
T PRK08555        412 GKSAIRLIPPLIISEEEAKIGLEILEEAIKVV  443 (443)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             99989997794388999999999999999639