HHsearch alignment for GI: 254780432 and conserved domain: TIGR02326

>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase; InterPro: IPR012703 Phosphonates are a class of organophosphorus compounds, characterised by a stable C-P bond, which are found in a variety of biologically produced molecules including antiobiotics, lipids, proteins and polysaccharides . The functions of these molecules include phosphorus storage, cell communication, host recognition and chemical warfare. 2-Aminoethylphosphonate (AEP), the most common naturally occurring phosphonate, is an important precursor used in the biosynthesis of phosphonolipids, phosphonoproteins, and phosphonoglycans. This entry represents 2-aminoethylphosphonate-pyruvate transaminase (AEPT)(2.6.1.37 from EC) which catalyses the interconversion of AEP and phosphonoacetaldehyde (P-Ald), coupled with the interconversion of pryuvate and L-alanine. In some bacterial species this is the first step in an AEP degradation pathway which allows them to utilise this compound as a source of carbon, nitrogen and phosphorus. Phosphonoacetaldeyhde hydrolase, often encoded by an adjacent gene, then converts P-Ald to acetaldehyde and phosphate.Species with this pathway generally have an identified phosphonate ABC transporter but do not also have the multisubunit C-P lyase complex as found in Escherichia coli. The crystal structure of AEPT from Salmonella typhimurium has been studied to 2.2 A resolution . The protein is a homodimer where each subunit is composed of two domains, large and small. The large domain forms an alpha-beta complex characteristic of the aspartate transaminase family, while the small domain is comosed of highly twisted beta strands. The active site contains a pyridoxal 5'-phosphate cofactor and is found at the domain interface, being composed of residues from both subunits..
Probab=97.79  E-value=0.0007  Score=45.83  Aligned_cols=282  Identities=16%  Similarity=0.227  Sum_probs=161.4

Q ss_pred             HHHHHHHHHHHHCC-----CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC
Q ss_conf             89999986520101-----3331235655540356777665432001347860023435465654321234-55321134
Q gi|254780432|r   75 QQEIFANHLIHSTF-----ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATIS-AGGKLQYL  148 (392)
Q Consensus        75 ~~~~la~~L~~~~~-----~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s-~s~~~~~~  148 (392)
T Consensus        37 ~~~~ir~~L~~la~~~~~~YT~VllQGSGtf~VEA~i------Gs~~pr~~~klLv~~NGAY-G~R~~~ia~~l~i~~~-  108 (366)
T TIGR02326        37 VVESIRQKLLKLATAEEEKYTTVLLQGSGTFAVEAVI------GSAVPRKDGKLLVVINGAY-GKRIAQIAEYLQIPHH-  108 (366)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHH------HCCCCCCCCEEEEEECCCH-HHHHHHHHHHHCCCEE-
T ss_conf             7999999999986068985467861275125556654------1124788973899717853-4789999998478616-


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHCCC-----CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC
Q ss_conf             799986433322210026887541012-----332222333222211246210123221102234572131011003444
Q gi|254780432|r  149 EGFGPKIEGFDQAKFCDLQSLKNQISN-----DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG  223 (392)
Q Consensus       149 ~~~~p~~~~~~~~~~~d~~~l~~~~~~-----~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G  223 (392)
T Consensus       109 ------~~~~~E~~~~~~~~ve~~L~~dp~ItH~A~vHcETtT---GiLNP----i~~~~~~~~~hGk~~ivDA-MSSfG  174 (366)
T TIGR02326       109 ------VVETEENEPTNVVEVEAILAADPAITHVALVHCETTT---GILNP----IEAVAKVAKRHGKVTIVDA-MSSFG  174 (366)
T ss_pred             ------EEECCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCC---CCCCH----HHHHHHHHHHCCCEEEEEC-CCCCC
T ss_conf             ------7515877777889999998518971278898367526---62112----8999999985597799853-41137


Q ss_pred             CCCCCCCCCCCCCCCCEE--ECCCCCCCCCC-CCCCCCCCCCCCC------------CCC--------CCCCCCCCCCCC
Q ss_conf             455531011124545302--10344444434-4321000111222------------223--------322345321111
Q gi|254780432|r  224 RTGKLFAYEWANVKPDIM--TIAKGMGGGFP-IGACLATNEVAAC------------MNQ--------GSHGSTYGGNVL  280 (392)
Q Consensus       224 RtG~~f~~e~~gi~PDi~--~~gK~l~gG~P-~sav~~~~~i~~~------------~~~--------~~~~~T~~gnpl  280 (392)
T Consensus       175 gi~----idi~~l~~D~LIssanKCi~-GVPGfgFviA~~~~L~~~~g~arSLsLDLydQw~~M~~~~GkWRFT---sPT  246 (366)
T TIGR02326       175 GIP----IDIAELDIDYLISSANKCIQ-GVPGFGFVIAKQAELEKCAGNARSLSLDLYDQWECMEKQHGKWRFT---SPT  246 (366)
T ss_pred             CCH----HHHHHHCCCEEEECCCCCCC-CCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCEEEC---CCH
T ss_conf             600----11643256763523478133-7684366776899998620432102354899999964489962217---726


Q ss_pred             C-HHHHHHHHHHHHCC-CCCC---HHHHHCCHHHHHHHHHHHHCCCEEEEECCCE-EEEEEEECCCH----HHHHHHHHH
Q ss_conf             0-01233455432012-2210---1121000026889999886797075504640-09998724998----999999996
Q gi|254780432|r  281 A-MVLGEKVLNIIQSD-GFLE---NVINIAKILFEGLTAIKNRFPNMFLEVRGQG-LLIGLKTVFSP----ALLAAKFRD  350 (392)
Q Consensus       281 ~-~aaa~a~L~~l~~~-~l~~---~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G-l~~~ie~~~~~----~~~~~~l~~  350 (392)
T Consensus       247 HvV~Af~qAL~el~~EGGv~aR~~RY~~nq~~L~~~m~~LGF~--~ll~~-~~~sPIItsF~~P~~~~y~F~~fY~~lk~  323 (366)
T TIGR02326       247 HVVHAFAQALLELEKEGGVEARYQRYQSNQKLLVAGMRALGFE--PLLDD-ELQSPIITSFYSPEDPDYRFADFYQRLKE  323 (366)
T ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCC--CCCCH-HHCCCEEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             8999999999999845897457899999999999999861551--14754-34588689850778897138999999976


Q ss_pred             CCEEEEECC---CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             898996268---988995589868899999999999999998
Q gi|254780432|r  351 ECLLTAPSS---DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       351 ~Gll~~~~~---~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
T Consensus       324 ~GFviYPGKvs~~~~FRiG~IG~V~~~di~~l~~~I~~~~~~  365 (366)
T TIGR02326       324 QGFVIYPGKVSQVDTFRIGNIGDVDAADIERLVTAIGKALYL  365 (366)
T ss_pred             CCCEECCCCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             781762761045662111676763889999999999987504