HHsearch alignment for GI: 254780432 and conserved domain: TIGR01264

>TIGR01264 tyr_amTase_E tyrosine aminotransferase; InterPro: IPR005957 This entry describes tyrosine aminotransferase (2.6.1.5 from EC) as found in animals and Trypanosoma cruzi (Euglenozoa). It is the first enzyme of a pathway of tyrosine degradation via homogentisate. L-tyrosine + 2-oxoglutarate = 4-hydroxyphenylpyruvate + L-glutamate.; GO: 0004838 tyrosine transaminase activity, 0030170 pyridoxal phosphate binding, 0009072 aromatic amino acid family metabolic process.
Probab=98.52  E-value=6.7e-06  Score=59.03  Aligned_cols=313  Identities=19%  Similarity=0.224  Sum_probs=173.2

Q ss_pred             CCHHHHHHHHHHHHHCCCC---CCCCCCHHHHHHHHHHHH------H----CCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             8999999999999731450---687578189999986520------1----01333123565554035677766543200
Q gi|254780432|r   49 SHPELVAILKSQSEKLWHV---SNLYQSTQQEIFANHLIH------S----TFADRVFFTNSGAESVECAIKTARRYHYM  115 (392)
Q Consensus        49 ~~p~i~~a~~~q~~~~~~~---~~~~~~~~~~~la~~L~~------~----~~~~~v~f~~SGseA~e~Aiklar~~~~~  115 (392)
T Consensus        50 ~~~~~~~a~~~~v~S~~ynGY~p~vG~~~Ar~aia~~y~~sfvhn~~~~~~~~a~~Vvl~SGCS~Al~~ai~a~------  123 (415)
T TIGR01264        50 TSEEAMQAMKESVDSGKYNGYAPTVGALEAREAIAEYYRNSFVHNKRPDGSIEADDVVLCSGCSHALEMAIEAL------  123 (415)
T ss_pred             CCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCHHHHHHHHHHH------
T ss_conf             88899999998752566067720013488889999987631100236687201276477167027899999995------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-CCCCCCCCCCCC
Q ss_conf             1347860023435465654321234553211347999864333222100268875410123322223-332222112462
Q gi|254780432|r  116 AGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI-EPIQGEGGVRKV  194 (392)
Q Consensus       116 ~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~-Epv~g~~G~~~~  194 (392)
T Consensus       124 -Ad~G~-nvLVP~PGFplY~Tlc~~~~-i--~~~~Y~~--d~~d~~w~~DL~~l~~LiDd~T~~l~vnNPSNPcGSv--F  194 (415)
T TIGR01264       124 -ADAGQ-NVLVPRPGFPLYETLCKALG-I--EVKLYNL--DLPDEDWEIDLKQLESLIDDKTKALIVNNPSNPCGSV--F  194 (415)
T ss_pred             -CCCCC-EEECCCCCCCHHHHHHHHCC-C--CCCEECC--CCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCC--C
T ss_conf             -37978-06307888720788640147-6--2000025--7987335664898863125674078883757788988--7


Q ss_pred             CHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC-----CCCCCCCC-CCCCCEEE--CCCCCC-CCCCCCCCCCC------
Q ss_conf             10123221102234572131011003444455-----53101112-45453021--034444-44344321000------
Q gi|254780432|r  195 PEEFLQQLRKICDDIDALLIFDEVQTGYGRTG-----KLFAYEWA-NVKPDIMT--IAKGMG-GGFPIGACLAT------  259 (392)
Q Consensus       195 ~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG-----~~f~~e~~-gi~PDi~~--~gK~l~-gG~P~sav~~~------  259 (392)
T Consensus       195 ~~~Hl~~l~a~A~~~~Lpi~ADEIY~~~VF~GkDPnatF~~lA~L~s~VP~~~cgG~AKr~lVPGWRLGWli~hd~~~~~  274 (415)
T TIGR01264       195 RREHLEELLALAERLKLPIIADEIYGDMVFKGKDPNATFTPLASLSSKVPILSCGGLAKRWLVPGWRLGWLIIHDRKGVL  274 (415)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCEEEECCCCCCCCCCCCCCCCEEEECCCCCC
T ss_conf             87889999999875387236642025651388678642202023779988687076320022476110247888788865


Q ss_pred             -CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC---CC----CCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEE
Q ss_conf             -11122222332234532111100123345543201---22----21011210000268899998867970755046400
Q gi|254780432|r  260 -NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS---DG----FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGL  331 (392)
Q Consensus       260 -~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~---~~----l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl  331 (392)
T Consensus       275 ~~e~~~GL~~ls~-~i~Gp----ntlvQGAl~~iL~~TPq~Yf~~~~~~l~~nA~~~y~~La~v----~Gl-~pv~P~Ga  344 (415)
T TIGR01264       275 RDEVKDGLKKLSQ-RILGP----NTLVQGALPEILLKTPQEYFDGTVSVLESNAMLVYEILAEV----PGL-RPVMPKGA  344 (415)
T ss_pred             CHHHHHHHHHHHC-HHCCC----CHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCC----CCC-EEECCCCC
T ss_conf             0268899999723-00462----01144217988640655677899999874089999885106----886-11148875


Q ss_pred             ---EEEEEEC-----CCHHHHH-HHHHHCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             ---9998724-----9989999-99996898996268----98899558986889999999999999999
Q gi|254780432|r  332 ---LIGLKTV-----FSPALLA-AKFRDECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       332 ---~~~ie~~-----~~~~~~~-~~l~~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
T Consensus       345 MY~m~~i~~e~F~e~k~Dv~F~~~L~~E~sV~cLPG~~F~~PGf~Rvv--~T~P~~~~~EA~~RI~eFC~  412 (415)
T TIGR01264       345 MYMMVGIELEKFPEFKSDVEFVEKLVEEESVFCLPGSCFEYPGFFRVV--LTVPSSMMEEACSRIKEFCK  412 (415)
T ss_pred             EEEEEEEECCCCCCCCCHHHHHHHHHHHCCCEECCHHHHCCCCCEEEE--EECCHHHHHHHHHHHHHHHH
T ss_conf             587560020017772411799999851146304641644589958999--70780678999999999841