HHsearch alignment for GI: 254780432 and conserved domain: cd06454

>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to serine palmitoyltransferase (SPT), 5-aminolevulinate synthase (ALAS), 8-amino-7-oxononanoate synthase (AONS), and 2-amino-3-ketobutyrate CoA ligase (KBL). SPT is responsible for the condensation of L-serine with palmitoyl-CoA to produce 3-ketodihydrospingosine, the reaction of the first step in sphingolipid biosynthesis. ALAS is involved in heme biosynthesis; it catalyzes the synthesis of 5-aminolevulinic acid from glycine and succinyl-coenzyme A. AONS catalyses the decarboxylative condensation of l-alanine and pimeloyl-CoA in the first committed step of biotin biosynthesis. KBL catalyzes the second reaction step of the metabolic degradation pathway for threonine converting 2-amino-3-ketobutyrate, to glycine and acetyl-CoA. The members of this CD are widely found in all three forms of life.
Probab=99.96  E-value=7.2e-28  Score=202.68  Aligned_cols=317  Identities=19%  Similarity=0.237  Sum_probs=219.4

Q ss_pred             CEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCC--C-CC--CCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHH
Q ss_conf             76464102267435787-89999999999997314506--8-75--7818999998652010133312356555403567
Q gi|254780432|r   32 IPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVS--N-LY--QSTQQEIFANHLIHSTFADRVFFTNSGAESVECA  105 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~--~-~~--~~~~~~~la~~L~~~~~~~~v~f~~SGseA~e~A  105 (392)
T Consensus         1 r~~l~f~s---~dYLgL~~~p~~~~a~~~a~~~~G~g~~~sr~~~G~~~~~~~lE~~la~~~g~e~al~~~sG~~an~~~   77 (349)
T cd06454           1 KKVLNFCS---NDYLGLANHPEVIEAAKEALDKYGVGAGGSRLISGTSDLHEELEEELAEFHGKEAALVFSSGYAANDGV   77 (349)
T ss_pred             CCEEEEEC---CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHH
T ss_conf             95899766---632478989999999999999739988876736478799999999999986998199955707877888


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC-----CCCCC
Q ss_conf             7766543200134786002343546565432123455321134799986433322210026887541012-----33222
Q gi|254780432|r  106 IKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-----DTAAI  180 (392)
Q Consensus       106 iklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~-----~iAav  180 (392)
T Consensus        78 i~~l---------~~~~d~i~~D~~~H~si~~G~~~s~------------a~~~~f~Hnd~~~L~~~l~~~~~~~~~~~i  136 (349)
T cd06454          78 LSTL---------AGKGDLIISDSLNHASIIDGIRLSG------------AKKRIFKHNDMEDLEKLLREARRPYGKKLI  136 (349)
T ss_pred             HHHC---------CCCCCEEEECCCCCHHHHHHHHCCC------------CCEEEECCCCHHHHHHHHHHHHCCCCCEEE
T ss_conf             8620---------5789779741534372886365244------------647997899999999999853225897699


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCC--CCCCCCCCCCCCCCCC--CCCEE--ECCCCCCCCCCCC
Q ss_conf             2333222211246210123221102234572131011003--4444555310111245--45302--1034444443443
Q gi|254780432|r  181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQT--GYGRTGKLFAYEWANV--KPDIM--TIAKGMGGGFPIG  254 (392)
Q Consensus       181 i~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~t--G~GRtG~~f~~e~~gi--~PDi~--~~gK~l~gG~P~s  254 (392)
T Consensus       137 v~egv~Sm~Gd~ap----L~~l~~l~~~~~~~livDeAH~~Gv~G~~G~G~-~~~~~~~~~~di~~~tlsKa~G~--~Gg  209 (349)
T cd06454         137 VTEGVYSMDGDIAP----LPELVDLAKKYGAILFVDEAHSVGVYGPHGRGV-EEFGGLTDDVDIIMGTLGKAFGA--VGG  209 (349)
T ss_pred             EECCCCCCCCCCCC----HHHHHHHHHHHCCEEEEECHHHCCCCCCCCCCH-HHHCCCCCCCEEEECCCCCCCCC--CCC
T ss_conf             96576788877679----899999999829789972323317415888767-88658988667998536543467--771


Q ss_pred             CCCCCCCCCCCCCCC--CCCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCC-E
Q ss_conf             210001112222233--22345321111001233455432012-2210112100002688999988679707550464-0
Q gi|254780432|r  255 ACLATNEVAACMNQG--SHGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQ-G  330 (392)
Q Consensus       255 av~~~~~i~~~~~~~--~~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~-G  330 (392)
T Consensus       210 ~v~g~~~~i~~l~~~~~~~i~s~~l~p~~~aa~~~al~~l~~~~~~~~~L~~~~~~~~~~l~~~g--~-~----i~~~~~  282 (349)
T cd06454         210 YIAGSKELIDYLRSYARGFIFSTSLPPAVAAAALAALEVLQGGPERRERLQENVRYLRRGLKELG--F-P----VGGSPS  282 (349)
T ss_pred             EEECCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCC--C-C----CCCCCC
T ss_conf             24253568999986198857777768999999999999986395889999999999999999769--9-7----579999


Q ss_pred             -EEEEE--EECCCHHHHHHHHHHCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             -09998--72499899999999689899626-------8988995589868899999999999999
Q gi|254780432|r  331 -LLIGL--KTVFSPALLAAKFRDECLLTAPS-------SDNVVRILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       331 -l~~~i--e~~~~~~~~~~~l~~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i~~l~~a  386 (392)
T Consensus       283 ~~i~~~~~~~~~~a~~~~~~L~~~Gi~v~~~~~Ptvp~~~~~lRi~~sa~ht~edId~li~~l~ev  348 (349)
T cd06454         283 HIIPPLIGDDPAKAVAFSDALLERGIYVQAIRYPTVPRGTARLRISLSAAHTKEDIDRLLEALKEV  348 (349)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             727999869999999999999887962863798978999835999868779999999999999974