HHsearch alignment for GI: 254780432 and conserved domain: TIGR01825

>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative; InterPro: IPR010962 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal). PLP is a versatile catalyst, acting as a coenzyme in a multitude of reactions, including decarboxylation, deamination and transamination , , . PLP-dependent enzymes are primarily involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and in the synthesis or catabolism of neurotransmitters; pyridoxal phosphate can also inhibit DNA polymerases and several steroid receptors . Inadequate levels of pyridoxal phosphate in the brain can cause neurological dysfunction, particularly epilepsy . PLP enzymes exist in their resting state as a Schiff base, the aldehyde group of PLP forming a linkage with the epsilon-amino group of an active site lysine residue on the enzyme. The alpha-amino group of the substrate displaces the lysine epsilon-amino group, in the process forming a new aldimine with the substrate. This aldimine is the common central intermediate for all PLP-catalyzed reactions, enzymatic and non-enzymatic . This entry contains a number of enzyme families: Serine palmitoyltransferase Glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase) 5-aminolevulinic acid synthase 8-amino-7-oxononanoate synthase All transfer the R-group (acetyl, succinyl, or 6-carboxyhexanoyl) from coenzyme A to an amino acid (Gly, Gly, Ala, respectively), with release of CO2 for the latter two reactions.; GO: 0016740 transferase activity, 0030170 pyridoxal phosphate binding.
Probab=99.92  E-value=9.9e-24  Score=175.62  Aligned_cols=333  Identities=17%  Similarity=0.243  Sum_probs=237.9

Q ss_pred             CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCC-CHHHHHHHHHHHHHCCCCCCC-----CCCHHHHHHHHHHHHH
Q ss_conf             8874898501037996799764641022674357878-999999999999731450687-----5781899999865201
Q gi|254780432|r   13 QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHS-HPELVAILKSQSEKLWHVSNL-----YQSTQQEIFANHLIHS   86 (392)
Q Consensus        13 ~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~-~p~i~~a~~~q~~~~~~~~~~-----~~~~~~~~la~~L~~~   86 (392)
T Consensus        15 ~~i~~L~s~qGp~v~-vnG~~vinLsS---NNYLGlA~hp~Lk~aA~~a~~~yGvGAGAVRTIaGTl~lH~eLE~~LA~F   90 (392)
T TIGR01825        15 VEIRVLESAQGPEVK-VNGKKVINLSS---NNYLGLASHPRLKEAAKEAIQQYGVGAGAVRTIAGTLELHEELEEKLAKF   90 (392)
T ss_pred             CCCHHHCCCCCCEEE-ECCEEEEECCC---CCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             440532078888789-88857874043---55455468876899999999865962241210433778999999998755


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC--CCCCCCC
Q ss_conf             01333123565554035677766543200134786-0023435465654321234553211347999-864--3332221
Q gi|254780432|r   87 TFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK-FRIVTFEGAFHGRTLATISAGGKLQYLEGFG-PKI--EGFDQAK  162 (392)
Q Consensus        87 ~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r-~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~-p~~--~~~~~~~  162 (392)
T Consensus        91 K~teAAl~fqSGF~~N~GvlSa~L~-------k~ddG~v~Sd----------------ELNHASIIDG~RLtkA~k~~y~  147 (392)
T TIGR01825        91 KKTEAALVFQSGFNTNQGVLSALLR-------KGDDGIVLSD----------------ELNHASIIDGLRLTKAKKKIYK  147 (392)
T ss_pred             CCCCEEEHHHCCHHHHHHHHHHHHC-------CCCCEEEEEC----------------CCCHHHHHHCCCCCCCCEEEEE
T ss_conf             3820110103122377999987623-------5887158720----------------0020345504223788568984


Q ss_pred             CHHHHHHHHHC----CC---CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-C-CCC
Q ss_conf             00268875410----12---332222333222211246210123221102234572131011003444455531-0-111
Q gi|254780432|r  163 FCDLQSLKNQI----SN---DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-A-YEW  233 (392)
Q Consensus       163 ~~d~~~l~~~~----~~---~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~-~e~  233 (392)
T Consensus       148 H~dm~DL~~~l~e~~~~Gqy~~~l~vTDGVFSMDGdvAp----Lp~iVE~Ae~Yda~~yVDDA-HGsGVlGe~GrGtV~H  222 (392)
T TIGR01825       148 HVDMDDLERVLRENVEEGQYKKKLIVTDGVFSMDGDVAP----LPEIVELAEKYDALVYVDDA-HGSGVLGEKGRGTVKH  222 (392)
T ss_pred             CCCHHHHHHHHHHCCCCCCCCCEEEEECCEEECCCCCCC----CCHHHHHHHHCCCEEEEECC-CCCCCCCCCCCCEEEC
T ss_conf             598458999997160337544368996650425678788----73233463245957998633-4664447788713530


Q ss_pred             CCCC-CC----EEECCCCCC--CCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCHHHHHHHHHHHHC-CCCCCHHH
Q ss_conf             2454-53----021034444--4434432100011122222332---234532111100123345543201-22210112
Q gi|254780432|r  234 ANVK-PD----IMTIAKGMG--GGFPIGACLATNEVAACMNQGS---HGSTYGGNVLAMVLGEKVLNIIQS-DGFLENVI  302 (392)
Q Consensus       234 ~gi~-PD----i~~~gK~l~--gG~P~sav~~~~~i~~~~~~~~---~~~T~~gnpl~~aaa~a~L~~l~~-~~l~~~~~  302 (392)
T Consensus       223 FGL~y~~v~~qvGTLSKA~GvvGGY----~AG~~~lidyL~~~aRPFLFSta~-~Pa~~~A~~~Av~~l~~~~~l~~kLW  297 (392)
T TIGR01825       223 FGLEYDKVDIQVGTLSKAIGVVGGY----VAGSKELIDYLKARARPFLFSTAL-PPAVVAALIEAVDVLQESPELMEKLW  297 (392)
T ss_pred             CCCCCCCEEEEECCHHHHHCCCCCC----CCCCHHHHHHHHHCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             3754164678855522322256642----348889999998628986012578-80789999999998707931477767


Q ss_pred             HHCCHHHHHHHHHH-----HHCCCEEEEECCCEEEEEEEECCCHHHHHHHHHHC-CEEE-------EECCCCEEEECCCC
Q ss_conf             10000268899998-----86797075504640099987249989999999968-9899-------62689889955898
Q gi|254780432|r  303 NIAKILFEGLTAIK-----NRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDE-CLLT-------APSSDNVVRILPPL  369 (392)
Q Consensus       303 ~~g~~l~~~L~~l~-----~~~~~~v~~vRG~Gl~~~ie~~~~~~~~~~~l~~~-Gll~-------~~~~~~~irl~Ppl  369 (392)
T Consensus       298 ~Nt~ylk~~L~~LGydl~~S~tP--ItPv-----~~Gde--~~A~efS~rL~~~yGvFa~sivFPTVp~g~ARiR~~~tA  368 (392)
T TIGR01825       298 DNTRYLKAGLSKLGYDLGESETP--ITPV-----LIGDE--KVAQEFSRRLLDEYGVFAQSIVFPTVPRGTARIRNIPTA  368 (392)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCC--CCCE-----EECCC--HHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCH
T ss_conf             88999998767616411476686--1245-----87651--568999998777529089984216566988421246561


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             6889999999999999999852
Q gi|254780432|r  370 TITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       370 ~it~~eid~~i~~l~~al~~L~  391 (392)
T Consensus       369 ~HTkd~L~~al~aye~~Gk~l~  390 (392)
T TIGR01825       369 EHTKDDLDQALDAYEKVGKELG  390 (392)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHC
T ss_conf             3026679999999998678725