HHsearch alignment for GI: 254780432 and conserved domain: PRK12381

>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional.
Probab=100.00  E-value=0  Score=807.55  Aligned_cols=387  Identities=43%  Similarity=0.722  Sum_probs=374.3

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             31451558888748985010379967997646410226743578789999999999997314506875781899999865
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHL   83 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L   83 (392)
T Consensus        11 ~~~~~~~y~p~P~vi~ra~G~~l~D~dG~~yLD~~~g~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~la~~L   90 (406)
T PRK12381         11 DEWMVPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASKFWHTGNGYTNEPVLRLAKKL   90 (406)
T ss_pred             HHHCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHCEECCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             96324779999833898453989979989999916088745238998999999999986556677873688999999998


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             20101333123565554035677766543200134786002343546565432123455321134799986433322210
Q gi|254780432|r   84 IHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKF  163 (392)
Q Consensus        84 ~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~  163 (392)
T Consensus        91 ~~~~~~~~v~f~~SGsEAve~AiKlAr~~~~~~~~~~r~~Ii~~~~~yHG~t~~~~s~~g~~~~~~~~~p~~~~~~~~~~  170 (406)
T PRK12381         91 IDATFADRVFFCNSGAEANEAALKLARKYAHDRYGNHKSGIVAFKNAFHGRTLFTVSAGGQPKYSQDFAPLPPDIRHAAY  170 (406)
T ss_pred             HHCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             73058764999487778999999999999986389998769996787678832232157873335677889974435652


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             02688754101233222233322221124621012322110223457213101100344445553101112454530210
Q gi|254780432|r  164 CDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI  243 (392)
Q Consensus       164 ~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~  243 (392)
T Consensus       171 ~d~~~~~~~~~~~~aAvivEPiqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~tG~GRtG~~~a~~~~gv~PDiv~~  250 (406)
T PRK12381        171 NDLNSASALIDDQTCAVIVEPIQGEGGVIPADKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDVLTT  250 (406)
T ss_pred             CHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHEECCCCEEECCCCEECCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             22999999738883599990645668832689899999997521158379744420077766676535466789988997


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEE
Q ss_conf             34444443443210001112222233223453211110012334554320122210112100002688999988679707
Q gi|254780432|r  244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMF  323 (392)
Q Consensus       244 gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v  323 (392)
T Consensus       251 gK~lggG~P~sav~~~~~i~~~~~~~~h~~T~~gnpla~aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~-~i  329 (406)
T PRK12381        251 AKALGGGFPIGAMLTTEKYASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQRHDWFVERLNTINARYG-LF  329 (406)
T ss_pred             CCCCCCCCEEEEEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCC-CE
T ss_conf             42024886048998728878652888766389869999999999999997556999999999999999999887389-88


Q ss_pred             EEECCCEEEEEEEECCC----HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             55046400999872499----899999999689899626898899558986889999999999999999852
Q gi|254780432|r  324 LEVRGQGLLIGLKTVFS----PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       324 ~~vRG~Gl~~~ie~~~~----~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
T Consensus       330 ~dVRG~GLm~giel~~~~~~~~~~l~~~~~~~Gll~~~~g~n~irl~PPL~it~~eid~~l~~l~~al~~v~  401 (406)
T PRK12381        330 SEIRGLGLLIGCVLNAEYAGKAKQISQEAAKAGVMVLIAGPNVVRFAPALNVSEEEIATGLDRFARACERFV  401 (406)
T ss_pred             EEEEECCEEEEEEECCCCCCHHHHHHHHHHHCCEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             863025269999964887535999999999799699607999699979953899999999999999999999