HHsearch alignment for GI: 254780432 and conserved domain: TIGR03251

>TIGR03251 LAT_fam L-lysine 6-transaminase. Characterized members of this protein family are L-lysine 6-transaminase, also called lysine epsilon-aminotransferase (LAT). The immediate product of the reaction of this enzyme on lysine, 2-aminoadipate 6-semialdehyde, becomes 1-piperideine 6-carboxylate, or P6C. This product may be converted subsequently to pipecolate or alpha-aminoadipate, lysine catabolites that may be precursors of certain seconary metabolites.
Probab=100.00  E-value=0  Score=704.97  Aligned_cols=383  Identities=28%  Similarity=0.407  Sum_probs=314.2

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEEC-CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-----CCCCHHHH
Q ss_conf             31451558888748985010379967-9976464102267435787899999999999973145068-----75781899
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSE-NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-----LYQSTQQE   77 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~-dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-----~~~~~~~~   77 (392)
T Consensus         9 ~~~~~~~~~p~~i~i~rgeG~~l~D~~dG~~yLD~~~g~~~~~lGh~hp~iv~a~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (431)
T TIGR03251         9 SRHMLTDGFDLVLDLDRSRGSVLVDARDGRRYLDMFSFFASMALGMNHPALVDDLAFRARLGAAAVNKPSNSDVYTVAMA   88 (431)
T ss_pred             HHHHCCCCCCCCEEEEEEECCEEEECCCCCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             77422138996206886026999989999884170141998877079799999999999998876538566225569999


Q ss_pred             HHHHHHHHHC---CCCCCCCCCCCCCCHHHHHHHHHHHHHCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9998652010---133312356555403567776654320013------4786002343546565432123455321134
Q gi|254780432|r   78 IFANHLIHST---FADRVFFTNSGAESVECAIKTARRYHYMAG------KTNKFRIVTFEGAFHGRTLATISAGGKLQYL  148 (392)
Q Consensus        78 ~la~~L~~~~---~~~~v~f~~SGseA~e~Aiklar~~~~~~g------~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~  148 (392)
T Consensus        89 ~l~~~l~~~~~~~~l~~v~f~~sGsEAvE~AiKlA~~y~~r~~~~~~~~~~~~~kiis~~~syHG~T~gals~t~~~~~~  168 (431)
T TIGR03251        89 RFVDTFARVLGDPALPHLFFIEGGALAVENALKTAFDWKSRHNQARGIPAALGTQVLHLRQAFHGRSGYTLSLTNTDPRK  168 (431)
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCEECCCCCCCCCCCCCCCCC
T ss_conf             99999998508877785897586799999999999999764312345577776479997253659963333443687533


Q ss_pred             CCCCCCCCC----------------CCCCC---CHHHHHHHH---HCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             799986433----------------32221---002688754---10123322223332222112462101232211022
Q gi|254780432|r  149 EGFGPKIEG----------------FDQAK---FCDLQSLKN---QISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKIC  206 (392)
Q Consensus       149 ~~~~p~~~~----------------~~~~~---~~d~~~l~~---~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc  206 (392)
T Consensus       169 ~~~~p~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~iAAvI~EPIqG~gG~~~~p~~yl~~lr~lc  248 (431)
T TIGR03251       169 TARFPKFDWPRIDNPKLTFPLDAPNLDQVIALEEEALRQARAAFAERPHDIACFIAEPIQGEGGDNHFRPEFLRAMRALC  248 (431)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             57788778777779887688887650025556899999999999738995799996777677798568989999999998


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCHHHH
Q ss_conf             345721310110034444555310111245453021034444443443210001112222-2332234532111100123
Q gi|254780432|r  207 DDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACM-NQGSHGSTYGGNVLAMVLG  285 (392)
Q Consensus       207 ~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~-~~~~~~~T~~gnpl~~aaa  285 (392)
T Consensus       249 ~~~giLLI~DEVqtGfGRtG~~fa~e~~gv~PDiv~~gKgl~~g~~~~~~~~~~~~~~~~~~~~~~~sT~~gnpla~aaa  328 (431)
T TIGR03251       249 DEHDALLIFDEVQTGVGLTGTAWAYQQLGVQPDIVAFGKKTQVCGIMAGRRVDEVADNVFAVPSRLNSTWGGNLVDMVRA  328 (431)
T ss_pred             HHCCCEEECCCCEECCCCCCCCHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH
T ss_conf             76275055341013677667744677507889989877722355188899999999986417877678888898999999


Q ss_pred             HHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEE
Q ss_conf             3455432012221011210000268899998867970755046400999872499--89999999968989962689889
Q gi|254780432|r  286 EKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVV  363 (392)
Q Consensus       286 ~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~i  363 (392)
T Consensus       329 la~l~ii~~e~l~~~v~~~g~~l~~~L~~l~~~~p~~V~dVRG~GLm~giel~~~~~~~~~~~~~~~~Gll~~~~g~~~i  408 (431)
T TIGR03251       329 TRILEIIEEERLVDNARVQGAHLLARLHELAAEFPHLVSNPRGRGLMCAFDLPSTADRDEVIRQLYREGVLLLGCGERSI  408 (431)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCEEEEEECCCHHHHHHHHHHHHHCCCEEEECCCCEE
T ss_conf             98899986246999999999999999999987687824563013369999818816799999999978939974799989


Q ss_pred             EECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             95589868899999999999999
Q gi|254780432|r  364 RILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       364 rl~Ppl~it~~eid~~i~~l~~a  386 (392)
T Consensus       409 r~~PPL~it~~eid~~~~~l~~V  431 (431)
T TIGR03251       409 RFRPPLTVTREEIDAAIDAIRRV  431 (431)
T ss_pred             EEECCCCCCHHHHHHHHHHHCCC
T ss_conf             99889308899999999997269