HHsearch alignment for GI: 254780432 and conserved domain: cd06453

>cd06453 SufS_like Cysteine desulfurase (SufS)-like. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to cysteine desulfurase (SufS) and selenocysteine lyase. SufS catalyzes the removal of elemental sulfur and selenium atoms from L-cysteine, L-cystine, L-selenocysteine, and L-selenocystine to produce L-alanine; and selenocysteine lyase catalyzes the decomposition of L-selenocysteine.
Probab=99.74  E-value=1.5e-16  Score=128.61  Aligned_cols=322  Identities=15%  Similarity=0.171  Sum_probs=191.5

Q ss_pred             EEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHH-------HHHHHHHHHCC---CCCCCCCCCCCCCHH
Q ss_conf             46410226743578789999999999997314506875781899-------99986520101---333123565554035
Q gi|254780432|r   34 FLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE-------IFANHLIHSTF---ADRVFFTNSGAESVE  103 (392)
Q Consensus        34 yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~-------~la~~L~~~~~---~~~v~f~~SGseA~e  103 (392)
T Consensus         2 YlD~aat------t~~~~~V~~~~~~~~~~~~~np~~~~~~~~~~a~~~le~aR~~ia~~lg~~~~~eI~fts~aTea~n   75 (373)
T cd06453           2 YLDNAAT------SQKPQPVIDAIVDYYRHYNANVHRGVHELSARATDAYEAAREKVARFINAPSPDEIIFTRNTTEAIN   75 (373)
T ss_pred             CCCCCCC------CCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHH
T ss_conf             4548764------6899999999999999758998730509999999999999999999749699897999188679987


Q ss_pred             HHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             67776-65432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  104 CAIKT-ARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       104 ~Aikl-ar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
T Consensus        76 ~~~~~l~~~~-----~~gd-~Vi~s~~EH~s-~~~p~~---~la~~~G~~v~~ip~~~~G~i~~~~l~~~i~~~T~lV~~  145 (373)
T cd06453          76 LVAYGLGRAN-----KPGD-EIVTSVMEHHS-NIVPWQ---QLAERTGAKLKVVPVDDDGQLDLEALEKLLTERTKLVAV  145 (373)
T ss_pred             HHHHHHHHCC-----CCCC-EEEECCCCCCC-HHHHHH---HHHHHCCCEEEEECCCCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             8865302026-----9999-89976011124-278999---998705958985078978858899999754589569999


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCCCCCCCCCCC
Q ss_conf             33222211246210123221102234572131011003444455531011124545302103--4444443443210001
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA--KGMGGGFPIGACLATN  260 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g--K~l~gG~P~sav~~~~  260 (392)
T Consensus       146 ~~v~n~tG~~~p----i~~I~~~~~~~g~~~~vDa~Qa-~g~~----~idv~~~~~D~~~~s~hK-~~GP~G~G~Lyv~~  215 (373)
T cd06453         146 THVSNVLGTINP----VKEIGEIAHEAGVPVLVDGAQS-AGHM----PVDVQDLGCDFLAFSGHK-MLGPTGIGVLYGKE  215 (373)
T ss_pred             ECCCCCCCCCCC----HHHHHHHHHHCCCEEEEECCCC-CCCC----CCCHHHHHCCEEEEECHH-CCCCCCEEEEEECC
T ss_conf             785667760887----9999999987497699876212-4554----651777627738976101-15888349999860


Q ss_pred             CCCCCCCCCCCCCC---------------------CCCCCCCHHHHHHHHHHHHCC---CCCCHHHHHCCHHHHHHHHHH
Q ss_conf             11222223322345---------------------321111001233455432012---221011210000268899998
Q gi|254780432|r  261 EVAACMNQGSHGST---------------------YGGNVLAMVLGEKVLNIIQSD---GFLENVINIAKILFEGLTAIK  316 (392)
Q Consensus       261 ~i~~~~~~~~~~~T---------------------~~gnpl~~aaa~a~L~~l~~~---~l~~~~~~~g~~l~~~L~~l~  316 (392)
T Consensus       216 ~~~~~l~p~~~gg~~~~~~~~~~~~~~~~~~rfe~GT~n~~~i~~l~~al~~~~~~g~~~i~~~~~~L~~~l~~~L~~l~  295 (373)
T cd06453         216 ELLEEMPPYGGGGEMIEEVSFEETTYADLPHKFEAGTPNIAGAIGLGAAIDYLEKIGMEAIAAHEHELTAYALERLSEIP  295 (373)
T ss_pred             HHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             14524783316887533323432222555220255675588999999999999984899999999999999999996389


Q ss_pred             HHCCCEEEEECCCEEEEEEEEC-CCHHHHHHHHHHCCEEEEEC------------CCCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             8679707550464009998724-99899999999689899626------------8988995589868899999999999
Q gi|254780432|r  317 NRFPNMFLEVRGQGLLIGLKTV-FSPALLAAKFRDECLLTAPS------------SDNVVRILPPLTITAEEIHEGLERI  383 (392)
Q Consensus       317 ~~~~~~v~~vRG~Gl~~~ie~~-~~~~~~~~~l~~~Gll~~~~------------~~~~irl~Ppl~it~~eid~~i~~l  383 (392)
T Consensus       296 ~--v~i~~~~~~r~~ivsf~~~~~~~~~v~~~L~~~gI~vs~G~~Ca~~~~~~~g~~g~iRvS~~~ynt~~dId~li~al  373 (373)
T cd06453         296 G--VRVYGDAEDRAGVVSFNLEGIHPHDVATILDQYGIAVRAGHHCAQPLMRRLGVPGTVRASFGLYNTEEEIDALVEAL  373 (373)
T ss_pred             C--CEECCCCCCCCCEEEEEECCCCHHHHHHHHHHCCEEEECCCCCCHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHC
T ss_conf             9--76248845568889999699599999999967992997863324488997289987999688889999999999559