HHsearch alignment for GI: 254780432 and conserved domain: PRK09264

>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated.
Probab=100.00  E-value=0  Score=740.20  Aligned_cols=380  Identities=31%  Similarity=0.547  Sum_probs=338.6

Q ss_pred             CEECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHHHH
Q ss_conf             145155888-87489850103799679976464102267435787899999999999973145068-7578189999986
Q gi|254780432|r    5 DFLFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFANH   82 (392)
Q Consensus         5 ~~~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la~~   82 (392)
T Consensus        11 ~s~~~~y~~~~Pivi~ra~G~~l~D~dG~~ylD~~sg~~~~~lGH~~p~I~~Ai~~ql~~~~~~h~~~~~~~~~~~l~e~   90 (426)
T PRK09264         11 ESEVRSYCRSFPVVFDKAKGSWLYDEDGKEYIDFFAGAGALNYGHNNPVLKQALIDYLQRDGITHGLDMHTEAKREFLET   90 (426)
T ss_pred             CCCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             43304578899934998453989989989999837059853005897999999999998548600134212899999999


Q ss_pred             HHHH----CCCC-CCCCCC-CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             5201----0133-312356-555403567776654320013478600234354656543212345532113479998643
Q gi|254780432|r   83 LIHS----TFAD-RVFFTN-SGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIE  156 (392)
Q Consensus        83 L~~~----~~~~-~v~f~~-SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~  156 (392)
T Consensus        91 l~~~il~p~~l~~~v~F~~~SGSEAvE~AiKlAR~~------tgr~~Iis~~~~YHG~T~gals~tg~~~~~~~~~~~~~  164 (426)
T PRK09264         91 FERLILKPRGLDYKVQFTGPTGTNAVEAALKLARKV------TGRTNIISFTNGFHGMTLGALAVTGNAHKRGGAGVPLN  164 (426)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHH------CCCCEEEEEECCCCCCCCEEEEECCCCCCCCCCCCCCC
T ss_conf             999735755798048955898227999999999983------49985999837757874145550378434577889978


Q ss_pred             CCCCCCCH--------HHHHHHHHCC------CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCC
Q ss_conf             33222100--------2688754101------233222233322221124621012322110223457213101100344
Q gi|254780432|r  157 GFDQAKFC--------DLQSLKNQIS------NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGY  222 (392)
Q Consensus       157 ~~~~~~~~--------d~~~l~~~~~------~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~  222 (392)
T Consensus       165 ~~~~~P~~~~~~~~~~~~~~~e~~l~~~~~g~d~iAAviiEPiqg~gG~~~~p~~yl~~lr~lc~~~giLlI~DEV~tGf  244 (426)
T PRK09264        165 HVTFMPYDGYFGGDVDTLAYLEKLLEDSSSGVDLPAAVIVETVQGEGGLNVASAEWLQRLEKLCRKHDILLIVDDIQAGC  244 (426)
T ss_pred             CCEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEECCCCC
T ss_conf             81772788866787016999999987623788861699987866888982499899999999998707506733201077


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH-HCCCCCCH
Q ss_conf             4455531011124545302103444444-344321000111222223322345321111001233455432-01222101
Q gi|254780432|r  223 GRTGKLFAYEWANVKPDIMTIAKGMGGG-FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNII-QSDGFLEN  300 (392)
Q Consensus       223 GRtG~~f~~e~~gi~PDi~~~gK~l~gG-~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l-~~~~l~~~  300 (392)
T Consensus       245 GRTG~~fa~e~~gv~PDiv~~gKglsGgg~P~sav~~~~e~-d~~~~g~h~~Tf~Gnp~a~aaa~a~L~~~~~~~~l~~~  323 (426)
T PRK09264        245 GRTGTFFSFEEAGIKPDIVTLSKSISGYGLPMALVLIKPEL-DQWKPGEHNGTFRGNNLAFVTATAALETYWSDDAFEKE  323 (426)
T ss_pred             CCCCCCCCCCCCCCCCCEEEECHHHCCCCCCEEEEEECHHH-CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCHHHHH
T ss_conf             86778302104799987798864336897104999973444-04677544667788829999999999999871479999


Q ss_pred             HHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECC--CCEEEECCCCCCCHHHH
Q ss_conf             1210000268899998867970755046400999872499--8999999996898996268--98899558986889999
Q gi|254780432|r  301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--P