HHsearch alignment for GI: 254780432 and conserved domain: TIGR03403

>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type. Members of this family are the NifS-like cysteine desulfurase of the epsilon division of the Proteobacteria, similar to the NifS protein of nitrogen-fixing bacteria. Like NifS, and unlike IscS, this protein is found as part of a system of just two proteins, a cysteine desulfurase and a scaffold, for iron-sulfur cluster biosynthesis. This protein is called NifS by Olsen, et al. (PMID:11123951), so we use this designation.
Probab=99.61  E-value=7.6e-14  Score=110.97  Aligned_cols=323  Identities=18%  Similarity=0.201  Sum_probs=185.1

Q ss_pred             EEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH-------HHHHHHC---CCCCCCCCCCCCCCHH
Q ss_conf             46410226743578789999999999997314506875781899999-------8652010---1333123565554035
Q gi|254780432|r   34 FLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFA-------NHLIHST---FADRVFFTNSGAESVE  103 (392)
Q Consensus        34 yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la-------~~L~~~~---~~~~v~f~~SGseA~e  103 (392)
T Consensus         2 YLD~aAt------t~~~~~Vi~~~~~~~~~~~~-Np~s~h~~~~~a~~~~e~aR~~ia~~l~a~~~~eIvFTsg~Tea~N   74 (382)
T TIGR03403         2 YLDNNAT------TMLDPKVKELMDPFFCDIYG-NPNSLHQFGTATHPAIAEALDKLYKGINARDLDDIIITSCATESNN   74 (382)
T ss_pred             CCCCCCC------CCCCHHHHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHHH
T ss_conf             4637356------89999999999999986689-9632539999999999999999999759699786999387589999


Q ss_pred             HHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             67776-65432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  104 CAIKT-ARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       104 ~Aikl-ar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
T Consensus        75 ~~~~gl~~~~--~~-~~~~~~ii~s~-~EH~sv~~~~----~~l~~~G~~v~~~~~d~~G~~d~~~l~~~l~~~T~LVai  146 (382)
T TIGR03403        75 WVLKGVYFDE--IL-KGGKNHIITTE-VEHPAVRATC----AFLESLGVEVTYLPINEQGTITAEQVREAITEKTALVSV  146 (382)
T ss_pred             HHHHHHHHHH--HH-CCCCCEEEEEC-CCCHHHHHHH----HHHHHCCCEEEEECCCCCCCCCHHHHHHHCCCCCCEEEE
T ss_conf             9999999998--63-68999999955-6515389999----999965978999775999858899999760146606776


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCC-CCCCCCCC
Q ss_conf             33222211246210123221102234572131011003444455531011124545302103--4444443-44321000
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA--KGMGGGF-PIGACLAT  259 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g--K~l~gG~-P~sav~~~  259 (392)
T Consensus       147 ~~anN~tG~i~p----v~~I~~~~~~~g~~~~vDa~Q~-~g~~--pidv~~l--~~D~l~~S~HK-~~-GP~GiG~L~ir  215 (382)
T TIGR03403       147 MWANNETGMIFP----IKEIGEICKERGVLFHTDAVQA-IGKI--PVDVQKA--GVDFLSFSAHK-FH-GPKGVGGLYIR  215 (382)
T ss_pred             ECCCCCCCCCCC----HHHHHHHHHHCCCEEEEEHHHH-CCCC--CCCCCCC--CCCEEEEEHHH-CC-CCCCEEEEEEC
T ss_conf             314767777787----9999999987298799671341-3564--6432323--46524531010-36-88834999986


Q ss_pred             CCCCCCCCCCCC---------CCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEE--EE-
Q ss_conf             111222223322---------34532111100123345543201--22210112100002688999988679707--55-
Q gi|254780432|r  260 NEVAACMNQGSH---------GSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMF--LE-  325 (392)
Q Consensus       260 ~~i~~~~~~~~~---------~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v--~~-  325 (392)
T Consensus       216 ~~~--~l~P~~~Gg~~~~~~r~GT~--n~~~i~~l~~A~~~~~~~~~~~~~~~~~L~~~l~~~L~~i----~~~~i~g~~  287 (382)
T TIGR03403       216 KGV--ELTPLFHGGEHMGGRRSGTL--NVPYIVAMGEAMRLANEYLDFEKSHVRRLRDRLEDALLEL----PDVFVVGDR  287 (382)
T ss_pred             CCC--CCCCCCCCCCCCCCCCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC----CCCEEECCH
T ss_conf             777--65876589877476127986--7889999999999999989999999999999999999817----794671683


Q ss_pred             -ECCC-EEEEEEEECCCHHHHHHHHHHCCEEEEEC-----------------------CCCEEEECCCCCCCHHHHHHHH
Q ss_conf             -0464-00999872499899999999689899626-----------------------8988995589868899999999
Q gi|254780432|r  326 -VRGQ-GLLIGLKTVFSPALLAAKFRDECLLTAPS-----------------------SDNVVRILPPLTITAEEIHEGL  380 (392)
Q Consensus       326 -vRG~-Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~-----------------------~~~~irl~Ppl~it~~eid~~i  380 (392)
T Consensus       288 ~~r~p~~~~~~~~~-i~~~~~~~~L~~~gI~v~~GsaCas~~~~~s~vl~a~g~~~~~~~~~vR~S~~~ynT~eeId~~i  366 (382)
T TIGR03403       288 EHRVPNTILISIKG-VEGEAMLWDLNKAGIAASTGSACASEDLEANPVMVAIGADKELAHTAIRLSLSRFTTEEEIDYTI  366 (382)
T ss_pred             HHCCCCEEEEECCC-CCHHHHHHHHCCCCEEEECHHHHCCCCCCCCHHHHHCCCCHHHCCCEEEEECCCCCCHHHHHHHH
T ss_conf             32588579862799-89899999847099799755772899887589999719985445957999758999999999999


Q ss_pred             HHHHHHHHHHC
Q ss_conf             99999999852
Q gi|254780432|r  381 ERIERTAIKLS  391 (392)
Q Consensus       381 ~~l~~al~~L~  391 (392)
T Consensus       367 ~~l~~~v~~lr  377 (382)
T TIGR03403       367 EVFKKAVQRLR  377 (382)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999998