HHsearch alignment for GI: 254780432 and conserved domain: cd00378

>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). SHMT carries out interconversion of serine and glycine; it catalyzes the transfer of hydroxymethyl group of N5, N10-methylene tetrahydrofolate to glycine resulting in the formation of serine and tetrahydrofolate. Both eukaryotic and prokaryotic SHMT enzymes form tight obligate homodimers; the mammalian enzyme forms a homotetramer comprising four pyridoxal phosphate-bound active sites.
Probab=98.08  E-value=0.00072  Score=45.73  Aligned_cols=281  Identities=21%  Similarity=0.267  Sum_probs=139.3

Q ss_pred             HHHHCCCCCCCC-CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC-CCC---CCCCCCCCCCCCCCCCCCCC
Q ss_conf             520101333123-5655540356777665432001347860023435465654-321---23455321134799986433
Q gi|254780432|r   83 LIHSTFADRVFF-TNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGR-TLA---TISAGGKLQYLEGFGPKIEG  157 (392)
Q Consensus        83 L~~~~~~~~v~f-~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~-t~~---a~s~s~~~~~~~~~~p~~~~  157 (392)
T Consensus        74 ak~LF~a~~anVqp~SGs~AN~av~~-al------l~pGD-~il~l~l~~GGHltHg~~~~v~~~g~~~~~~~Y~vd~~-  144 (402)
T cd00378          74 AKKLFGAEYANVQPHSGSQANLAVYF-AL------LEPGD-TIMGLDLSHGGHLTHGSFTKVSASGKLFESVPYGVDPE-  144 (402)
T ss_pred             HHHHHCCCCCCCCCCCHHHHHHHHHH-HH------HCCCC-EEEEECCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCC-
T ss_conf             99983898747587873999999999-97------27999-89986643477756677877202135678896324556-


Q ss_pred             CCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             3222100268875410123322223332222112462101232211022345721310110-034444555310111245
Q gi|254780432|r  158 FDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV-QTGYGRTGKLFAYEWANV  236 (392)
Q Consensus       158 ~~~~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV-~tG~GRtG~~f~~e~~gi  236 (392)
T Consensus       145 ~~~IDyd~~~~~a~~--~kPklIi~----G~-S~y~r~~d-~~~~reIad~vgA~l~~D~aHi~GLIA~g~-~p~P-l~-  213 (402)
T cd00378         145 TGLIDYDALEKMALE--FKPKLIVA----GA-SAYPRPID-FKRFREIADEVGAYLLVDMAHVAGLVAGGV-FPNP-LP-  213 (402)
T ss_pred             CCCCCHHHHHHHHHH--CCCCEEEE----CC-CCCCCCCC-HHHHHHHHHHCCCEEEEEHHHHHHHEECCC-CCCC-CC-
T ss_conf             587189999999986--59969997----77-15656558-899999998709889855012344303565-7997-68-


Q ss_pred             CCCEEECC--CCCCCCCCCCCCCCC-C-CCCCCCCCCCCCCCCCCCCCCHHHHHH-HHHHHHC---CCCCCHHHHHCCHH
Q ss_conf             45302103--444444344321000-1-112222233223453211110012334-5543201---22210112100002
Q gi|254780432|r  237 KPDIMTIA--KGMGGGFPIGACLAT-N-EVAACMNQGSHGSTYGGNVLAMVLGEK-VLNIIQS---DGFLENVINIAKIL  308 (392)
Q Consensus       237 ~PDi~~~g--K~l~gG~P~sav~~~-~-~i~~~~~~~~~~~T~~gnpl~~aaa~a-~L~~l~~---~~l~~~~~~~g~~l  308 (392)
T Consensus       214 ~ADvvt~tTHKTlrG--PrGGiIl~~~~~~~~kId~avfPg~qggph~h~iAa~Aval~Ea~~~~f~~Ya~qVv~NAkaL  291 (402)
T cd00378         214 GADVVTTTTHKTLRG--PRGGLILTRKGELAKKINSAVFPGLQGGPHLHVIAAKAVALKEALEPEFKAYAKQVVENAKAL  291 (402)
T ss_pred             CCEEEECCCCCCCCC--CCCEEEEECCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH
T ss_conf             765774464345789--984089954278998854650986446745667899999999986866899999999999999


Q ss_pred             HHHHHHHHHHCCCEEEEECCCEEEEEEEEC---CCHHHHHHHHHHCCEEEE----EC------CCCEEEECCC-CC---C
Q ss_conf             688999988679707550464009998724---998999999996898996----26------8988995589-86---8
Q gi|254780432|r  309 FEGLTAIKNRFPNMFLEVRGQGLLIGLKTV---FSPALLAAKFRDECLLTA----PS------SDNVVRILPP-LT---I  371 (392)
Q Consensus       309 ~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~---~~~~~~~~~l~~~Gll~~----~~------~~~~irl~Pp-l~---i  371 (392)
T Consensus       292 A~~L~~~--G~-~vv~ggTd~H~vl-vd~~~~g~~G~~a~~~Le~~gI~~Nkn~iP~d~~~~~~~sGiRiGT~a~T~rG~  367 (402)
T cd00378         292 AEALKER--GF-KVVSGGTDNHLVL-VDLRPKGITGKAAEDALEEAGITVNKNTLPWDPSSPFVPSGIRIGTPAMTTRGM  367 (402)
T ss_pred             HHHHHHC--CC-EEECCCCCCCEEE-EECCCCCCCHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCEEECCHHHHHCCC
T ss_conf             9999858--94-7974899887799-966645689999999999849087547488999999999761647789985899


Q ss_pred             CHHHHHHHHHHHHHHHHH
Q ss_conf             899999999999999998
Q gi|254780432|r  372 TAEEIHEGLERIERTAIK  389 (392)
Q Consensus       372 t~~eid~~i~~l~~al~~  389 (392)
T Consensus       368 ~e~em~~ia~lI~~~l~~  385 (402)
T cd00378         368 GEEEMEEIADFIARALKD  385 (402)
T ss_pred             CHHHHHHHHHHHHHHHHC
T ss_conf             889999999999999817