HHsearch alignment for GI: 254780432 and conserved domain: TIGR03531

>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase. In the archaea and eukaryotes, the conversion of the mischarged serine to selenocysteine (Sec) on its tRNA is accomplished in two steps. This enzyme, O-phosphoseryl-tRNA(Sec) selenium transferase, acts second, after a phosphophorylation step catalyzed by a homolog of the bacterial SelA protein.
Probab=97.45  E-value=0.00049  Score=46.84  Aligned_cols=196  Identities=16%  Similarity=0.313  Sum_probs=111.6

Q ss_pred             HHHHHHHHC----CCCCCCCCCCCCCCCCCCCCC-CHHHHHHHHCCCCCCCCEEEECC---CCC---------CCCCCCC
Q ss_conf             268875410----123322223332222112462-10123221102234572131011---003---------4444555
Q gi|254780432|r  165 DLQSLKNQI----SNDTAAILIEPIQGEGGVRKV-PEEFLQQLRKICDDIDALLIFDE---VQT---------GYGRTGK  227 (392)
Q Consensus       165 d~~~l~~~~----~~~iAavi~Epv~g~~G~~~~-~~~~l~~l~~lc~~~g~llI~DE---V~t---------G~GRtG~  227 (392)
T Consensus       190 dv~~ie~~i~~~g~~~i~cVlSTT-----ScFAPR~~D~i~eiAklC~~~~IpHvVNNAYGlQ~~~~~~~i~~A~-r~GR  263 (444)
T TIGR03531       190 DVEDIERAIEEIGPENILCVLSTT-----SCFAPRSPDDIEEIAKICAKYDIPHVVNNAYGLQSNKYMEKINKAI-KVGR  263 (444)
T ss_pred             CHHHHHHHHHHHCCCCEEEEEECC-----CCCCCCCCCCHHHHHHHHHHCCCCEEECCHHHHHHHHHHHHHHHHH-HCCC
T ss_conf             999999999982867647998536-----5459999766999999999749983784203661799999999998-6498


Q ss_pred             CCCCCCCCCCCCEEE--CCCCCCCCCCCCC-CCCC--CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH------C--
Q ss_conf             310111245453021--0344444434432-1000--1112222233223453211110012334554320------1--
Q gi|254780432|r  228 LFAYEWANVKPDIMT--IAKGMGGGFPIGA-CLAT--NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQ------S--  294 (392)
Q Consensus       228 ~f~~e~~gi~PDi~~--~gK~l~gG~P~sa-v~~~--~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~------~--  294 (392)
T Consensus       264 ----------VDa~VQStDKNfl--VPVGGaII~s~d~~~i~~i-----s~~YPGR----AS~sp~lDlfITLLslG~~g  322 (444)
T TIGR03531       264 ----------VDAVVSSTDKNFM--VPVGGAIIYSFDENFIQEI-----SKSYPGR----ASASPSLDVLITLLSMGSKG  322 (444)
T ss_pred             ----------CEEEEEECCCCEE--EECCCEEEEECCHHHHHHH-----HHCCCCC----CCCCHHHHHHHHHHHHHHHH
T ss_conf             ----------3199970686625--4348748971888999999-----8418997----77740799999999974888


Q ss_pred             -CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEEC----CCHHHHHHHHHHCCEE---EEECCC------
Q ss_conf             -22210112100002688999988679707550464009998724----9989999999968989---962689------
Q gi|254780432|r  295 -DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV----FSPALLAAKFRDECLL---TAPSSD------  360 (392)
Q Consensus       295 -~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~----~~~~~~~~~l~~~Gll---~~~~~~------  360 (392)
T Consensus       323 y~~Ll~eRke~~~~l~~~L~~~a~~~gerlL~t~~N~IS~aitl~~l~~~~~t~lGsmLf~r~VsG~RVV~~~~~k~i~g  402 (444)
T TIGR03531       323 YLELLKERKEMYKYLKELLQKLAERHGERLLDVPENPISSAMTLNTLRPKDPTMLGSMLYSRRVTGPRVVTNGDSKTVGG  402 (444)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCCCEEECCCCCEEECC
T ss_conf             99999999999999999999999982987214899950577873667876789999999736887561775899738878


Q ss_pred             --------C-------EEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             --------8-------89955898688999999999999999
Q gi|254780432|r  361 --------N-------VVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       361 --------~-------~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
T Consensus       403 ~~F~~~gsh~~~yp~~Ylt~aaaIG~~~~dvd~f~~rLdk~l  444 (444)
T TIGR03531       403 CEFKGYGSHTSNYPCPYITAAAAIGMTKEDVDTFVSRLEKSL  444 (444)
T ss_pred             EEEECCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHCC
T ss_conf             775067777677852579988881885899999999986149