Query         gi|254780432|ref|YP_003064845.1| acetylornithine transaminase protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 392
No_of_seqs    157 out of 10448
Neff          7.4 
Searched_HMMs 39220
Date          Sun May 29 21:44:48 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780432.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00707 argD acetylornithine 100.0       0       0  920.9  22.5  382    6-388     1-402 (402)
  2 TIGR01885 Orn_aminotrans ornit 100.0       0       0  862.1  19.8  386    2-387    12-426 (426)
  3 COG4992 ArgD Ornithine/acetylo 100.0       0       0  843.0  24.9  385    3-391    13-400 (404)
  4 PRK02627 acetylornithine amino 100.0       0       0  829.2  27.6  387    3-390    10-397 (398)
  5 PRK12381 bifunctional succinyl 100.0       0       0  807.6  28.8  387    4-391    11-401 (406)
  6 PRK05093 argD bifunctional N-s 100.0       0       0  808.4  27.3  387    4-391    12-402 (403)
  7 PRK01278 argD bifunctional N-s 100.0       0       0  808.0  27.4  384    7-390     6-389 (389)
  8 TIGR03246 arg_catab_astC succi 100.0       0       0  798.1  27.7  386    4-390     7-396 (397)
  9 PTZ00125 ornithine aminotransf 100.0       0       0  789.3  27.0  387    3-391    20-415 (415)
 10 PRK04073 rocD ornithine--oxo-a 100.0       0       0  789.5  25.8  383    3-388    11-396 (396)
 11 PRK04612 argD bifunctional N-s 100.0       0       0  786.0  27.8  386    4-390    12-404 (408)
 12 PRK02936 argD acetylornithine  100.0       0       0  788.6  25.5  376    5-387     2-377 (377)
 13 PRK00854 rocD ornithine--oxo-a 100.0       0       0  778.6  24.8  384    2-388    14-403 (404)
 14 PRK03244 argD acetylornithine  100.0       0       0  775.9  25.4  378    4-391    15-396 (398)
 15 PRK07030 adenosylmethionine--8 100.0       0       0  776.0  25.3  386    3-391    11-448 (467)
 16 PRK03715 argD bifunctional N-s 100.0       0       0  771.4  28.2  384    4-391     8-395 (395)
 17 COG0160 GabT 4-aminobutyrate a 100.0       0       0  772.6  25.0  380    4-391    26-447 (447)
 18 PRK05965 hypothetical protein; 100.0       0       0  767.4  26.8  387    3-391    10-449 (459)
 19 PRK08593 4-aminobutyrate amino 100.0       0       0  766.1  26.2  384    2-392    13-435 (448)
 20 PRK04260 acetylornithine amino 100.0       0       0  767.6  24.3  374    5-387     2-375 (375)
 21 PRK07678 aminotransferase; Val 100.0       0       0  764.4  26.7  388    3-391    14-451 (451)
 22 PRK07482 hypothetical protein; 100.0       0       0  763.5  26.8  388    3-391    12-456 (461)
 23 PRK06541 hypothetical protein; 100.0       0       0  765.3  24.9  387    3-391    16-457 (460)
 24 PRK06148 hypothetical protein; 100.0       0       0  764.2  25.2  376    5-390   596-1013(1015)
 25 PRK11522 putrescine--2-oxoglut 100.0       0       0  762.0  26.9  373   16-391    75-462 (468)
 26 PRK08742 adenosylmethionine--8 100.0       0       0  764.1  25.1  385    3-390    27-468 (472)
 27 PRK07481 hypothetical protein; 100.0       0       0  761.9  26.6  387    3-391     6-446 (448)
 28 PRK06105 aminotransferase; Pro 100.0       0       0  760.9  26.7  386    3-391    12-451 (460)
 29 cd00610 OAT_like Acetyl ornith 100.0       0       0  760.9  26.4  378    3-387     5-413 (413)
 30 PRK07495 4-aminobutyrate amino 100.0       0       0  760.9  26.2  380    5-391    10-421 (422)
 31 PRK13360 omega amino acid--pyr 100.0       0       0  760.2  26.4  386    3-391    10-441 (441)
 32 PRK09221 beta alanine--pyruvat 100.0       0       0  758.9  26.6  387    2-391    13-445 (445)
 33 PRK06916 adenosylmethionine--8 100.0       0       0  759.6  26.0  387    3-392    22-460 (462)
 34 PRK06943 adenosylmethionine--8 100.0       0       0  757.8  27.2  385    3-390    17-446 (452)
 35 PRK07323 consensus             100.0       0       0  757.2  26.6  379    3-390    28-443 (443)
 36 PRK07480 putative aminotransfe 100.0       0       0  757.0  26.4  386    3-391    17-453 (459)
 37 PRK08360 4-aminobutyrate amino 100.0       0       0  756.9  26.2  381    4-391    11-428 (443)
 38 PRK05769 4-aminobutyrate amino 100.0       0       0  754.3  26.7  379    3-390    25-441 (442)
 39 PRK05964 adenosylmethionine--8 100.0       0       0  752.2  27.4  384    3-390     8-421 (421)
 40 PRK08117 4-aminobutyrate amino 100.0       0       0  752.2  26.9  382    3-391    11-429 (429)
 41 PRK07036 hypothetical protein; 100.0       0       0  753.2  26.1  387    3-392    15-455 (466)
 42 PRK06058 4-aminobutyrate amino 100.0       0       0  751.7  26.6  379    5-390    28-446 (446)
 43 PRK06917 hypothetical protein; 100.0       0       0  748.3  26.9  387    4-391     2-439 (447)
 44 PRK06918 4-aminobutyrate amino 100.0       0       0  747.8  26.8  379    5-390    27-445 (454)
 45 COG0161 BioA Adenosylmethionin 100.0       0       0  750.5  24.2  386    3-390     9-444 (449)
 46 PRK08088 4-aminobutyrate amino 100.0       0       0  748.2  25.9  382    3-391    12-426 (426)
 47 PRK06777 4-aminobutyrate amino 100.0       0       0  747.2  26.6  374    8-388    15-420 (421)
 48 PRK07894 consensus             100.0       0       0  748.1  25.9  385    3-390    13-429 (430)
 49 PRK07483 hypothetical protein; 100.0       0       0  745.7  26.5  385    5-390     2-438 (443)
 50 PRK06082 4-aminobutyrate amino 100.0       0       0  747.2  25.3  380    3-391    42-454 (460)
 51 PRK05639 4-aminobutyrate amino 100.0       0       0  745.5  25.8  380    4-391    23-445 (457)
 52 PRK06173 adenosylmethionine--8 100.0       0       0  744.1  26.3  387    3-392    10-428 (429)
 53 PRK06931 diaminobutyrate--2-ox 100.0       0       0  742.0  26.9  380    3-390    23-450 (454)
 54 PRK06149 hypothetical protein; 100.0       0       0  745.2  24.3  369   11-389   564-970 (972)
 55 PRK09044 consensus             100.0       0       0  743.0  25.8  385    2-389     7-417 (418)
 56 PRK09264 diaminobutyrate--2-ox 100.0       0       0  740.2  27.5  380    5-391    11-418 (426)
 57 PRK08555 consensus             100.0       0       0  740.3  27.1  378    4-390    21-443 (443)
 58 PRK06062 hypothetical protein; 100.0       0       0  739.9  26.3  380    3-391     3-430 (434)
 59 PRK08466 consensus             100.0       0       0  738.1  27.1  385    3-391    10-430 (430)
 60 PRK06938 diaminobutyrate--2-ox 100.0       0       0  741.1  24.8  377    6-390    36-461 (464)
 61 PRK05630 adenosylmethionine--8 100.0       0       0  739.6  25.8  383    3-388    10-421 (423)
 62 PRK09792 PLP-dependent GABA am 100.0       0       0  738.4  26.3  376    7-389    14-421 (421)
 63 PRK12403 putative aminotransfe 100.0       0       0  737.6  26.1  385    4-391    19-454 (460)
 64 PRK07986 adenosylmethionine--8 100.0       0       0  736.2  26.1  386    3-392     9-426 (428)
 65 PRK04013 argD acetylornithine/ 100.0       0       0  731.3  27.1  362   10-392     2-363 (364)
 66 TIGR03372 putres_am_tran putre 100.0       0       0  732.7  24.2  370   15-387    58-442 (442)
 67 TIGR02407 ectoine_ectB diamino 100.0       0       0  735.8  20.0  380    3-389     5-413 (413)
 68 PRK08297 L-lysine aminotransfe 100.0       0       0  724.1  23.0  388    4-391    25-449 (449)
 69 KOG1402 consensus              100.0       0       0  713.7  18.6  386    3-388    30-426 (427)
 70 TIGR00700 GABAtrnsam 4-aminobu 100.0       0       0  709.3  18.9  368   14-388    15-426 (427)
 71 TIGR03251 LAT_fam L-lysine 6-t 100.0       0       0  705.0  22.2  383    4-386     9-431 (431)
 72 PRK00062 glutamate-1-semialdeh 100.0       0       0  681.4  24.2  372    8-391    28-428 (429)
 73 KOG1404 consensus              100.0       0       0  673.2  19.7  368    9-383    27-432 (442)
 74 PRK12389 glutamate-1-semialdeh 100.0       0       0  660.6  24.0  367   13-391    34-429 (429)
 75 PRK06942 glutamate-1-semialdeh 100.0       0       0  656.3  23.4  371    8-390    26-425 (425)
 76 PRK00615 glutamate-1-semialdeh 100.0       0       0  652.5  23.1  371    9-391    30-430 (433)
 77 pfam00202 Aminotran_3 Aminotra 100.0       0       0  654.5  18.5  321   17-339     1-338 (338)
 78 PRK07046 aminotransferase; Val 100.0       0       0  623.9  23.7  367   11-391    53-451 (452)
 79 KOG1401 consensus              100.0       0       0  619.1  20.2  387    5-391    29-432 (433)
 80 PRK06209 glutamate-1-semialdeh 100.0       0       0  606.4  23.3  351   14-391    30-407 (431)
 81 TIGR00713 hemL glutamate-1-sem 100.0       0       0  607.3  20.2  371    8-390    24-434 (434)
 82 TIGR00709 dat 2,4-diaminobutyr 100.0       0       0  598.2  20.3  376    7-391    13-440 (445)
 83 COG0001 HemL Glutamate-1-semia 100.0       0       0  543.5  22.6  366   14-391    35-430 (432)
 84 KOG1403 consensus              100.0       0       0  500.9  16.8  369   11-390    26-438 (452)
 85 TIGR00699 GABAtrns_euk 4-amino 100.0       0       0  496.2  16.2  368   13-387    40-469 (469)
 86 KOG1405 consensus              100.0       0       0  439.0  17.3  371   13-390    57-484 (484)
 87 TIGR00508 bioA adenosylmethion 100.0       0       0  333.2  17.3  386    3-389    11-465 (466)
 88 PRK06939 2-amino-3-ketobutyrat 100.0   6E-30 1.5E-34  216.3  14.5  342   10-390    20-394 (395)
 89 PRK05958 8-amino-7-oxononanoat 100.0 2.4E-29 6.2E-34  212.3  15.7  340   12-389    20-386 (387)
 90 TIGR00858 bioF 8-amino-7-oxono 100.0 3.2E-29 8.3E-34  211.5  11.5  337   13-384     3-378 (378)
 91 cd06454 KBL_like KBL_like; thi 100.0 7.2E-28 1.8E-32  202.7  15.5  317   32-386     1-348 (349)
 92 PRK13392 5-aminolevulinate syn 100.0 1.3E-27 3.2E-32  201.1  16.1  344   11-391    20-399 (410)
 93 PRK07505 hypothetical protein; 100.0 2.1E-26 5.3E-31  193.1  18.1  342   16-391    33-404 (405)
 94 PRK13393 5-aminolevulinate syn 100.0 1.9E-26 4.9E-31  193.4  17.5  342   11-390    19-397 (404)
 95 PRK09064 5-aminolevulinate syn  99.9 1.9E-26 4.9E-31  193.4  16.3  337   17-391    25-398 (406)
 96 PRK07179 hypothetical protein;  99.9 7.5E-27 1.9E-31  196.0  13.1  323   29-391    51-401 (408)
 97 TIGR01821 5aminolev_synth 5-am  99.9 3.7E-26 9.5E-31  191.5  12.5  334   18-391    26-423 (427)
 98 COG0156 BioF 7-keto-8-aminopel  99.9 5.2E-25 1.3E-29  184.0  14.6  330   17-386    25-387 (388)
 99 TIGR01825 gly_Cac_T_rel pyrido  99.9 9.9E-24 2.5E-28  175.6  15.6  333   13-391    15-390 (392)
100 PRK05937 8-amino-7-oxononanoat  99.9 2.9E-23 7.5E-28  172.5  15.3  318   30-391     2-352 (370)
101 TIGR01822 2am3keto_CoA 2-amino  99.9   3E-23 7.6E-28  172.5  14.4  332   13-390    19-392 (395)
102 PRK06225 aspartate aminotransf  99.8 2.6E-17 6.6E-22  133.6  16.6  329   33-391    23-373 (375)
103 PRK07212 consensus              99.8 6.9E-17 1.8E-21  130.9  17.2  330   29-387    28-377 (378)
104 PRK05764 aspartate aminotransf  99.8 1.8E-16 4.5E-21  128.2  17.8  334   29-391    28-389 (389)
105 PRK07367 consensus              99.8 2.7E-16 6.9E-21  127.0  18.0  335   29-390    25-385 (385)
106 cd06453 SufS_like Cysteine des  99.7 1.5E-16 3.9E-21  128.6  15.0  322   34-383     2-373 (373)
107 PRK07324 transaminase; Validat  99.7 1.6E-16 4.2E-21  128.4  15.1  306   64-392    56-373 (373)
108 PRK05957 aspartate aminotransf  99.7 4.6E-16 1.2E-20  125.5  17.4  336   29-391    24-387 (389)
109 PRK08361 aspartate aminotransf  99.7 2.7E-16 6.8E-21  127.0  15.7  334   31-390    31-390 (390)
110 TIGR03392 FeS_syn_CsdA cystein  99.7 5.5E-15 1.4E-19  118.4  21.3  333   29-391    14-397 (398)
111 PRK06056 consensus              99.7 1.3E-15 3.2E-20  122.6  18.0  333   29-390    31-401 (402)
112 PRK10874 cysteine sulfinate de  99.7 5.1E-15 1.3E-19  118.7  21.1  333   29-391    17-400 (401)
113 PRK05794 consensus              99.7 9.2E-16 2.3E-20  123.5  17.1  332   29-390    27-396 (397)
114 KOG1359 consensus               99.7 3.4E-16 8.7E-21  126.3  14.8  331   15-390    49-413 (417)
115 PRK07778 consensus              99.7   9E-16 2.3E-20  123.6  16.9  334   29-388    27-385 (386)
116 PRK05942 aspartate aminotransf  99.7   8E-16   2E-20  123.9  16.6  334   29-389    32-392 (394)
117 PRK07683 aminotransferase A; V  99.7 1.9E-15 4.9E-20  121.4  18.2  334   30-390    26-384 (387)
118 pfam00155 Aminotran_1_2 Aminot  99.7 5.1E-16 1.3E-20  125.2  15.1  323   32-383     1-351 (351)
119 PRK08443 consensus              99.7 2.1E-15 5.3E-20  121.2  18.0  337   29-390    26-387 (388)
120 PRK06348 aspartate aminotransf  99.7 1.7E-15 4.2E-20  121.8  17.3  329   32-386    29-382 (383)
121 PRK06375 consensus              99.7 1.7E-15 4.3E-20  121.8  17.3  334   29-390    26-381 (381)
122 PRK08362 consensus              99.7 1.7E-15 4.3E-20  121.8  16.8  335   30-390    24-386 (389)
123 PRK03566 consensus              99.7   2E-15   5E-20  121.4  16.1  321   32-389    32-364 (365)
124 PRK08069 consensus              99.7 3.1E-15 7.9E-20  120.1  16.7  333   29-388    27-390 (390)
125 PRK06107 aspartate aminotransf  99.7 8.9E-15 2.3E-19  117.1  18.5  333   29-390    30-401 (402)
126 PRK02731 histidinol-phosphate   99.7 3.5E-15 8.9E-20  119.7  16.4  321   32-389    32-366 (367)
127 PRK07337 aminotransferase; Val  99.7 4.5E-15 1.1E-19  119.0  16.9  328   29-387    27-387 (388)
128 PRK07550 hypothetical protein;  99.7 5.8E-15 1.5E-19  118.3  16.8  327   29-385    27-384 (387)
129 PRK06108 aspartate aminotransf  99.7   6E-15 1.5E-19  118.2  16.8  335   30-389    22-382 (382)
130 KOG1360 consensus               99.7 1.4E-15 3.6E-20  122.3  13.5  310   45-391   181-526 (570)
131 PRK07682 hypothetical protein;  99.7 4.3E-15 1.1E-19  119.1  15.9  335   30-391    18-378 (378)
132 PRK03321 putative aminotransfe  99.7 5.6E-15 1.4E-19  118.4  16.3  318   33-389    23-351 (352)
133 TIGR03537 DapC succinyldiamino  99.7 1.2E-14   3E-19  116.3  17.8  329   33-385     1-349 (350)
134 PRK09276 aspartate aminotransf  99.7 3.3E-15 8.4E-20  119.9  14.9  329   29-386    28-385 (385)
135 PRK07568 aspartate aminotransf  99.7   1E-14 2.6E-19  116.7  17.3  338   29-391    27-394 (396)
136 PRK06575 consensus              99.7 1.6E-14   4E-19  115.5  18.2  333   29-390    28-399 (399)
137 PRK07681 aspartate aminotransf  99.7 5.7E-15 1.5E-19  118.3  15.9  329   29-386    29-385 (399)
138 PRK07543 consensus              99.7 5.2E-15 1.3E-19  118.6  15.6  333   29-390    28-399 (400)
139 PRK07366 succinyldiaminopimela  99.7 7.2E-15 1.8E-19  117.7  16.1  332   29-387    27-388 (388)
140 PRK09148 aminotransferase; Val  99.7 6.3E-15 1.6E-19  118.1  15.7  332   29-390    28-392 (406)
141 PRK06290 aspartate aminotransf  99.7 7.8E-15   2E-19  117.4  16.1  332   29-391    41-404 (411)
142 PRK05166 histidinol-phosphate   99.7 1.4E-14 3.6E-19  115.8  17.0  323   30-388    36-372 (374)
143 PRK08912 hypothetical protein;  99.7 1.1E-14 2.8E-19  116.5  16.1  331   29-389    23-386 (387)
144 PRK03158 histidinol-phosphate   99.7 1.7E-14 4.2E-19  115.3  16.9  319   32-387    29-359 (359)
145 PRK09295 selenocysteine lyase;  99.7   8E-14   2E-18  110.9  20.3  331   30-390    20-405 (406)
146 PRK08960 hypothetical protein;  99.7 2.6E-14 6.6E-19  114.0  17.7  331   29-388    29-386 (387)
147 PRK07310 consensus              99.7 2.9E-14 7.5E-19  113.7  17.7  334   29-389    27-392 (395)
148 TIGR03540 DapC_direct LL-diami  99.7 1.7E-14 4.4E-19  115.2  16.6  329   29-386    26-383 (383)
149 PRK08068 transaminase; Reviewe  99.7 1.6E-14   4E-19  115.5  16.0  328   29-386    29-386 (389)
150 PRK00950 histidinol-phosphate   99.6 2.6E-14 6.6E-19  114.0  16.9  324   27-388    30-369 (369)
151 PRK06207 aspartate aminotransf  99.6 4.7E-14 1.2E-18  112.3  18.1  341   30-390    33-404 (406)
152 PRK07777 aminotransferase; Val  99.6   2E-14   5E-19  114.8  16.1  332   29-388    21-385 (386)
153 PRK08175 aminotransferase; Val  99.6 3.3E-14 8.4E-19  113.4  17.1  334   29-389    26-389 (395)
154 PRK06220 consensus              99.6 2.9E-14 7.3E-19  113.8  16.8  332   29-390    28-381 (384)
155 TIGR03538 DapC_gpp succinyldia  99.6 4.1E-14 1.1E-18  112.7  17.4  337   26-387    23-394 (394)
156 PRK08636 aspartate aminotransf  99.6 4.2E-14 1.1E-18  112.6  17.1  339   29-391    30-402 (403)
157 pfam00266 Aminotran_5 Aminotra  99.6 5.1E-14 1.3E-18  112.1  17.5  315   34-379     2-371 (371)
158 PRK06507 consensus              99.6 3.5E-14 8.8E-19  113.2  16.3  333   29-390    28-399 (400)
159 PRK09147 aminotransferase; Pro  99.6 6.9E-14 1.7E-18  111.3  17.7  339   25-388    22-396 (397)
160 PRK09440 avtA valine--pyruvate  99.6 6.5E-14 1.7E-18  111.4  16.1  331   42-390    31-412 (416)
161 TIGR03403 nifS_epsilon cystein  99.6 7.6E-14 1.9E-18  111.0  15.8  323   34-391     2-377 (382)
162 cd00609 AAT_like Aspartate ami  99.6 6.9E-14 1.8E-18  111.3  15.6  315   50-385    13-350 (350)
163 PRK09082 putative aminotransfe  99.6 4.2E-14 1.1E-18  112.6  14.3  325   32-385    30-385 (386)
164 cd06502 TA_like Low-specificit  99.6 1.5E-14 3.8E-19  115.6  10.7  305   45-385     6-337 (338)
165 PRK06358 threonine-phosphate d  99.6 1.7E-13 4.2E-18  108.8  16.1  324   29-388    16-354 (354)
166 PRK04152 consensus              99.6 1.6E-13 4.2E-18  108.8  15.9  321   28-387    27-364 (364)
167 PRK07309 aromatic amino acid a  99.6 2.1E-13 5.4E-18  108.1  15.5  332   30-390    28-389 (390)
168 PRK08363 alanine aminotransfer  99.6 6.5E-13 1.6E-17  104.9  17.9  335   29-389    27-394 (398)
169 TIGR03539 DapC_actino succinyl  99.6 2.3E-13 5.8E-18  107.9  15.5  314   29-383    18-356 (357)
170 PRK01533 histidinol-phosphate   99.6 7.9E-13   2E-17  104.3  16.9  320   31-389    28-355 (366)
171 PRK06836 aspartate aminotransf  99.5 5.4E-13 1.4E-17  105.4  15.1  329   32-391    34-394 (396)
172 TIGR03402 FeS_nifS cysteine de  99.5 1.7E-12 4.3E-17  102.2  17.5  324   34-390     2-373 (379)
173 PRK07865 N-succinyldiaminopime  99.5 6.3E-13 1.6E-17  105.0  15.3  314   29-384    24-363 (364)
174 PRK07392 threonine-phosphate d  99.5 6.3E-13 1.6E-17  105.0  14.9  324   30-389    20-357 (358)
175 PRK10534 L-threonine aldolase;  99.5 2.3E-13 5.9E-18  107.8  12.4  310   34-389     1-333 (333)
176 cd06451 AGAT_like Alanine-glyo  99.5 1.4E-12 3.5E-17  102.8  16.2  280   79-388    37-356 (356)
177 PRK12414 putative aminotransfe  99.5 1.5E-12 3.8E-17  102.5  16.2  326   30-385    27-383 (384)
178 PRK09265 aminotransferase AlaT  99.5   2E-12 5.2E-17  101.6  16.8  337   29-390    30-402 (404)
179 COG0436 Aspartate/tyrosine/aro  99.5 4.3E-12 1.1E-16   99.5  18.3  333   32-390    28-392 (393)
180 PRK08153 histidinol-phosphate   99.5 4.5E-12 1.2E-16   99.4  17.8  317   35-390    36-367 (370)
181 PRK08056 threonine-phosphate d  99.5 1.5E-12 3.9E-17  102.4  15.3  320   30-389    18-355 (356)
182 PRK02948 cysteine desulfurase;  99.5 1.9E-12 4.9E-17  101.8  14.9  324   34-391     3-376 (381)
183 PRK09105 putative aminotransfe  99.5 4.1E-12 1.1E-16   99.6  16.4  315   29-388    45-372 (374)
184 PRK03317 histidinol-phosphate   99.5 3.6E-12 9.1E-17  100.0  15.8  319   35-389    29-365 (369)
185 COG0520 csdA Selenocysteine ly  99.5   2E-11 5.1E-16   95.2  18.3  330   31-388    22-404 (405)
186 PRK07590 L,L-diaminopimelate a  99.5 8.3E-12 2.1E-16   97.7  16.3  335   27-387    29-409 (409)
187 COG1104 NifS Cysteine sulfinat  99.5 9.2E-12 2.3E-16   97.4  16.3  324   33-390     3-378 (386)
188 PRK04870 histidinol-phosphate   99.5 1.7E-11 4.2E-16   95.7  17.0  314   31-387    25-356 (356)
189 PRK05839 hypothetical protein;  99.5 5.7E-12 1.5E-16   98.7  14.5  337   20-389    12-374 (376)
190 TIGR03542 DAPAT_plant LL-diami  99.4 1.2E-11 3.2E-16   96.5  14.8  332   30-387    31-402 (402)
191 PRK02610 histidinol-phosphate   99.4 1.1E-11 2.9E-16   96.8  14.4  326   30-390    23-369 (369)
192 PRK05387 histidinol-phosphate   99.4 6.5E-11 1.6E-15   91.8  17.5  320   29-388    21-352 (353)
193 cd06452 SepCysS Sep-tRNA:Cys-t  99.4 2.3E-11 5.9E-16   94.7  13.0  314   47-387    11-360 (361)
194 PRK13479 2-aminoethylphosphona  99.3 1.2E-11   3E-16   96.7  10.2  306   50-390    17-364 (368)
195 PRK08354 putative aminotransfe  99.3 1.6E-10   4E-15   89.3  15.5  294   32-386     8-309 (312)
196 cd01494 AAT_I Aspartate aminot  99.3 2.1E-12 5.3E-17  101.6   5.9  161   77-258     3-169 (170)
197 PRK13355 bifunctional HTH-doma  99.3   3E-10 7.5E-15   87.5  16.5  336   30-390   144-515 (518)
198 TIGR03301 PhnW-AepZ 2-aminoeth  99.3 6.7E-11 1.7E-15   91.7  13.0  302   50-387    11-355 (355)
199 TIGR01141 hisC histidinol-phos  99.3 1.6E-10   4E-15   89.3  13.8  308   44-385    38-376 (377)
200 KOG1368 consensus               99.3 3.8E-11 9.6E-16   93.4  10.5  322   32-388    21-367 (384)
201 COG2008 GLY1 Threonine aldolas  99.3 1.7E-10 4.4E-15   89.1  13.8  312   35-387     2-341 (342)
202 PRK07908 hypothetical protein;  99.3 2.5E-10 6.3E-15   88.0  14.2  309   30-388    19-345 (346)
203 COG0079 HisC Histidinol-phosph  99.3 7.5E-10 1.9E-14   84.9  16.2  318   33-390    23-355 (356)
204 TIGR03588 PseC UDP-4-keto-6-de  99.2 8.1E-11 2.1E-15   91.2   9.4  303   52-387    11-380 (380)
205 PRK06959 putative threonine-ph  99.2 6.9E-10 1.8E-14   85.1  14.1  305   30-391    22-335 (339)
206 PRK06855 aminotransferase; Val  99.2 1.7E-09 4.4E-14   82.5  15.7  335   29-389    29-429 (433)
207 KOG1358 consensus               99.2 6.9E-10 1.8E-14   85.1  13.6  335   16-390    79-466 (467)
208 PRK08247 cystathionine gamma-s  99.2 4.1E-10 1.1E-14   86.5  12.5  279   69-390    47-365 (366)
209 PRK05664 threonine-phosphate d  99.2 6.4E-10 1.6E-14   85.3  13.3  305   30-388    18-327 (330)
210 TIGR01977 am_tr_V_EF2568 cyste  99.2 1.4E-09 3.7E-14   83.0  14.4  311   49-385    12-383 (384)
211 COG1168 MalY Bifunctional PLP-  99.2   4E-09   1E-13   80.1  16.6  342   20-390    11-387 (388)
212 KOG1357 consensus               99.2 6.5E-10 1.7E-14   85.3  12.4  208  158-388   245-501 (519)
213 PRK11706 TDP-4-oxo-6-deoxy-D-g  99.2 1.7E-09 4.3E-14   82.6  14.5  305   51-387    11-374 (375)
214 PRK08249 cystathionine gamma-s  99.2 4.3E-10 1.1E-14   86.5  11.3  282   66-391    56-395 (398)
215 PRK06425 histidinol-phosphate   99.2 3.3E-10 8.3E-15   87.2  10.3  294   33-387    17-331 (332)
216 PRK05967 cystathionine beta-ly  99.2 6.2E-10 1.6E-14   85.4  11.7  280   69-390    59-389 (392)
217 PRK09028 cystathionine beta-ly  99.2 6.7E-11 1.7E-15   91.7   6.8  281   69-391    56-389 (394)
218 TIGR01326 OAH_OAS_sulfhy O-ace  99.2 2.2E-11 5.7E-16   94.9   4.2  286   61-388    44-434 (434)
219 PRK04781 histidinol-phosphate   99.2 1.9E-09 4.8E-14   82.3  13.8  295   69-388    52-360 (362)
220 PRK04311 selenocysteine syntha  99.2 1.3E-09 3.3E-14   83.3  12.8  332   33-388    82-464 (465)
221 PRK04635 histidinol-phosphate   99.2 1.8E-09 4.7E-14   82.3  13.5  284   69-386    48-344 (346)
222 COG1167 ARO8 Transcriptional r  99.2 1.8E-09 4.5E-14   82.4  13.4  338   29-391    86-457 (459)
223 PRK11658 UDP-4-amino-4-deoxy-L  99.2 7.9E-10   2E-14   84.7  11.6  302   51-389    14-379 (379)
224 PRK07503 methionine gamma-lyas  99.2 5.7E-10 1.5E-14   85.6  10.8  282   66-390    57-397 (403)
225 PRK04366 glycine dehydrogenase  99.2 1.6E-09 4.1E-14   82.7  13.0  317   43-390    74-452 (490)
226 PRK06176 cystathionine gamma-s  99.1 1.1E-09 2.9E-14   83.7  11.6  278   68-390    44-379 (379)
227 pfam01041 DegT_DnrJ_EryC1 DegT  99.1 4.5E-10 1.1E-14   86.3   9.5  300   51-384     5-363 (363)
228 TIGR01265 tyr_nico_aTase tyros  99.1 5.2E-09 1.3E-13   79.4  14.8  317   44-388    41-421 (424)
229 PRK03967 histidinol-phosphate   99.1 1.1E-08 2.7E-13   77.3  15.8  311   31-392    17-337 (337)
230 PRK06460 hypothetical protein;  99.1 1.3E-10 3.2E-15   89.9   5.9  279   70-390    41-375 (375)
231 PRK07811 cystathionine gamma-s  99.1 1.1E-09 2.8E-14   83.8  10.7  279   68-390    52-386 (386)
232 PRK06234 methionine gamma-lyas  99.1 1.6E-09   4E-14   82.8  11.1  283   66-391    56-398 (399)
233 PRK07504 O-succinylhomoserine   99.1 1.4E-09 3.6E-14   83.1  10.9  303   45-390    37-396 (397)
234 cd00616 AHBA_syn 3-amino-5-hyd  99.1 1.4E-09 3.6E-14   83.1  10.8  296   54-384     2-352 (352)
235 PRK08045 cystathionine gamma-s  99.1 1.3E-09 3.3E-14   83.3  10.5  279   69-390    47-383 (386)
236 PRK08064 cystathionine beta-ly  99.1 2.9E-10 7.3E-15   87.6   6.9  278   69-391    49-384 (390)
237 cd00614 CGS_like CGS_like: Cys  99.1 1.9E-09 4.8E-14   82.2  10.9  282   66-388    32-369 (369)
238 PRK07671 cystathionine beta-ly  99.1 1.9E-09 4.8E-14   82.2  10.7  276   67-387    43-376 (377)
239 COG0075 Serine-pyruvate aminot  99.1 2.6E-09 6.7E-14   81.3  11.1  308   50-391    17-365 (383)
240 COG2873 MET17 O-acetylhomoseri  99.1 1.4E-10 3.6E-15   89.6   4.6  312   43-389    32-425 (426)
241 PRK07810 O-succinylhomoserine   99.1 5.6E-10 1.4E-14   85.7   7.3  260   43-341    43-329 (406)
242 PRK08861 cystathionine gamma-s  99.1 2.4E-09 6.2E-14   81.5  10.6  279   68-389    47-383 (388)
243 PRK08114 cystathionine beta-ly  99.0 4.1E-09   1E-13   80.1  11.4  280   69-390    57-394 (395)
244 PRK08134 O-acetylhomoserine am  99.0 8.4E-09 2.1E-13   78.0  12.8  168   65-259    55-225 (433)
245 PRK05994 O-acetylhomoserine am  99.0 3.8E-09 9.7E-14   80.2  10.9  166   65-258    54-223 (426)
246 PRK08776 cystathionine gamma-s  99.0   7E-10 1.8E-14   85.1   7.0  235   69-342    55-317 (405)
247 pfam01212 Beta_elim_lyase Beta  99.0 4.2E-10 1.1E-14   86.5   5.8  238   48-315     9-268 (288)
248 PRK06767 methionine gamma-lyas  99.0 4.7E-09 1.2E-13   79.6  11.1  283   66-390    53-386 (386)
249 PRK08133 O-succinylhomoserine   99.0 5.8E-10 1.5E-14   85.6   6.1  280   65-388    52-390 (391)
250 PRK07050 cystathionine beta-ly  99.0 1.4E-08 3.5E-13   76.6  12.7  281   66-389    57-391 (394)
251 PRK07582 cystathionine gamma-l  99.0 6.2E-09 1.6E-13   78.9  10.8  275   68-390    47-369 (370)
252 PRK01688 histidinol-phosphate   99.0 2.1E-08 5.5E-13   75.3  13.5  286   69-385    52-352 (355)
253 PRK05968 hypothetical protein;  99.0 6.1E-09 1.5E-13   78.9  10.5  282   65-391    54-388 (389)
254 PRK00451 glycine dehydrogenase  99.0 7.8E-08   2E-12   71.7  16.0  312   43-388    75-449 (449)
255 PRK07269 cystathionine gamma-s  99.0 8.2E-09 2.1E-13   78.1  11.0  276   68-388    48-363 (364)
256 TIGR03235 DNA_S_dndA cysteine   99.0 3.8E-09 9.7E-14   80.2   9.2  289   34-355     1-319 (354)
257 PRK08248 O-acetylhomoserine am  99.0 5.5E-09 1.4E-13   79.2   9.5  167   65-258    55-224 (431)
258 PRK09331 Sep-tRNA:Cys-tRNA syn  98.9 3.3E-08 8.4E-13   74.1  12.6  319   47-390    29-381 (386)
259 pfam01053 Cys_Met_Meta_PP Cys/  98.9 3.9E-09 9.9E-14   80.2   7.8  279   66-388    44-381 (381)
260 PRK07812 O-acetylhomoserine am  98.9 5.4E-08 1.4E-12   72.7  13.6  167   65-258    60-230 (436)
261 PRK13520 L-tyrosine decarboxyl  98.9 2.5E-07 6.3E-12   68.4  16.5  318   47-389    34-375 (375)
262 PRK03262 consensus              98.9 4.8E-08 1.2E-12   73.1  12.8  286   69-385    52-352 (355)
263 PRK05613 O-acetylhomoserine am  98.9 9.8E-08 2.5E-12   71.0  13.7  167   65-258    60-230 (437)
264 PRK06084 O-acetylhomoserine am  98.9 5.1E-08 1.3E-12   72.9  11.8  164   68-258    52-218 (424)
265 KOG1549 consensus               98.9 1.1E-07 2.9E-12   70.6  13.5  326   31-390    43-419 (428)
266 PRK08574 cystathionine gamma-s  98.9 2.1E-08 5.2E-13   75.5   9.6  279   69-390    48-384 (384)
267 PRK06702 O-acetylhomoserine am  98.8 1.7E-07 4.4E-12   69.4  13.4  167   65-258    52-222 (432)
268 COG0399 WecE Predicted pyridox  98.8 1.7E-07 4.5E-12   69.4  13.1  302   51-389    15-373 (374)
269 PRK05939 hypothetical protein;  98.8 7.2E-08 1.8E-12   71.9  10.4  165   66-258    38-205 (396)
270 PRK08637 hypothetical protein;  98.8 3.5E-07   9E-12   67.4  13.5  281   93-391    73-386 (386)
271 PRK07049 methionine gamma-lyas  98.7 2.1E-08 5.4E-13   75.3   6.2  290   66-389    75-426 (427)
272 KOG0259 consensus               98.7 5.7E-06 1.5E-10   59.5  17.3  319   43-389    63-433 (447)
273 TIGR01979 sufS cysteine desulf  98.7 1.1E-06 2.9E-11   64.0  13.4  341   12-390     5-408 (409)
274 cd00617 Tnase_like Tryptophana  98.7 8.4E-07 2.1E-11   64.9  12.7  326   31-389    19-408 (431)
275 cd00613 GDC-P Glycine cleavage  98.7 8.5E-07 2.2E-11   64.9  12.6  316   39-383    23-398 (398)
276 COG3844 Kynureninase [Amino ac  98.6 1.9E-05   5E-10   56.0  18.4  336   26-392    26-405 (407)
277 PRK13237 tyrosine phenol-lyase  98.6 1.3E-06 3.2E-11   63.8  11.9  326   30-389    43-433 (459)
278 COG1003 GcvP Glycine cleavage   98.6 3.8E-06 9.6E-11   60.7  14.0  290   77-390   112-448 (496)
279 KOG0053 consensus               98.6 1.2E-06 3.1E-11   63.8  11.0  191   69-286    72-267 (409)
280 KOG2862 consensus               98.6 2.8E-06 7.1E-11   61.5  12.7  300   42-389    37-382 (385)
281 COG0626 MetC Cystathionine bet  98.6 1.8E-06 4.5E-11   62.8  11.6  279   69-390    58-395 (396)
282 PRK12566 glycine dehydrogenase  98.6 5.5E-06 1.4E-10   59.6  14.0  291   77-389   546-876 (954)
283 TIGR01325 O_suc_HS_sulf O-succ  98.5 1.7E-06 4.5E-11   62.8  11.1  249   56-340    35-309 (386)
284 PRK05367 glycine dehydrogenase  98.5 3.3E-06 8.3E-11   61.1  12.3  292   77-389   545-875 (955)
285 TIGR01264 tyr_amTase_E tyrosin  98.5 6.7E-06 1.7E-10   59.0  13.7  313   49-388    50-412 (415)
286 PRK13238 tnaA tryptophanase; P  98.5 3.5E-06   9E-11   60.8  12.1  325   30-389    43-434 (461)
287 pfam03841 SelA L-seryl-tRNA se  98.5 1.1E-06 2.9E-11   64.1   9.2  231   44-296    11-263 (367)
288 cd06450 DOPA_deC_like DOPA dec  98.5 2.1E-05 5.3E-10   55.8  15.2  272   72-386    32-345 (345)
289 PRK06434 cystathionine gamma-l  98.5 3.3E-06 8.4E-11   61.1  10.9  278   65-389    55-384 (384)
290 PRK02769 histidine decarboxyla  98.4 6.8E-06 1.7E-10   59.0  11.4  263   92-388    87-371 (380)
291 KOG0256 consensus               98.3 7.3E-05 1.9E-09   52.2  14.0  289   74-389   125-461 (471)
292 PTZ00094 serine hydroxymethylt  98.3 0.00018 4.6E-09   49.7  15.7  277   83-389    86-405 (450)
293 COG3977 Alanine-alpha-ketoisov  98.2 6.9E-05 1.8E-09   52.4  13.3  209  165-390   170-412 (417)
294 COG0403 GcvP Glycine cleavage   98.2 0.00014 3.5E-09   50.5  13.3  316   36-387    75-448 (450)
295 PRK13034 serine hydroxymethylt  98.1 0.00051 1.3E-08   46.7  15.4  280   83-390    86-396 (422)
296 COG3033 TnaA Tryptophanase [Am  98.1 0.00027   7E-09   48.5  13.8  333   30-389    44-444 (471)
297 KOG0257 consensus               98.1 2.3E-05 5.9E-10   55.5   8.2  262   41-315    30-326 (420)
298 cd00378 SHMT Serine-glycine hy  98.1 0.00072 1.8E-08   45.7  15.8  281   83-389    74-385 (402)
299 PRK00011 glyA serine hydroxyme  98.0 0.00061 1.6E-08   46.2  14.8  278   84-389    81-388 (415)
300 pfam01276 OKR_DC_1 Orn/Lys/Arg  98.0 0.00011 2.7E-09   51.2  10.3  284   64-369    55-411 (417)
301 pfam00464 SHMT Serine hydroxym  97.9  0.0011 2.8E-08   44.6  14.3  275   78-383    69-380 (380)
302 KOG2040 consensus               97.9  0.0025 6.3E-08   42.2  16.1  291   77-386   585-915 (1001)
303 PRK13580 serine hydroxymethylt  97.9  0.0025 6.4E-08   42.2  16.1  286   84-390   107-448 (493)
304 COG0076 GadB Glutamate decarbo  97.9 0.00036 9.1E-09   47.7  11.0  289   43-353    64-398 (460)
305 TIGR02080 O_succ_thio_ly O-suc  97.9  0.0003 7.8E-09   48.2  10.6  289   46-389    35-382 (383)
306 TIGR01328 met_gam_lyase methio  97.8 0.00017 4.4E-09   49.8   9.0  283   65-390    50-392 (392)
307 TIGR01140 CobD L-threonine-O-3  97.8 0.00033 8.5E-09   47.9  10.3  314   30-385     3-348 (349)
308 TIGR02326 transamin_PhnW 2-ami  97.8  0.0007 1.8E-08   45.8  11.4  282   75-389    37-365 (366)
309 TIGR02539 SepCysS Sep-tRNA:Cys  97.8 0.00075 1.9E-08   45.6  11.1  287   73-389    50-379 (381)
310 cd00615 Orn_deC_like Ornithine  97.7 0.00016   4E-09   50.1   6.7  223   69-313    53-293 (294)
311 COG1103 Archaea-specific pyrid  97.6  0.0015 3.7E-08   43.7  11.1  313   50-389    30-380 (382)
312 KOG3846 consensus               97.6  0.0069 1.8E-07   39.3  14.2  332   44-391    74-463 (465)
313 COG0112 GlyA Glycine/serine hy  97.5  0.0095 2.4E-07   38.4  16.9  313   50-390    39-391 (413)
314 PRK09257 aromatic amino acid a  97.5 0.00042 1.1E-08   47.2   7.0  325   35-388    29-397 (397)
315 TIGR03531 selenium_SpcS O-phos  97.5 0.00049 1.2E-08   46.8   6.7  196  165-387   190-444 (444)
316 TIGR02006 IscS cysteine desulf  97.2   0.019 4.8E-07   36.5  12.6  332   33-391     5-381 (404)
317 pfam05889 SLA_LP_auto_ag Solub  97.2  0.0054 1.4E-07   40.0   9.4  201  163-388   141-389 (389)
318 TIGR01437 selA_rel pyridoxal p  97.1  0.0098 2.5E-07   38.3  10.5  328   31-389     8-389 (391)
319 TIGR03576 pyridox_MJ0158 pyrid  96.9  0.0024   6E-08   42.4   5.8  243   90-366    72-323 (346)
320 TIGR01814 kynureninase kynuren  96.9  0.0079   2E-07   38.9   8.4  330   44-387    44-443 (444)
321 COG1448 TyrB Aspartate/tyrosin  96.7   0.058 1.5E-06   33.3  11.3  194  180-387   176-396 (396)
322 KOG0634 consensus               96.7   0.067 1.7E-06   32.9  12.2  202  185-389   213-466 (472)
323 pfam00282 Pyridoxal_deC Pyrido  96.5   0.002 5.2E-08   42.8   3.0  177   73-261    74-277 (370)
324 pfam02347 GDC-P Glycine cleava  96.5   0.054 1.4E-06   33.5  10.2  308   38-383    67-429 (429)
325 KOG1383 consensus               96.4   0.089 2.3E-06   32.1  10.9  339   28-392    75-449 (491)
326 KOG0633 consensus               96.4   0.092 2.3E-06   32.0  11.1  275   78-386    73-374 (375)
327 COG1921 SelA Selenocysteine sy  96.2   0.026 6.6E-07   35.6   7.2  246   33-303    21-281 (395)
328 PRK13578 ornithine decarboxyla  96.1    0.14 3.5E-06   30.8  12.3   45  341-385   517-561 (720)
329 TIGR02617 tnaA_trp_ase tryptop  95.9   0.017 4.4E-07   36.7   5.1  346   18-391    28-444 (468)
330 TIGR01976 am_tr_V_VC1184 cyste  95.9    0.17 4.4E-06   30.2  14.7  314   33-383    23-410 (410)
331 KOG2467 consensus               94.9    0.13 3.2E-06   31.1   6.7  184  193-388   199-425 (477)
332 PRK12566 glycine dehydrogenase  93.3    0.74 1.9E-05   26.0  13.6  298   42-384    85-439 (954)
333 TIGR00461 gcvP glycine dehydro  93.0    0.81 2.1E-05   25.8  14.8  286   77-386   554-888 (965)
334 PRK05367 glycine dehydrogenase  92.2       1 2.6E-05   25.1  13.9  265   81-386   132-443 (955)
335 pfam04864 Alliinase_C Allinase  91.8     1.2 2.9E-05   24.8   8.3  187  181-386   139-362 (363)
336 KOG0629 consensus               91.2     1.3 3.4E-05   24.4   8.0  267   91-388   161-508 (510)
337 KOG0258 consensus               91.0    0.53 1.4E-05   27.0   5.0  198  165-369   199-456 (475)
338 TIGR00474 selA L-seryl-tRNA se  89.9     1.7 4.4E-05   23.6   8.3  273   23-319    48-355 (448)
339 COG1453 Predicted oxidoreducta  86.0    0.93 2.4E-05   25.4   3.5  200   30-267    46-263 (391)
340 COG1982 LdcC Arginine/lysine/o  81.0     4.7 0.00012   20.8  12.0  279   76-384    72-403 (557)
341 PRK13475 ribulose bisphosphate  80.1     1.7 4.4E-05   23.7   2.9   91  225-316   349-441 (459)
342 TIGR00693 thiE thiamine-phosph  80.1    0.53 1.4E-05   27.0   0.3  120  195-318    51-186 (210)
343 KOG2433 consensus               78.1     3.3 8.3E-05   21.8   3.8   16  362-378   530-545 (577)
344 cd03318 MLE Muconate Lactonizi  77.7    0.39 9.9E-06   27.9  -1.0   90  193-289   222-312 (365)
345 cd02691 PurM-like2 AIR synthas  77.5       6 0.00015   20.1   5.0   67  189-255    98-181 (346)
346 KOG4166 consensus               75.3       1 2.7E-05   25.1   0.6   66  192-261   471-542 (675)
347 TIGR02360 pbenz_hydroxyl 4-hyd  73.2       5 0.00013   20.6   3.7  102   22-143    73-176 (393)
348 cd02197 HypE HypE (Hydrogenase  72.7     1.8 4.6E-05   23.5   1.3   76  174-249    67-164 (293)
349 pfam06838 Alum_res Aluminium r  72.4     8.1 0.00021   19.2   8.7  200   48-266    25-246 (405)
350 TIGR01329 cysta_beta_ly_E cyst  70.3     5.3 0.00014   20.4   3.3  288   70-389    45-412 (415)
351 TIGR02534 mucon_cyclo muconate  70.1     1.6   4E-05   23.9   0.6   96  179-287   204-310 (369)
352 TIGR02151 IPP_isom_2 isopenten  66.6     2.5 6.4E-05   22.6   1.0   75  183-258   162-261 (349)
353 TIGR02618 tyr_phenol_ly tyrosi  65.3     3.9 9.9E-05   21.3   1.8  218  166-389   159-426 (450)
354 KOG3843 consensus               63.7     5.2 0.00013   20.5   2.2  222  147-390   121-403 (432)
355 PRK02615 thiamine-phosphate py  63.5     2.2 5.6E-05   23.0   0.2   35  198-232   187-224 (345)
356 CHL00040 rbcL ribulose-1,5-bis  63.3     5.4 0.00014   20.4   2.2   85  226-316   361-463 (477)
357 pfam07505 Gp37_Gp68 Phage prot  63.1      12 0.00032   18.0   5.6   45  190-249   197-241 (253)
358 pfam02606 LpxK Tetraacyldisacc  62.9      13 0.00032   18.0   4.6  119   94-256    43-168 (318)
359 TIGR01324 cysta_beta_ly_B cyst  59.6      14 0.00036   17.6   4.0  177   61-267    44-228 (389)
360 PRK05437 isopentenyl pyrophosp  55.0     4.7 0.00012   20.8   0.7   40  183-224   161-200 (351)
361 TIGR01136 cysKM cysteine synth  54.7      17 0.00044   17.1   4.8   80   30-126    61-142 (315)
362 PRK07105 pyridoxamine kinase;   53.4     9.6 0.00024   18.8   2.1   36  178-213   105-142 (284)
363 PRK00507 deoxyribose-phosphate  53.3      18 0.00046   17.0   3.8  205   32-292     7-217 (221)
364 cd03322 rpsA The starvation se  52.7     2.3 5.9E-05   22.8  -1.2   89  194-288   198-287 (361)
365 COG2861 Uncharacterized protei  52.5      19 0.00047   16.9   3.5   74  277-358   161-240 (250)
366 PRK04208 rbcL ribulose bisopho  51.8      15 0.00038   17.5   2.9   86  226-317   353-456 (467)
367 cd03085 PGM1 Phosphoglucomutas  49.9      20  0.0005   16.7   3.2   25  201-231   329-353 (548)
368 cd01522 RHOD_1 Member of the R  48.6      21 0.00053   16.6   3.2   50   79-136    53-104 (117)
369 TIGR01458 HAD-SF-IIA-hyp3 HAD-  47.9      12 0.00031   18.1   1.9   50  193-242   180-245 (258)
370 PRK03080 phosphoserine aminotr  47.1      22 0.00057   16.3  10.9  187  182-391   145-378 (381)
371 cd00308 enolase_like Enolase-s  46.8     2.9 7.5E-05   22.1  -1.4   67  169-244   113-180 (229)
372 pfam04298 Zn_peptidase_2 Putat  46.7     9.1 0.00023   18.9   1.1   69   74-155    37-111 (222)
373 PRK00313 lpxK tetraacyldisacch  46.3      14 0.00036   17.7   2.0  119   94-256    59-185 (332)
374 TIGR01394 TypA_BipA GTP-bindin  45.7      24  0.0006   16.2   5.7  121  234-380   459-582 (609)
375 cd01020 TroA_b Metal binding p  45.6      21 0.00053   16.5   2.8   27  193-219   189-215 (264)
376 PRK05409 hypothetical protein;  45.3     7.5 0.00019   19.5   0.5   32  187-218    67-98  (283)
377 PRK03512 thiamine-phosphate py  44.7     7.2 0.00018   19.6   0.3   47  165-217    21-70  (211)
378 pfam05114 DUF692 Protein of un  44.1     8.4 0.00021   19.1   0.6   33  186-218    63-95  (275)
379 TIGR02423 protocat_alph protoc  43.5      12 0.00031   18.1   1.4   64  177-250    56-139 (203)
380 pfam05690 ThiG Thiazole biosyn  43.0      12  0.0003   18.2   1.2  152   47-224    17-185 (246)
381 TIGR00551 nadB L-aspartate oxi  42.8      14 0.00035   17.8   1.5   16   44-59     70-85  (546)
382 PRK06512 thiamine-phosphate py  42.7     7.9  0.0002   19.3   0.3   51  166-219    29-81  (221)
383 cd02811 IDI-2_FMN Isopentenyl-  41.8      12  0.0003   18.2   1.0   39  183-223   153-191 (326)
384 PRK09490 metH B12-dependent me  41.6      27 0.00069   15.8   4.0   27  196-225   468-497 (1229)
385 TIGR02902 spore_lonB ATP-depen  41.4      14 0.00036   17.7   1.4   52  161-218   122-184 (532)
386 cd03315 MLE_like Muconate lact  40.9     4.2 0.00011   21.1  -1.3   57  179-244   158-215 (265)
387 TIGR03266 methan_mark_1 putati  40.5      26 0.00067   15.9   2.7   12  342-353   326-337 (376)
388 cd06061 PurM-like1 AIR synthas  39.8      12  0.0003   18.2   0.8   45  174-218    68-119 (298)
389 PRK08176 pdxK pyridoxal kinase  39.7      14 0.00035   17.8   1.1   36  178-213   120-157 (281)
390 TIGR02318 phosphono_phnM phosp  39.5      16 0.00041   17.3   1.5  229   32-295    41-312 (391)
391 TIGR02082 metH methionine synt  39.3      30 0.00075   15.6   6.2   30   31-60     28-59  (1265)
392 cd00611 PSAT_like Phosphoserin  39.0      30 0.00076   15.5  10.8  169  205-385   158-352 (355)
393 pfam09940 DUF2172 Domain of un  38.6      14 0.00036   17.7   1.0   37   14-52     17-53  (384)
394 PRK07564 phosphoglucomutase; V  38.5      27  0.0007   15.8   2.5   24  201-230   353-376 (544)
395 pfam00883 Peptidase_M17 Cytoso  38.5      16 0.00042   17.2   1.4   12  206-217   167-178 (312)
396 PRK13805 bifunctional acetalde  38.3      12  0.0003   18.2   0.6   51  162-219   469-520 (862)
397 cd03321 mandelate_racemase Man  38.2     9.5 0.00024   18.8   0.1   63  194-257   221-284 (355)
398 CHL00162 thiG thiamin biosynth  37.9      31 0.00079   15.4   3.2  159   47-224    25-200 (267)
399 PRK00125 pyrF orotidine 5'-pho  37.8      31 0.00079   15.4   5.3  133  199-331    74-220 (277)
400 pfam06970 RepA_N Replication i  37.1      26 0.00067   15.9   2.2   33   27-59     43-75  (76)
401 PRK06264 cbiC precorrin-8X met  36.5      19 0.00048   16.8   1.4   56  234-296   150-209 (210)
402 COG0352 ThiE Thiamine monophos  35.1      13 0.00034   17.9   0.4   51  166-220    24-76  (211)
403 cd02195 SelD Selenophosphate s  34.7      12  0.0003   18.2   0.1   74  175-250    82-177 (287)
404 cd03327 MR_like_2 Mandelate ra  34.3      10 0.00026   18.5  -0.2   51  194-244   206-257 (341)
405 KOG1528 consensus               33.9      36 0.00092   15.0   3.2   21  372-392   331-351 (351)
406 KOG0628 consensus               33.6      36 0.00092   15.0  11.5  216  166-391   219-473 (511)
407 TIGR03247 glucar-dehydr glucar  33.3      37 0.00093   15.0   6.5   37  200-236   269-305 (441)
408 KOG1270 consensus               32.3      14 0.00036   17.7   0.2   46  193-238   172-218 (282)
409 cd03316 MR_like Mandelate race  32.1      14 0.00037   17.6   0.2   51  194-244   224-275 (357)
410 KOG0791 consensus               31.9      22 0.00056   16.4   1.2   11  194-204   177-187 (374)
411 COG2156 KdpC K+-transporting A  31.7      39 0.00099   14.8   4.0   20   42-61     85-104 (190)
412 pfam06418 CTP_synth_N CTP synt  31.6      39   0.001   14.8   3.2   61  180-242   136-208 (275)
413 cd07560 Peptidase_S41_CPP C-te  31.4      39   0.001   14.8   6.7  143   71-242    58-210 (211)
414 cd01528 RHOD_2 Member of the R  31.3      35  0.0009   15.1   2.1   37   91-135    61-97  (101)
415 TIGR00224 pckA phosphoenolpyru  30.8      40   0.001   14.7   2.4   56   67-130    18-75  (549)
416 cd00983 recA RecA is a  bacter  29.5      42  0.0011   14.6   3.3   18  198-215   170-187 (325)
417 KOG1412 consensus               28.9      43  0.0011   14.5   6.3  189  189-390   191-406 (410)
418 PRK09517 multifunctional thiam  28.5      19 0.00047   16.9   0.3   36  176-211   326-362 (738)
419 PRK11524 putative methyltransf  28.4      32 0.00082   15.3   1.5   12  303-314   252-263 (284)
420 COG0062 Uncharacterized conser  28.3      44  0.0011   14.4   2.7   65  177-245   119-185 (203)
421 PRK00913 leucyl aminopeptidase  27.8      45  0.0012   14.4   3.2   62  190-251   185-266 (491)
422 COG1850 RbcL Ribulose 1,5-bisp  27.4      46  0.0012   14.3   3.0   18  233-250   341-358 (429)
423 PRK08286 cbiC precorrin-8X met  27.2      27 0.00068   15.9   0.9   53  235-294   156-212 (213)
424 PHA01747 putative ATP-dependen  27.1      21 0.00053   16.5   0.4   89  192-300   219-316 (425)
425 TIGR01812 sdhA_frdA_Gneg succi  27.1      47  0.0012   14.3   2.9   29  211-246   412-444 (636)
426 pfam02603 Hpr_kinase_N HPr Ser  27.0      27  0.0007   15.8   1.0   42  166-217    71-112 (127)
427 TIGR00476 selD selenide, water  26.8      40   0.001   14.7   1.8  126  193-333   128-269 (372)
428 PRK13699 putative methylase; P  26.8      39 0.00099   14.8   1.7   10  374-383   196-205 (227)
429 PRK00943 selenophosphate synth  26.5      24 0.00062   16.1   0.6   75  175-251    90-184 (347)
430 cd03325 D-galactonate_dehydrat  26.4      18 0.00045   17.0  -0.1   52  193-244   210-262 (352)
431 pfam00586 AIRS AIR synthase re  26.2      20 0.00052   16.6   0.2   41  174-214    44-91  (95)
432 PTZ00276 biotin/lipoate protei  26.1      48  0.0012   14.2   2.2   10  101-110    18-27  (245)
433 pfam02110 HK Hydroxyethylthiaz  26.0      49  0.0012   14.1   4.8   20  196-215   138-157 (246)
434 pfam00016 RuBisCO_large Ribulo  25.6      49  0.0013   14.1   3.0   62  225-292   207-270 (309)
435 PTZ00225 60S ribosomal protein  25.6     8.8 0.00022   19.0  -1.8   92  200-312    95-191 (214)
436 TIGR00614 recQ_fam ATP-depende  25.0      51  0.0013   14.0   3.3  134  194-355   117-268 (497)
437 cd03319 L-Ala-DL-Glu_epimerase  24.8      16  0.0004   17.4  -0.7   29  194-222   212-240 (316)
438 PRK05355 phosphoserine aminotr  24.7      51  0.0013   14.0   7.6  166  209-386   165-355 (360)
439 cd03317 NAAAR N-acylamino acid  24.6      23  0.0006   16.2   0.2   49  195-243   213-262 (354)
440 TIGR00095 TIGR00095 putative m  24.3      52  0.0013   13.9   3.4   79  297-391    83-164 (210)
441 cd00245 Glm_e Coenzyme B12-dep  24.0      34 0.00087   15.2   1.0  121  190-318   211-337 (428)
442 cd04728 ThiG Thiazole synthase  23.6      54  0.0014   13.9   2.2  150   47-224    18-186 (248)
443 TIGR02089 TTC tartrate dehydro  23.5      19 0.00048   16.9  -0.4   40  271-317   283-329 (355)
444 cd04915 ACT_AK-Ectoine_2 ACT d  23.3      55  0.0014   13.8   3.0   48  342-389    19-66  (66)
445 PRK04205 hypothetical protein;  23.3      24 0.00062   16.1   0.1   28  196-237   161-188 (222)
446 COG5599 PTP2 Protein tyrosine   23.1      25 0.00064   16.0   0.2   11  219-229   226-236 (302)
447 TIGR01455 glmM phosphoglucosam  23.0      55  0.0014   13.8   6.2   97  281-388   345-449 (450)
448 KOG0453 consensus               22.8      51  0.0013   14.0   1.7   15  131-145   263-277 (778)
449 cd01521 RHOD_PspE2 Member of t  22.3      57  0.0015   13.7   2.2   51   76-135    50-104 (110)
450 TIGR02336 TIGR02336 conserved   22.2      57  0.0015   13.7   2.5  105  154-262   486-626 (767)
451 cd01125 repA Hexameric Replica  22.0      58  0.0015   13.7   1.9   52  164-215    98-154 (239)
452 COG0414 PanC Panthothenate syn  21.8      59  0.0015   13.6   2.4   30  217-246   116-151 (285)
453 cd02812 PcrB_like PcrB_like pr  21.7      59  0.0015   13.6   4.4   33   77-112    15-51  (219)
454 TIGR01369 CPSaseII_lrg carbamo  21.6      59  0.0015   13.6   2.2   20  201-220   524-543 (1089)
455 KOG3040 consensus               21.4      41   0.001   14.6   1.0   38   48-86     23-63  (262)
456 pfam03853 YjeF_N YjeF-related   21.3      60  0.0015   13.6   2.7   63  178-244   101-165 (170)
457 COG5011 Uncharacterized protei  21.3      60  0.0015   13.6   1.8   42   91-134     4-45  (228)
458 COG1105 FruK Fructose-1-phosph  21.0      38 0.00096   14.9   0.7   24  194-217   143-166 (310)
459 pfam06153 DUF970 Protein of un  20.9      61  0.0015   13.5   6.9   56  331-389     3-66  (109)
460 PRK09279 pyruvate phosphate di  20.9      61  0.0016   13.5   3.4   30  361-390   700-729 (875)
461 TIGR02085 meth_trns_rumB 23S r  20.8      33 0.00084   15.3   0.4   46  196-244   223-271 (386)
462 COG1932 SerC Phosphoserine ami  20.8      61  0.0016   13.5  15.1  167  211-390   171-364 (365)
463 pfam02669 KdpC K+-transporting  20.7      61  0.0016   13.5   3.6   19   43-61     84-102 (188)
464 PRK05935 biotin--protein ligas  20.5      62  0.0016   13.5   2.2   39  195-233    14-53  (190)
465 COG2265 TrmA SAM-dependent met  20.4      62  0.0016   13.4   4.4   12  279-290   325-336 (432)
466 KOG2470 consensus               20.4      62  0.0016   13.5   1.7   14   48-61     82-95  (510)
467 PRK09939 putative oxidoreducta  20.1      63  0.0016   13.4   2.6   32   27-62    204-235 (759)

No 1  
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases; InterPro: IPR004636   This family of proteins, for which ornithine aminotransferases form an outgroup, consists mostly of proteins designated acetylornithine aminotransferase. However, the two very closely related members from Escherichia coli are assigned different enzymatic activities. One is acetylornithine aminotransferase (2.6.1.11 from EC), ArgD, an enzyme of arginine biosynthesis, while another is succinylornithine aminotransferase, an enzyme of the arginine succinyltransferase pathway, an ammonia-generating pathway of arginine catabolism . Members of this family may also act on ornithine, like ornithine aminotransferase (2.6.1.13 from EC)  and on succinyldiaminopimelate, like N-succinyldiaminopmelate-aminotransferase (2.6.1.17 from EC, DapC, an enzyme of lysine biosynthesis) . ; GO: 0008483 transaminase activity, 0006525 arginine metabolic process.
Probab=100.00  E-value=0  Score=920.93  Aligned_cols=382  Identities=48%  Similarity=0.794  Sum_probs=374.3

Q ss_pred             EECCCCCCCC-EEEEEECCCEEEE-CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             4515588887-4898501037996-7997646410226743578789999999999997314506875781899999865
Q gi|254780432|r    6 FLFNTYDQSD-IRFEKGKGAWLFS-ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHL   83 (392)
Q Consensus         6 ~~~~~~~~~p-~~i~~a~G~~i~d-~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L   83 (392)
                      |++++|+|.| +.|+||+|+|||| .|||+||||++|+++++|||+||++++|+++|+++|+|++++|.+++..+||++|
T Consensus         1 ~~~~~Y~R~~d~~i~rG~G~~v~Dd~~GK~YlDf~aGIAV~~LGH~hP~l~Ea~~~Q~~kL~H~SNlY~~~~~~~LA~kL   80 (402)
T TIGR00707         1 YLMQTYGRLPDIVIVRGKGAYVYDDVNGKEYLDFVAGIAVNALGHAHPKLVEALKEQLEKLVHVSNLYYTEPQEELAEKL   80 (402)
T ss_pred             CCCCCCCCCCCEEEECCCCCEEEECCCCCEEEEECCCHHHHCCCCCCHHHHHHHHHHHHHHEEECCCCCCCHHHHHHHHH
T ss_conf             90057688765016316640898767894652010022440113578899999998662406607765580899999999


Q ss_pred             HHHCCCC-------CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2010133-------312356555403567776654320013478600234354656543212345532113479998643
Q gi|254780432|r   84 IHSTFAD-------RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIE  156 (392)
Q Consensus        84 ~~~~~~~-------~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~  156 (392)
                      ++.++.|       ||||||||+||||+|+|+||+|+..+ ...|++||||.+||||||++++|+|++|+|+++|+|+++
T Consensus        81 v~~~~~dgGqhd~~rvFFCNSGaEAnEAAlKlARk~~~~~-g~~k~~ivaf~naFHGRT~g~LsaTgqpKy~~~F~PLvp  159 (402)
T TIGR00707        81 VEHSGADGGQHDASRVFFCNSGAEANEAALKLARKYTGDK-GKEKKKIVAFENAFHGRTMGALSATGQPKYQKPFEPLVP  159 (402)
T ss_pred             HHHHHCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHCC-CCCCCEEEEEEECCCCCHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             9997046883023266751474789999999989864022-788653888870776300454300477645685788423


Q ss_pred             CCCCCCCHH-HHHHHHHCCCC-----CCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             332221002-68875410123-----322223332222112462101232211022345721310110034444555310
Q gi|254780432|r  157 GFDQAKFCD-LQSLKNQISND-----TAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA  230 (392)
Q Consensus       157 ~~~~~~~~d-~~~l~~~~~~~-----iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~  230 (392)
                      +|.+++||| ++++++.+.++     +||||+||||||||++|++.+||++||++|+++|+|||+||||||+||||+|||
T Consensus       160 gf~y~~yNDe~~~l~~~i~~~~eg~rtAAvivEpiQGEgGV~pa~~~fL~a~r~lc~~~~~LLI~DEVQtG~GRTG~~fA  239 (402)
T TIGR00707       160 GFKYVPYNDEIEALKEAIDDEKEGDRTAAVIVEPIQGEGGVVPADKEFLKALRELCEDKDALLIFDEVQTGLGRTGKLFA  239 (402)
T ss_pred             CCEEECCCCCHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCEEEEEEEEEECCCCCHHHHH
T ss_conf             81244488978999998502577871889998532178653348778999999998648918999447528774332233


Q ss_pred             CCCCC--CCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHH
Q ss_conf             11124--5453021034444443443210001112222233223453211110012334554320122210112100002
Q gi|254780432|r  231 YEWAN--VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKIL  308 (392)
Q Consensus       231 ~e~~g--i~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l  308 (392)
                      +||||  |+|||+|++|+||||+|+||+++++++.+.+.++.|||||+||||+|+||++||++|+++.++++++++|++|
T Consensus       240 ~~Hygse~~PDi~T~AKgLGgG~PiGA~~~~e~~a~~~~~G~HGsTFGGNPLAc~Aa~~vl~~i~~~~~l~~v~~~G~~f  319 (402)
T TIGR00707       240 YEHYGSEVEPDIITLAKGLGGGVPIGAVLAKEEVAEALTPGDHGSTFGGNPLACAAALAVLEVIEKERLLEKVKEKGDYF  319 (402)
T ss_pred             HHCCCCCCCCHHHHHHHHHHCCCHHHHHEEHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             12068845523875405552782022320236787315898986667873899999877666550510478999988999


Q ss_pred             HHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH---HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             688999988679707550464009998724998---99999999689899626898899558986889999999999999
Q gi|254780432|r  309 FEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP---ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIER  385 (392)
Q Consensus       309 ~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~---~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~  385 (392)
                      +++|+++..++.+.|++|||+|||+|+|+..++   ..+.+.++++|+|+.++++++|||.|||+|++++|++++++|++
T Consensus       320 ~~~L~~~~~~~~~l~k~VRG~GLmlG~e~~~~~~~a~~~~~~a~~~GlLv~~Ag~~v~Rf~PPL~i~~e~i~~~~~~l~~  399 (402)
T TIGR00707       320 KERLEELIKKYIDLIKEVRGKGLMLGIELEAPSVAAKDIVKEAREKGLLVNTAGPKVLRFVPPLIITEEEIDEAVDALEE  399 (402)
T ss_pred             HHHHHHHCCCCCCCEEEEECCEEEEEEEECCCCCCHHHHHHHHHHCCCEEECCCCCEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             99999861776674015323123465564278655899999998489268817887066157864458899999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780432|r  386 TAI  388 (392)
Q Consensus       386 al~  388 (392)
                      +|.
T Consensus       400 ~~~  402 (402)
T TIGR00707       400 AIE  402 (402)
T ss_pred             HHC
T ss_conf             829


No 2  
>TIGR01885 Orn_aminotrans ornithine--oxo-acid transaminase; InterPro: IPR010164   Ornithine aminotransferase catalyses the conversion of L-ornithine and a 2-oxo acid to L-glutamate 5-semialdehyde and an L-amino acid. This enzyme is found in low-GC bacteria, where it is responsible for the fourth step in arginine biosynthesis, and in the mitochondrial matrix of eukaryotes, where it controls L-ornithine levels in tissues. In human hereditary ornithine aminotransferase deficiency, the elevated levels of intraocular concentrations of ornithine are responsible for gyrate atrophy, which affects the CNS and peripheral nervous system ; GO: 0008483 transaminase activity, 0030170 pyridoxal phosphate binding.
Probab=100.00  E-value=0  Score=862.14  Aligned_cols=386  Identities=35%  Similarity=0.643  Sum_probs=371.7

Q ss_pred             CCCCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             84314515588887489850103799679976464102267435787899999999999973145068757818999998
Q gi|254780432|r    2 NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFAN   81 (392)
Q Consensus         2 ~~~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~   81 (392)
                      +|++|-+|+|+|.||+|.||+|.||||.+|++|+||.|+|+++|.|||||.|++|+++|+++++.++..|+++....++|
T Consensus        12 ~~~~YgAhnYhPLPV~~~~g~G~~v~D~eG~~Y~D~LSaYSavNqGHchP~i~~Al~~Q~~KlTL~Sraf~nd~lg~~~~   91 (426)
T TIGR01885        12 RESKYGAHNYHPLPVVLQRGKGAYVWDPEGREYLDFLSAYSAVNQGHCHPKIVNALKNQADKLTLTSRAFHNDVLGEFAK   91 (426)
T ss_pred             HCCCCCCCCCCCHHHHHHHCCCCEEEECCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHCCHHHHHHH
T ss_conf             10234677888247887506830898148888641002554401376771689999999851371027660603578999


Q ss_pred             HHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC
Q ss_conf             6520101--3331235655540356777665432001347--86002343546565432123455321-13479998643
Q gi|254780432|r   82 HLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKT--NKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFGPKIE  156 (392)
Q Consensus        82 ~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t--~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~p~~~  156 (392)
                      .+.+.++  +++|+++|||+||+|+|+|+||+|.+..+.-  ++-+||.-.|+|||||++|+|+|.+. .++++|+|++|
T Consensus        92 ~~t~LfgGk~~~vL~mNTGaEAvEtA~KLAR~WgY~~K~ip~~kA~ii~~~GNFhGRTlgA~S~Std~e~~k~~FGPflP  171 (426)
T TIGR01885        92 YLTKLFGGKYEKVLPMNTGAEAVETALKLARKWGYEVKGIPRNKAKIIAASGNFHGRTLGAVSASTDSETSKKGFGPFLP  171 (426)
T ss_pred             HHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHCCCCHHHHCCCCCCCC
T ss_conf             99975499510560456873479999999997441357855762389985388733035443202672120067879677


Q ss_pred             ------CCCCCCCHHHHHHHHHC------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCC
Q ss_conf             ------33222100268875410------123322223332222112462101232211022345721310110034444
Q gi|254780432|r  157 ------GFDQAKFCDLQSLKNQI------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGR  224 (392)
Q Consensus       157 ------~~~~~~~~d~~~l~~~~------~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GR  224 (392)
                            +|.++||+|+|+|++.+      .|+|||||+||||||+|++.||++||.++|+||+|||+|||+||||||+||
T Consensus       172 nvasGhgf~~iPYgd~EAl~~aL~~P~~~GDnVAA~i~EPIQGEAGvvvPp~gYl~~V~~LC~~~nVLfI~DEiQTGlGR  251 (426)
T TIGR01885       172 NVASGHGFRKIPYGDLEALRKALQDPKKTGDNVAAFILEPIQGEAGVVVPPPGYLPGVRALCKEHNVLFIADEIQTGLGR  251 (426)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCEEECCCCHHHHHHHHHHHCCCEEEEEEECCCCCH
T ss_conf             43357852115588878999997275778886899995040354436848963578999986551872898200038402


Q ss_pred             CCCCCCCCCCC--CCCCEEECCCCCCCC-CCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             55531011124--545302103444444-3443210001112222233--223453211110012334554320122210
Q gi|254780432|r  225 TGKLFAYEWAN--VKPDIMTIAKGMGGG-FPIGACLATNEVAACMNQG--SHGSTYGGNVLAMVLGEKVLNIIQSDGFLE  299 (392)
Q Consensus       225 tG~~f~~e~~g--i~PDi~~~gK~l~gG-~P~sav~~~~~i~~~~~~~--~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~  299 (392)
                      ||+|||++|++  |+|||++|||+|+|| ||+|||+.++|||.++.|+  +|||||+||||+||+|.|+|++|++++|.+
T Consensus       252 TGk~la~dh~~aev~PDi~lLGKALsGGv~PiSa~la~~dim~vl~PGPF~HGSTfGGNPLAcavaiAaLeVL~~ekL~~  331 (426)
T TIGR01885       252 TGKLLACDHENAEVKPDIVLLGKALSGGVYPISAVLADDDIMSVLKPGPFEHGSTFGGNPLACAVAIAALEVLEEEKLAE  331 (426)
T ss_pred             HHHHHHHHCCCCEECCCCEEEEHHHCCCCCCEEEEEECCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHH
T ss_conf             54533101058820450335112345894622436664640121176486567768875789999999999874045068


Q ss_pred             HHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC------HHHHHHHHHHCCEEEEEC-CCCEEEECCCCCCC
Q ss_conf             11210000268899998867970755046400999872499------899999999689899626-89889955898688
Q gi|254780432|r  300 NVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS------PALLAAKFRDECLLTAPS-SDNVVRILPPLTIT  372 (392)
Q Consensus       300 ~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~------~~~~~~~l~~~Gll~~~~-~~~~irl~Ppl~it  372 (392)
                      |+.++|..|+++|++|..+.+++|.+|||+||+++||+..+      ...++.+|+++||++.++ ++.+|||+|||+||
T Consensus       332 ~A~~lG~~f~~~L~~l~~~S~dvv~EVRGkGLL~AIe~~~~ka~~~~~w~~Cl~~k~~GLlak~~nhd~~IR~aPPL~i~  411 (426)
T TIGR01885       332 RADQLGDMFLDELKQLARESPDVVKEVRGKGLLIAIEFKENKADEIGAWDVCLRLKENGLLAKPTNHDKIIRLAPPLVIT  411 (426)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEHHCCCCCEEEEEEECCCCCCCCHHHHHHHHHCCCCEECCCCCCCEEEECCCCCCC
T ss_conf             89883289999999887507640001156721688885065333264668878852074210133587068717885263


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999999
Q gi|254780432|r  373 AEEIHEGLERIERTA  387 (392)
Q Consensus       373 ~~eid~~i~~l~~al  387 (392)
                      +||++..++++.+++
T Consensus       412 ~E~L~~~ie~i~K~~  426 (426)
T TIGR01885       412 KEQLDEVIEIIRKTL  426 (426)
T ss_pred             HHHHHHHHHHHHHCC
T ss_conf             899999999986049


No 3  
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism]
Probab=100.00  E-value=0  Score=842.97  Aligned_cols=385  Identities=50%  Similarity=0.852  Sum_probs=374.7

Q ss_pred             CCCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             43145155888874898501037996799764641022674357878999999999999731450687578189999986
Q gi|254780432|r    3 KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANH   82 (392)
Q Consensus         3 ~~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~   82 (392)
                      +++|++++|.+.|++++||+|+|+||.+||+||||.+|+++++|||+||+|++|+++|+++++|+++.|.++.+.+|+++
T Consensus        13 ~~~~~~~~Y~~~~~~~~~G~G~~v~D~~G~~YlDf~~Giav~~lGH~hP~iv~al~~Q~~kl~h~sn~~~~~~~~~la~~   92 (404)
T COG4992          13 FMKYLMPTYGRLPVVIVRGEGAYVWDQQGREYLDFAAGIAVNNLGHCHPALVEALKEQAEKLWHVSNLFYNEPQAELAEK   92 (404)
T ss_pred             HHHHHHCCCCCCCEEEEECCCCEEECCCCCEEEEECCCEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             88765200576862478546257987998876660355111025778989999999999776211313378699999999


Q ss_pred             HHHHCC-CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             520101-3331235655540356777665432001347860023435465654321234553211347999864333222
Q gi|254780432|r   83 LIHSTF-ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQA  161 (392)
Q Consensus        83 L~~~~~-~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~  161 (392)
                      |++.++ +|||||+|||+||||+|+|+||+|..   .++|.+||+|++||||||++++|+|++++|+++|.|++++|.++
T Consensus        93 L~~~s~~~d~vff~NSGaEA~EaAiKlARk~~~---~~~k~~Iia~~nsFHGRT~galS~t~~~ky~~~F~Pl~~g~~~v  169 (404)
T COG4992          93 LVELSPFADRVFFCNSGAEANEAALKLARKYTG---DPEKSKIIAFENSFHGRTLGALSATGQPKYRKGFGPLLPGFRHV  169 (404)
T ss_pred             HHHHCCCCCEEEECCCCHHHHHHHHHHHHHHCC---CCCCCEEEEECCCCCCCCCEEEECCCCHHHCCCCCCCCCCCEEC
T ss_conf             996286666899757838999999999999708---88875799974775776623366568842226788999995361


Q ss_pred             CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             10026887541012332222333222211246210123221102234572131011003444455531011124545302
Q gi|254780432|r  162 KFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM  241 (392)
Q Consensus       162 ~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~  241 (392)
                      ||||++++++.+.+++||||+|||||+||+++||++||+++|++|++||+|||+||||||+||||+|||+||+||+|||+
T Consensus       170 pfnDi~al~~ai~~~taAvivEPIQGEgGV~~~~~~fl~~lr~lCd~~g~LLI~DEVQtG~GRTGk~fA~e~~gV~PDI~  249 (404)
T COG4992         170 PFNDIEALEAAIDEDTAAVIVEPIQGEGGVIPAPPEFLKALRELCDEHGALLILDEVQTGLGRTGKLFAYEHYGVEPDIL  249 (404)
T ss_pred             CCCCHHHHHHHHCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCEEEEEECCCCCCCCCCHHHHHHHHCCCCCEE
T ss_conf             78998999987365758999826668889877998999999999987192999964313888663178989748887778


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCC
Q ss_conf             10344444434432100011122222332234532111100123345543201222101121000026889999886797
Q gi|254780432|r  242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPN  321 (392)
Q Consensus       242 ~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~  321 (392)
                      |++|+||||+|+||+++++++++.+.++.|+|||+|||++||++.++|+++.++++++|++++|++|+++|+++..+|| 
T Consensus       250 tlaK~LgGG~PigA~la~~~~~~~~~~G~HgSTfGGNpLacAv~~a~l~~l~~e~ll~~v~~~g~~~~~~L~~l~~~~~-  328 (404)
T COG4992         250 TLAKALGGGFPIGAMLATEEIASAFTPGDHGSTFGGNPLACAVALAVLEVLLEEGLLENVREKGEYLLQRLRELKRRYP-  328 (404)
T ss_pred             EEECCCCCCCCCEEEEECHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-
T ss_conf             8601245883323557742666247887656777867999999999999980030899999999999999999751277-


Q ss_pred             EEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             0755046400999872499--899999999689899626898899558986889999999999999999852
Q gi|254780432|r  322 MFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       322 ~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      ++.+|||+|||+|+|+..+  ...+.+.++++|+++..+++|+|||.|||+||++|||+++++|++++..+.
T Consensus       329 ~v~~vRG~GLmiGiel~~~~~a~~~~~~~~~~gvL~~~a~~~ViR~~PpL~i~~eei~~~~~~l~~al~~~~  400 (404)
T COG4992         329 LVKEVRGRGLMIGIELKEPYRARDIVRALREEGVLVLPAGPNVIRFLPPLVITEEEIDEALDALERALAAAS  400 (404)
T ss_pred             CEEEEECCEEEEEEEECCCCCHHHHHHHHHHCCEEEECCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             212242150499999447645799999999789699607888488458752889999999999999999654


No 4  
>PRK02627 acetylornithine aminotransferase; Provisional
Probab=100.00  E-value=0  Score=829.20  Aligned_cols=387  Identities=48%  Similarity=0.804  Sum_probs=377.8

Q ss_pred             CCCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             43145155888874898501037996799764641022674357878999999999999731450687578189999986
Q gi|254780432|r    3 KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANH   82 (392)
Q Consensus         3 ~~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~   82 (392)
                      |++|++|+|.|+|++|+||+|+||||.|||+||||+||+|++++||+||+|.+|+++|++++.|+++.|.++...+|+++
T Consensus        10 d~~~~~~~y~~~P~~i~ra~G~~l~D~dG~~ylD~~~g~~~~~lGH~~p~i~~Ai~~Q~~~l~h~~~~~~~~~~~~lae~   89 (398)
T PRK02627         10 EDKYLMNTYGRLPIAFVRGEGCWLWDDDGKEYLDFLAGIAVNSLGHAHPKLVEAIQEQAAKLIHTSNLYYIPPQEELAEK   89 (398)
T ss_pred             HHHHCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
T ss_conf             98516888899985189976288996988999986717874942789899999999999856786665467089999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             52010133312356555403567776654320013478600234354656543212345532113479998643332221
Q gi|254780432|r   83 LIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAK  162 (392)
Q Consensus        83 L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~  162 (392)
                      |++..++++|+|++|||||||+|||+||+|+..++.|+|++||+|++||||+|++++|+|+++.++++|.|.++++.++|
T Consensus        90 L~~~~~~~~v~f~~sGseAvE~AiKlAr~y~~~~~~~~r~~ii~~~~syHG~T~ga~s~tg~~~~~~~~~p~~~~~~~~p  169 (398)
T PRK02627         90 LVELSGMDKVFFCNSGAEANEAAIKLARKYGHTKGGIEKPEIITAENSFHGRTLATLSATGQPKYQKGFEPLVPGFIYVP  169 (398)
T ss_pred             HHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEC
T ss_conf             97524998799828779999999999999988647888867999537869997510013788222367678888805624


Q ss_pred             CHHHHHHHHHC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             00268875410-12332222333222211246210123221102234572131011003444455531011124545302
Q gi|254780432|r  163 FCDLQSLKNQI-SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM  241 (392)
Q Consensus       163 ~~d~~~l~~~~-~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~  241 (392)
                      |+|++++++.+ .++|||||+|||||++|+++||++||+++|++|++||++||+|||||||||||+||++|++|++|||+
T Consensus       170 ~~d~~~l~~~~~~~~iAAvi~EPiqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfGRtG~~fa~e~~gv~PDiv  249 (398)
T PRK02627        170 FNDIEALEAAINNPRTAAVLLEPIQGEGGVNPADKEYLQALRELCDENNILLILDEVQTGMGRTGKLFAYQHYGIEPDIM  249 (398)
T ss_pred             CCHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHCCCCCCCEE
T ss_conf             77299999984589879999827888889865888899999999865074077530001778556510433269788857


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCC
Q ss_conf             10344444434432100011122222332234532111100123345543201222101121000026889999886797
Q gi|254780432|r  242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPN  321 (392)
Q Consensus       242 ~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~  321 (392)
                      |+||+|+||+|+|||++++++++.+.++.|++||+|||++||||+++|++++++++++|++++|++|.++|+++.++|| 
T Consensus       250 ~~gKgl~gG~Plsav~~~~~i~~~~~~g~h~~T~~gnpla~aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~-  328 (398)
T PRK02627        250 TLAKGLGGGVPIGAVLAKGKAADVFTPGDHGSTFGGNPLACAAALAVLDIIEEEGLLENAAERGEYLRAGLRELLEKYP-  328 (398)
T ss_pred             EECCCCCCCCCCCCEECCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCC-
T ss_conf             7600024889871243169999636799878889999899999999999998648999999999999999999997199-


Q ss_pred             EEEEECCCEEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             075504640099987249989999999968989962689889955898688999999999999999985
Q gi|254780432|r  322 MFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       322 ~v~~vRG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      .+.+|||.|||+++|+..+...+.+.++++|+++.+.++|+|||.|||+||++|||+++++|+++|.+|
T Consensus       329 ~v~~vRG~Gl~~giel~~~~~~~~~~~~~~Gll~~~~g~~~ir~~PPL~it~~eid~~~~~l~~al~ev  397 (398)
T PRK02627        329 IIKEVRGLGLMIGIELKRPAKELVKKALEKGLLINVTGDNVLRLLPPLIISKEEIDELVDRLDEVLKEL  397 (398)
T ss_pred             CEEEEEECCEEEEEEECCCHHHHHHHHHHCCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             836773225799999678799999999978978950799989998892089999999999999999986


No 5  
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional
Probab=100.00  E-value=0  Score=807.55  Aligned_cols=387  Identities=43%  Similarity=0.722  Sum_probs=374.3

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             31451558888748985010379967997646410226743578789999999999997314506875781899999865
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHL   83 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L   83 (392)
                      ++|++++|+|+|++++||+|+||||.|||+||||.+|+|+++|||+||+|++|+++|++++.++.+.+.++...+|+++|
T Consensus        11 ~~~~~~~y~p~P~vi~ra~G~~l~D~dG~~yLD~~~g~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~la~~L   90 (406)
T PRK12381         11 DEWMVPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASKFWHTGNGYTNEPVLRLAKKL   90 (406)
T ss_pred             HHHCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHCEECCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             96324779999833898453989979989999916088745238998999999999986556677873688999999998


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             20101333123565554035677766543200134786002343546565432123455321134799986433322210
Q gi|254780432|r   84 IHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKF  163 (392)
Q Consensus        84 ~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~  163 (392)
                      ++..+.+||+|++|||||||+|||+||+|+..++.|+|++||+|+++|||+|.+++|+++.+.++..|.|.++++.+.++
T Consensus        91 ~~~~~~~~v~f~~SGsEAve~AiKlAr~~~~~~~~~~r~~Ii~~~~~yHG~t~~~~s~~g~~~~~~~~~p~~~~~~~~~~  170 (406)
T PRK12381         91 IDATFADRVFFCNSGAEANEAALKLARKYAHDRYGNHKSGIVAFKNAFHGRTLFTVSAGGQPKYSQDFAPLPPDIRHAAY  170 (406)
T ss_pred             HHCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             73058764999487778999999999999986389998769996787678832232157873335677889974435652


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             02688754101233222233322221124621012322110223457213101100344445553101112454530210
Q gi|254780432|r  164 CDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI  243 (392)
Q Consensus       164 ~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~  243 (392)
                      +|++++++.+.+++||||+|||||++|+++||++||++||++|++||++||+|||||||||||+||++|++|++|||+|+
T Consensus       171 ~d~~~~~~~~~~~~aAvivEPiqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~tG~GRtG~~~a~~~~gv~PDiv~~  250 (406)
T PRK12381        171 NDLNSASALIDDQTCAVIVEPIQGEGGVIPADKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDVLTT  250 (406)
T ss_pred             CHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHEECCCCEEECCCCEECCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             22999999738883599990645668832689899999997521158379744420077766676535466789988997


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEE
Q ss_conf             34444443443210001112222233223453211110012334554320122210112100002688999988679707
Q gi|254780432|r  244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMF  323 (392)
Q Consensus       244 gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v  323 (392)
                      ||+||||||+|||++++++++.+.++.|++||+|||++||||+++|++++++++++|++++|++|.++|+++.++|+ ++
T Consensus       251 gK~lggG~P~sav~~~~~i~~~~~~~~h~~T~~gnpla~aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~-~i  329 (406)
T PRK12381        251 AKALGGGFPIGAMLTTEKYASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGVKQRHDWFVERLNTINARYG-LF  329 (406)
T ss_pred             CCCCCCCCEEEEEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCC-CE
T ss_conf             42024886048998728878652888766389869999999999999997556999999999999999999887389-88


Q ss_pred             EEECCCEEEEEEEECCC----HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             55046400999872499----899999999689899626898899558986889999999999999999852
Q gi|254780432|r  324 LEVRGQGLLIGLKTVFS----PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       324 ~~vRG~Gl~~~ie~~~~----~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      .+|||+|||+++|++.+    ...+.+.++++|+++...++|+|||+|||+||++|||+++++|++++.++.
T Consensus       330 ~dVRG~GLm~giel~~~~~~~~~~l~~~~~~~Gll~~~~g~n~irl~PPL~it~~eid~~l~~l~~al~~v~  401 (406)
T PRK12381        330 SEIRGLGLLIGCVLNAEYAGKAKQISQEAAKAGVMVLIAGPNVVRFAPALNVSEEEIATGLDRFARACERFV  401 (406)
T ss_pred             EEEEECCEEEEEEECCCCCCHHHHHHHHHHHCCEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             863025269999964887535999999999799699607999699979953899999999999999999999


No 6  
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed
Probab=100.00  E-value=0  Score=808.41  Aligned_cols=387  Identities=45%  Similarity=0.763  Sum_probs=374.0

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             31451558888748985010379967997646410226743578789999999999997314506875781899999865
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHL   83 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L   83 (392)
                      ++|++++|+|+|++|+||+|+|+||.|||+||||.||+|++||||+||+|.+|+++|++++.|....+.++...+|+++|
T Consensus        12 ~~~~~~~y~p~pivi~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~I~~Ai~~Q~~~l~~~~~~~~~~~~~~lae~L   91 (403)
T PRK05093         12 DEVMVPNYAPAAFIPVRGEGSRVWDQQGREYIDFAGGIAVTALGHCHPALVKALKEQGEKLWHISNVFTNEPALRLAKKL   91 (403)
T ss_pred             HHHCCCCCCCCCCCEEEEECCEEEECCCCEEEECCCCHHHCEECCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             86305879999830898562989979979999955088850328997999999999987557775741488999999998


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             20101333123565554035677766543200134786002343546565432123455321134799986433322210
Q gi|254780432|r   84 IHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKF  163 (392)
Q Consensus        84 ~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~  163 (392)
                      ++..+.|||+|++|||||||+|||+||+|+..++.++|++||+|+++|||+|++++++++.+.++.+|+|.++++.++||
T Consensus        92 ~~~~~~drv~f~~SGSEAvE~AiklAr~~~~~~~~~~r~~ii~~~~~yHG~t~~a~s~~g~~~~~~~~~p~~~~~~~~p~  171 (403)
T PRK05093         92 VDATFAERVFFANSGAEANEAALKLARRYACDRHGPEKTEIIAFHNSFHGRTLFTVSVGGQPKYSDGFGPKPADITHVPF  171 (403)
T ss_pred             HHCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHCCCCHHCCCCCCCCCCCEECCC
T ss_conf             64168775998386778999999999999997289987547777588688836877625880110277899977565563


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             02688754101233222233322221124621012322110223457213101100344445553101112454530210
Q gi|254780432|r  164 CDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI  243 (392)
Q Consensus       164 ~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~  243 (392)
                      +|++++++.+.+++||||+|||||++|+++||++||++||++|++||++||+|||||||||||+||++|+|||+|||+|+
T Consensus       172 ~d~~~l~~~~~~~iaAviiEPi~g~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~tG~GRtG~~fa~e~~gv~PDiv~~  251 (403)
T PRK05093        172 NDLAALKAVIDDKTCAVVVEPIQGEGGVIPATPEFLQGLRELCDKHNALLIFDEVQTGMGRTGDLYAYMHYGVTPDILTS  251 (403)
T ss_pred             CCHHHHHHCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             36888860337744799995766789975899999999998630168379860134268877775222368989988997


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEE
Q ss_conf             34444443443210001112222233223453211110012334554320122210112100002688999988679707
Q gi|254780432|r  244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMF  323 (392)
Q Consensus       244 gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v  323 (392)
                      ||+||||||+|||+++++|++.+.++.|++||+|||++|+||+++|++++++++++|++++|++|.++|+++.++|+ .+
T Consensus       252 gKglggG~Plsav~~~~~i~~~~~~~~~g~T~~g~pla~aaala~L~~i~~~~l~~~a~~~G~~l~~~L~~l~~~~~-~i  330 (403)
T PRK05093        252 AKALGGGFPIGAMLTTAEIASHFKVGTHGSTYGGNPLACAVAEAVFDIINTPEVLEGVKAREQRFVDGLQKINEKYG-VF  330 (403)
T ss_pred             CCCCCCCCCEEEEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCC-CE
T ss_conf             30015886427998728878650787726589858999999999999996344999999999999999999986289-82


Q ss_pred             EEECCCEEEEEEEECCC----HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             55046400999872499----899999999689899626898899558986889999999999999999852
Q gi|254780432|r  324 LEVRGQGLLIGLKTVFS----PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       324 ~~vRG~Gl~~~ie~~~~----~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      .+|||+|||+++|+..+    ...+...++++|+++.+.++|+|||.|||+||++|||+++++|++++.++.
T Consensus       331 ~~VRG~Glm~giel~~~~~~~a~~i~~~~~~~Gll~~~~g~n~irl~PPL~it~~eid~~l~~l~~al~eV~  402 (403)
T PRK05093        331 SEIRGKGLLIGAELNEQYKGRARDFLYAAAEEGVMVLVAGPDVLRFAPSLVIPDADIDEGLARFEKAVAKVV  402 (403)
T ss_pred             EEEEECCEEEEEEECCCCCHHHHHHHHHHHHCCCEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             666541269999965875216999999999689289527999799978844899999999999999999985


No 7  
>PRK01278 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Provisional
Probab=100.00  E-value=0  Score=808.02  Aligned_cols=384  Identities=62%  Similarity=1.060  Sum_probs=376.0

Q ss_pred             ECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             51558888748985010379967997646410226743578789999999999997314506875781899999865201
Q gi|254780432|r    7 LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHS   86 (392)
Q Consensus         7 ~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~   86 (392)
                      ++++|+|+|++|+||+|+||||.|||+||||.+|+|+++|||+||+|++|+++|+++++|+++.|.++..++|+++|++.
T Consensus         6 ~~~~y~~~Pi~i~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~ai~~q~~~l~~~~~~~~~~~~~~la~~L~~~   85 (389)
T PRK01278          6 LLPVYNRADLRFERGEGVWLIDEDGERYLDFASGIAVNSLGHAHPHLVEALKEQAEKLWHVSNLYRIPEQERLAERLVEN   85 (389)
T ss_pred             CCCCCCCCCCCEEEEECCEEEECCCCEEEECCCCHHHCEECCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             43558999977799765999979989999936098861228997899999999986566765653687999999997533


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             01333123565554035677766543200134786002343546565432123455321134799986433322210026
Q gi|254780432|r   87 TFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDL  166 (392)
Q Consensus        87 ~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~  166 (392)
                      .+.|+|+|++|||||||+|||+||+|+..+|.|+|++||+|+++|||+|.+++|+++++.++++|+|..+++.+++++|+
T Consensus        86 ~~~d~v~f~~sGsEAve~AlklAr~~~~~~g~t~r~~ii~~~~~yHG~t~~~~s~sg~~~~~~~~~p~~~~~~~~~~~d~  165 (389)
T PRK01278         86 SFADKVFFTNSGAEAVECAIKTARRYQYGKGHPERYRIITFEGAFHGRTLATIAATGQEKYLEGFGPLVDGFDQVPFGDI  165 (389)
T ss_pred             CCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCHHHCCCCCCCCCCEEECCCCCH
T ss_conf             67687999687489999999999998885399997289998888886763511357884433666899888246778978


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             88754101233222233322221124621012322110223457213101100344445553101112454530210344
Q gi|254780432|r  167 QSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG  246 (392)
Q Consensus       167 ~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~  246 (392)
                      +++++.+.+++||||+|||||++|+++||++||+++|++|++||++||+|||||||||||+||++|++||+|||+|+||+
T Consensus       166 ~~l~~~~~~~iAaviiEPi~g~gG~~~~~~~yl~~l~~lc~~~g~llI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gK~  245 (389)
T PRK01278        166 EALKAAITPNTAAILIEPIQGEGGIRPLPDEFLKGLRQLCDENGLLLIFDEVQCGVGRTGKLFAHEWAGVTPDIMALAKG  245 (389)
T ss_pred             HHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCHHHCCCCCCCEEEECCC
T ss_conf             99998628881799996888888960699999999999998606538742100077755664220036768986787012


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             44443443210001112222233223453211110012334554320122210112100002688999988679707550
Q gi|254780432|r  247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEV  326 (392)
Q Consensus       247 l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~v  326 (392)
                      |+||||+|||++++++++.+.++.|++||+|||++|+||+++|++++++++++|++++|++|.++|+++.++||+++.+|
T Consensus       246 l~gG~P~sav~~~~ei~~~~~~g~~~~T~~gnp~~~aaala~L~~i~~~~l~~~v~~~G~~l~~~L~~l~~~~p~~i~~v  325 (389)
T PRK01278        246 IGGGFPLGACLATEEAAKGMTPGTHGSTYGGNPLAMAVGNAVLDVVLAPGFLDNVQKMGLYLKQKLESLVDRFPDVIEEV  325 (389)
T ss_pred             CCCCCCEEEEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             46887427998638878543688767799979999999999999998646999999999999999999987686713556


Q ss_pred             CCCEEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             4640099987249989999999968989962689889955898688999999999999999985
Q gi|254780432|r  327 RGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       327 RG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      ||.|||+++|+..++..+..+++++|+++.+.++|+|||+|||+||++|||+++++|++++.+|
T Consensus       326 RG~Gl~~gie~~~~~~~i~~~~~~~Gll~~~~g~~~lr~~PpL~it~~ei~~~~~~l~~al~~v  389 (389)
T PRK01278        326 RGEGLMLGLKCVVPSRDLVAALRDEGLLTVPAGDNVVRLLPPLIITEEEIDEALERLERAAESL  389 (389)
T ss_pred             EEEEEEEEEEECCCHHHHHHHHHHCCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             4503699999458899999999979938972799979997881398999999999999999759


No 8  
>TIGR03246 arg_catab_astC succinylornithine transaminase family. Members of the seed alignment for this protein family are the enzyme succinylornithine transaminase (EC 2.6.1.81), which catalyzes the third of five steps in arginine succinyltransferase (AST) pathway, an ammonia-releasing pathway of arginine degradation. All seed alignment sequences are found within arginine succinyltransferase operons, and all proteins that score above 820.0 bits should function as succinylornithine transaminase. However, a number of sequences extremely closely related in sequence, found in different genomic contexts, are likely to act in different biological processes and may act on different substrates. This model is desigated subfamily rather than equivalog, pending further consideration, for this reason.
Probab=100.00  E-value=0  Score=798.09  Aligned_cols=386  Identities=45%  Similarity=0.768  Sum_probs=373.3

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             31451558888748985010379967997646410226743578789999999999997314506875781899999865
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHL   83 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L   83 (392)
                      ++|++++|+|+|++|+||+|+||||.|||+||||.+|+|++++||+||+|++|+++|++++++.++.+.++...+|+++|
T Consensus         7 ~~~~~~~y~~~P~vi~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~q~~~~~~~~~~~~~~~~~~la~~L   86 (397)
T TIGR03246         7 DQVMVPNYAPAPFIPVRGEGSRVWDQQGKEYIDFAGGIAVNALGHAHPELVKALIEQADKLWHIGNGYTNEPVLRLAKKL   86 (397)
T ss_pred             HHHCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             77442669999842898364999969879999946348766557898899999999996577776863488999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             20101333123565554035677766543200134786002343546565432123455321134799986433322210
Q gi|254780432|r   84 IHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKF  163 (392)
Q Consensus        84 ~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~  163 (392)
                      ++..+.++|+|++|||||||+|||+||+|+..++.++|++||+|+++|||+|.+++++++++.++.++.|.+.++.++|+
T Consensus        87 ~~~~~~~~v~f~~sGsEA~e~AlklAr~~~~~~~~~~k~~iis~~~~yHG~t~~~~s~~~~~~~~~~~~p~~~~~~~~~~  166 (397)
T TIGR03246        87 VDATFADKVFFCNSGAEANEAALKLARRYALDKHGADKSEIVAFKNSFHGRTLFTVSVGGQPKYSQGFAPLPGGIKHAPY  166 (397)
T ss_pred             HHHCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCC
T ss_conf             75148776997286778999999999999985179997689997278689856410468996556788899976420452


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             02688754101233222233322221124621012322110223457213101100344445553101112454530210
Q gi|254780432|r  164 CDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI  243 (392)
Q Consensus       164 ~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~  243 (392)
                      +|++.+++.+.+++||||+|||||++|+++||++||+++|++|++||++||+|||||||||||+||++|+|||+|||+|+
T Consensus       167 ~d~~~~~~~~~~~iaAvi~EPv~g~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfGRtG~~~a~~~~gv~PDiv~~  246 (397)
T TIGR03246       167 NDLAAAKALISDKTCAVIVEPIQGEGGVVPADPAFLKGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDILTS  246 (397)
T ss_pred             CCHHHHHHHHCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCCEEECCCCCCCCCHHHCCCCCCCEEEE
T ss_conf             33999998528873799993877888987388899999999999859358634122078777783143226989987887


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEE
Q ss_conf             34444443443210001112222233223453211110012334554320122210112100002688999988679707
Q gi|254780432|r  244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMF  323 (392)
Q Consensus       244 gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v  323 (392)
                      ||+|+||||+|||++++++++.+.++.|++||+|||++|+||+++|++|+++++++|++++|++|.++|+++.++| +++
T Consensus       247 gK~l~gG~P~sav~~~~~i~~~~~~~~h~~T~~gnpl~~aaala~L~~i~~e~l~~~~~~~g~~l~~~L~~l~~~~-~~i  325 (397)
T TIGR03246       247 AKALGGGFPIGAMLTTTEIAAHLKVGTHGTTYGGNPLACAVAGKVLDLVNTPELLAGVKQRHDLFVDGLEKINARY-NVF  325 (397)
T ss_pred             CCCCCCCCEEEEEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHC-CCE
T ss_conf             4224688404899744888865187773866882999999999999999854799999999999999999987417-987


Q ss_pred             EEECCCEEEEEEEECCC----HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             55046400999872499----89999999968989962689889955898688999999999999999985
Q gi|254780432|r  324 LEVRGQGLLIGLKTVFS----PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       324 ~~vRG~Gl~~~ie~~~~----~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      .+|||.|||+++|++.+    ...+...++++|+++...++|+|||.|||+||++|||+++++|++++.+|
T Consensus       326 ~~VRG~Glm~giel~~~~~~~a~~i~~~~~~~Gll~~~~g~n~lrl~PPL~it~eeid~~l~~l~~al~~v  396 (397)
T TIGR03246       326 SEIRGKGLLIGAVLTEAYQGKAKQFVNAAAEEGVIALIAGPNVVRFAPSLVISDDDIDEGLARFERAIEQV  396 (397)
T ss_pred             EEEEECCEEEEEEECCCCCCHHHHHHHHHHHCCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             75422435999997278633599999999978928930799979997885189999999999999999986


No 9  
>PTZ00125 ornithine aminotransferase; Provisional
Probab=100.00  E-value=0  Score=789.34  Aligned_cols=387  Identities=35%  Similarity=0.606  Sum_probs=361.6

Q ss_pred             CCCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             43145155888874898501037996799764641022674357878999999999999731450687578189999986
Q gi|254780432|r    3 KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANH   82 (392)
Q Consensus         3 ~~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~   82 (392)
                      |++|++|+|.|+|++|+||+|+|+||.|||+||||.||+|+++|||+||+|++|+++|++++.+.+..+.++...++++.
T Consensus        20 ~~~~~~~~y~~~P~vi~rg~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~a~~~   99 (415)
T PTZ00125         20 EDNYGAHNYHPIPVVFKKGKGVFVWDVEGKKYFDFLSAYSAVNQGHCHPKILEALINQAKKLTLSSRAFYNQKLGEAEKY   99 (415)
T ss_pred             HHHHCCCCCCCCCCEEEEEECCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
T ss_conf             98718888899896189856498996988998782406886344279799999999999657877675345899999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             520101333123565554035677766543200134--786002343546565432123455321134799986433322
Q gi|254780432|r   83 LIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGK--TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQ  160 (392)
Q Consensus        83 L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~--t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~  160 (392)
                      +....+++||+|++|||||||+|+|+||+|+...++  ++|.+||+|+++|||+|.+++++++++.++..|+|..+++..
T Consensus       100 l~~~~g~~~v~f~~SGsEA~e~AiklAr~~~~~~~~~~~~r~~ii~~~~~yHG~t~ga~s~~~~~~~~~~~~p~~~~~~~  179 (415)
T PTZ00125        100 ITNLFGYDKVLFMNTGAEANETAVKFARRWGYAVKGIPENQAKIIFCNGNFSGRTMGAISASDDPKSYNKFGPFVPGFHK  179 (415)
T ss_pred             HHHCCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
T ss_conf             98554998899538758899999999989877416777896059997388688844543344574334577888897077


Q ss_pred             CCCHHHHHHHHHC--CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2100268875410--12332222333222211246210123221102234572131011003444455531011124545
Q gi|254780432|r  161 AKFCDLQSLKNQI--SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP  238 (392)
Q Consensus       161 ~~~~d~~~l~~~~--~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~P  238 (392)
                      +||+|++++++.+  .+++||||+|||||++|+++||++||++||++|++||++||+|||||||||||+||++|++|++|
T Consensus       180 ~p~~d~~~l~~~~~~~~~iAAviiEPi~g~gG~~~p~~~yl~~lr~lc~~~gillI~DEV~tGfGRtG~~fa~e~~gv~P  259 (415)
T PTZ00125        180 VDYNDLEALEKLLSKDPNVCAFIVEPIQGEAGVIVPDEGYLKQVYSLCKKYNVLLVADEVQTGLGRTGKLLAVDHEGVKP  259 (415)
T ss_pred             CCCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEECCCCEECCCCCCCCCCCCCCCCCC
T ss_conf             04676899999960499768999746568788426999999999999998487676452241677567621201789799


Q ss_pred             CEEECCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHH
Q ss_conf             3021034444443-443210001112222233223453211110012334554320122210112100002688999988
Q gi|254780432|r  239 DIMTIAKGMGGGF-PIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKN  317 (392)
Q Consensus       239 Di~~~gK~l~gG~-P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~  317 (392)
                      ||+|+||+||||| |+|||++++++++.+.++.|++||+|||++||||+++|++++++++++|++++|++|+++|++|. 
T Consensus       260 Div~~gKgl~gG~~Plsav~~~~~i~~~~~~~~h~~T~~gnpla~Aaa~a~L~~i~~~~l~~~v~~~G~~l~~~L~~L~-  338 (415)
T PTZ00125        260 DIVLLGKALSGGHLPISAVLANDDVMLTIKPGEHGSTYGGNPLAAAVCKEALEVLSEEKLAENAQKLGKYFRKGLKKLK-  338 (415)
T ss_pred             CEEEECCCCCCCCCCCEEEECCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH-
T ss_conf             8210031446887762035334999963268998889981899999999999999864699999999999999999874-


Q ss_pred             HCCCEEEEECCCEEEEEEEECCCH----HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             679707550464009998724998----99999999689899626898899558986889999999999999999852
Q gi|254780432|r  318 RFPNMFLEVRGQGLLIGLKTVFSP----ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       318 ~~~~~v~~vRG~Gl~~~ie~~~~~----~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +|| .+.+|||+|||++||+..+.    ..+..+++++|+++.+.++|+|||+|||+||++|||+++++|+++|++|+
T Consensus       339 ~~p-~v~~VRG~Gl~~giel~~~~~~~~~~i~~~~~~~Gll~~~~g~~vir~~PPL~it~~eid~~l~~l~~aL~~l~  415 (415)
T PTZ00125        339 KSP-IVEIVRGKGLLNAIQFDPNVSNVAWDICLKFKENGLLCKPTHDDIIRLTPPLTITKEQLDQCLLIIKKVLKSFN  415 (415)
T ss_pred             CCC-CEEEEECCCEEEEEEEECCCCHHHHHHHHHHHHCCEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             699-76987007819999985797658999999999599699607999899989933899999999999999999619


No 10 
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional
Probab=100.00  E-value=0  Score=789.46  Aligned_cols=383  Identities=38%  Similarity=0.661  Sum_probs=367.2

Q ss_pred             CCCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             43145155888874898501037996799764641022674357878999999999999731450687578189999986
Q gi|254780432|r    3 KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANH   82 (392)
Q Consensus         3 ~~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~   82 (392)
                      |++|++|+|.|+|++|+||+|+||||.|||+||||+||+|++++||+||+|++|+++|++++++.+..+.++...+++++
T Consensus        11 ~~~y~~~~y~~~P~~i~rg~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~~~~~~~~~~~~~~~~~~e~   90 (396)
T PRK04073         11 TNHYGAHNYHPLPIVISEAEGVWVKDPEGNKYMDMLSAYSAVNQGHRHPKIIQALKDQADKVTLTSRAFHSDQLGPWYEK   90 (396)
T ss_pred             HHHHCCCCCCCCCCEEEEEECCEEEECCCCEEEEECCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
T ss_conf             87626788899996289736599998989999994517887630379799999999998417876653243478999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             5201013331235655540356777665432001--34786002343546565432123455321134799986433322
Q gi|254780432|r   83 LIHSTFADRVFFTNSGAESVECAIKTARRYHYMA--GKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQ  160 (392)
Q Consensus        83 L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~--g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~  160 (392)
                      +++..+.++++|+||||||||+|+|+||+|.+..  ..++|++||+|+++|||+|++++|+++++.++++|+|..+++..
T Consensus        91 l~~l~~~~~v~f~~sGseAvE~AlklAr~~~~~~~~~~~~r~~ii~~~~~yHG~t~~~~s~t~~~~~~~~~~p~~~~~~~  170 (396)
T PRK04073         91 VAKLTGKDMVLPMNTGAEAVETAIKAARRWAYDVKGVEPNKAEIIACEGNFHGRTMAAVSLSSEAEYKRGFGPMLPGIKK  170 (396)
T ss_pred             HHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCEE
T ss_conf             99752836489618788899999999999987623788898779997775004532052226764334577899998232


Q ss_pred             CCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             21002688754101233222233322221124621012322110223457213101100344445553101112454530
Q gi|254780432|r  161 AKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI  240 (392)
Q Consensus       161 ~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi  240 (392)
                      +||+|++++++.+.+++||||+|||||++|+++||++||+++|++|++||++||+|||||||||||+||++|++||+|||
T Consensus       171 ~p~~d~~~l~~~~~~~~AAvi~EPi~g~gG~~~p~~~yl~~lr~lc~~~gillI~DEV~tGfGRtG~~fa~e~~gv~PDi  250 (396)
T PRK04073        171 IPYGDVEALKAAITPNTAAFLVEPIQGEAGINIPPEGFLKAARELCKEENVLFIADEIQTGLGRTGKLFACDWDNVKPDM  250 (396)
T ss_pred             CCCCHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCEEECCCCEECCCCCCCCCCEECCCCCCCE
T ss_conf             57521667886148975699998987778977899899999999999839935266341078865763001004689880


Q ss_pred             EECCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHC
Q ss_conf             2103444444-344321000111222223322345321111001233455432012221011210000268899998867
Q gi|254780432|r  241 MTIAKGMGGG-FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF  319 (392)
Q Consensus       241 ~~~gK~l~gG-~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~  319 (392)
                      +|+||+|+|| +|+|||++++++++.+.++.|++||+|||++||||+++|++++++++++|++++|++|+++|+++  ++
T Consensus       251 v~~gK~l~gG~~P~~av~~~~~i~~~~~~~~h~~T~~gnpla~aaa~a~L~~~~~~~l~~~~~~~g~~l~~~L~~l--~~  328 (396)
T PRK04073        251 YILGKALGGGVFPISCVAANRDILGVFTPGSHGSTFGGNPLACAVSIAALDVIEEEKLPERSLELGEYFKEQLKEI--DN  328 (396)
T ss_pred             EECCCCCCCCCCCEEEEECCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC--CC
T ss_conf             1025345578776058960789996166899760548898999999999999987579999999999999999825--89


Q ss_pred             CCEEEEECCCEEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             970755046400999872499899999999689899626898899558986889999999999999999
Q gi|254780432|r  320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       320 ~~~v~~vRG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      | .|.+|||+|||+++|+..+...+.++++++|+++.+.++|+|||+|||+||++|||+++++|+++|.
T Consensus       329 ~-~i~~vRG~Gl~~giel~~~~~~~~~~~~~~Gll~~~~~~~~ir~~PpL~it~~eid~~l~~l~~~L~  396 (396)
T PRK04073        329 P-MIKEVRGRGLFIGVELNEPARPYCEALKEEGLLCKETHETVIRFAPPLVISKEELDWALEKIKAVLS  396 (396)
T ss_pred             C-CEEECCCCEEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHC
T ss_conf             9-7487233779999995875899999999499799527999899979936899999999999999859


No 11 
>PRK04612 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Provisional
Probab=100.00  E-value=0  Score=785.97  Aligned_cols=386  Identities=40%  Similarity=0.700  Sum_probs=367.1

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             31451558888748985010379967997646410226743578789999999999997314506875781899999865
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHL   83 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L   83 (392)
                      ++|.+++|+|+|++|+||+|+||||.|||+||||.||+|++++||+||+|++|+++|+++++|+++.+.++...+|+++|
T Consensus        12 ~~~~~~~y~p~pivi~r~~G~~l~D~dG~~ylD~~sg~~~~~lGh~hp~v~~Ai~~Q~~~l~~~~~~~~~~~~~~lae~L   91 (408)
T PRK04612         12 AHYYLPVYRPRQVVLERGQGSRVWDDQGREYLDLSSGIAVSGLGHNDPDLVAALTEQAGKLWHTSNVFFSAPPLKLAEEL   91 (408)
T ss_pred             HHCCCCCCCCCCEEEEEEECCEEEECCCCEEEEECHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             87074657999716998563999969889999924507751225898999999999986525766752265899999999


Q ss_pred             HHHCC-CCCCCCCCCCCCCHHHHHHHHHHHHHCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             20101-333123565554035677766543200134-7860023435465654321234553211347999864333222
Q gi|254780432|r   84 IHSTF-ADRVFFTNSGAESVECAIKTARRYHYMAGK-TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQA  161 (392)
Q Consensus        84 ~~~~~-~~~v~f~~SGseA~e~Aiklar~~~~~~g~-t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~  161 (392)
                      ++..+ .++|+|++|||||||+|||+||+|+...|+ ++|++|++|+++|||+|.+++++++++.++.+|.|.+.++..+
T Consensus        92 ~~~~~~~~~v~f~~SGsEAvE~AlKlAr~y~~~~G~~~~k~~ii~~~~syHG~t~~als~t~~~~~~~~~~p~p~~~~~~  171 (408)
T PRK04612         92 VTASRFAEKVFLCNSGTEANEAAIKLVRKWASSQGRPADKRVIVTFRGSFHGRTLASVTATAQPKYQEGYEPLPGGFRYV  171 (408)
T ss_pred             HHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCEECCCCCCCCCCCCCCCCCCEEEC
T ss_conf             72268876699718746899999999999987328877776999985852598767422567843346888998852543


Q ss_pred             CCHHHHHHHHHC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             100268875410-1233222233322221124621012322110223457213101100344445553101112454530
Q gi|254780432|r  162 KFCDLQSLKNQI-SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI  240 (392)
Q Consensus       162 ~~~d~~~l~~~~-~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi  240 (392)
                      +++|++.+++.+ +++|||||+|||||++|+++||++||++||++||+||++||+|||||||||||+||+++++|++|||
T Consensus       172 ~~~d~~~le~~~~~~~iAAvivEPi~g~gG~~~~~~~yl~~l~~lc~~~gillI~DEV~TGfGRtG~~fa~~~~~v~PDi  251 (408)
T PRK04612        172 DFNDVEALEAAMAGGDVAAVMLEPIQGEGGVMPAAPGFLARVRALCDQHDALLVLDEIQCGMGRTGTLFAHWQEQVTPDI  251 (408)
T ss_pred             CCCCHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHCCCCCCE
T ss_conf             66749999971569978999997867888830689999999999997569469850122478867620355512899998


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCC
Q ss_conf             21034444443443210001112222233223453211110012334554320122210112100002688999988679
Q gi|254780432|r  241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFP  320 (392)
Q Consensus       241 ~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~  320 (392)
                      +|+||+||||||+|||++++++++.++.+.|++||+|||++|+||+++|++++++++++|++++|++|+++|+++.++| 
T Consensus       252 i~~gKglg~G~Pl~av~~~~~i~~~~~~~~h~~T~~gnpla~aaala~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~-  330 (408)
T PRK04612        252 VTLAKALGGGFPIGAMLAGPKVAETMQFGAHGTTFGGNPLAAAVARVALRKLASPQIAANVARQSAALRAGLEALNAEF-  330 (408)
T ss_pred             EEEEHHHCCCCCEEEEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCC-
T ss_conf             9972322388762899986888851468997888873599999999999999866699999999999999999987407-


Q ss_pred             CEEEEECCCEEEEEEEECCC----HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             70755046400999872499----89999999968989962689889955898688999999999999999985
Q gi|254780432|r  321 NMFLEVRGQGLLIGLKTVFS----PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       321 ~~v~~vRG~Gl~~~ie~~~~----~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +++.+|||+|||+|+|+..+    ...+...++++|+++.+.++|+|||+|||+||++|||+++++|+++|.++
T Consensus       331 ~~i~~vRG~GLm~giel~~~~~~~~~~i~~~~~~~Gll~~~~g~~~irl~PPL~it~~eide~l~~l~~al~~~  404 (408)
T PRK04612        331 GVFAQIRGRGLMLGAVLAPAHAGQAGAILDLAAEHGLLLLQAGPDVLRFVPALNLTDAELADGLARLRLALAAY  404 (408)
T ss_pred             CCEEEECCCCEEEEEEECCCCCCHHHHHHHHHHHCCCEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             98883220446999995478862699999999978919931799979996883388999999999999999999


No 12 
>PRK02936 argD acetylornithine aminotransferase; Provisional
Probab=100.00  E-value=0  Score=788.62  Aligned_cols=376  Identities=43%  Similarity=0.746  Sum_probs=366.0

Q ss_pred             CEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             14515588887489850103799679976464102267435787899999999999973145068757818999998652
Q gi|254780432|r    5 DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLI   84 (392)
Q Consensus         5 ~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~   84 (392)
                      .+++++|+++|++|+||+|+|+||.|||+||||++|+|++++||+||+|++|+++|+++++++++.+.++.+.+++++|+
T Consensus         2 ~~~~~~y~~~Pi~i~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~ql~~~~~~~~~~~~~~~~~la~~l~   81 (377)
T PRK02936          2 SHLFQTYGRRPIEIVKGKGTKVIDNNGKQYLDFTSGIAVCNLGHCHPTVTKAVQEQLDDIWHVSNLFTNSLQEEVASLLT   81 (377)
T ss_pred             CCCCCCCCCCCCCEEEEECCEEEECCCCEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCHHCCHHHHHHHHHHH
T ss_conf             85446579999877984639999598799999662988601058979999999999865788662010489999999732


Q ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             01013331235655540356777665432001347860023435465654321234553211347999864333222100
Q gi|254780432|r   85 HSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFC  164 (392)
Q Consensus        85 ~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~  164 (392)
                      +..+.++|+|++|||||||+|||+||+|      |+|++||+|++||||+|.+++++|+++.++.+|.|..+++.++||+
T Consensus        82 ~~~~~~~v~f~~sGsEAve~AiklAr~~------tgr~~ii~~~~~yHG~T~ga~s~t~~~~~~~~~~~~~~~~~~~p~~  155 (377)
T PRK02936         82 ENSAGDLVFFCNSGAEANEAALKLARKH------TGKSKIVTFEQSFHGRTFGTMSATGQEKIKEGFGPLLPGFLHVPFN  155 (377)
T ss_pred             CCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCEEEEECCCCCCCCCCCHHHCCCCCCCCCCCCCCCCEEECCCC
T ss_conf             0688788999687778999999998875------5998799987855114432001058743345778999981446745


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             26887541012332222333222211246210123221102234572131011003444455531011124545302103
Q gi|254780432|r  165 DLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA  244 (392)
Q Consensus       165 d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g  244 (392)
                      |++++++.+.++|||||+|||||++|+++||++||+++|++|++||++||+|||||||||||+||++|+||++|||+|+|
T Consensus       156 d~~~l~~~~~~~iAavi~EPiqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfGRtG~~~a~e~~gv~PDii~~g  235 (377)
T PRK02936        156 DIKALEEVMNEEVAAVMLEVVQGEGGVIPADLSFLQEVQTLCKKFGALLIIDEVQTGIGRTGTLFAYEQFGLEPDIVTVA  235 (377)
T ss_pred             CHHHHHHCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCHHHHCCCCCCEEEEE
T ss_conf             89999851689678999978767889768999999999999998298457122112776556720364449887678862


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEE
Q ss_conf             44444434432100011122222332234532111100123345543201222101121000026889999886797075
Q gi|254780432|r  245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFL  324 (392)
Q Consensus       245 K~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~  324 (392)
                      |+|+||+|+|||++++++++.+.++.|++||+|||++||||+++|++++++++++|++++|++|+++|+++.+++| .+.
T Consensus       236 K~l~~G~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~~~~~~~-~i~  314 (377)
T PRK02936        236 KGLGNGIPVGAMIGKKELGSAFTAGSHGSTFGGNYLAMAAAKEVLQVIKQPSFLEEVQEKGEYFLQKLQEELQHVE-CVK  314 (377)
T ss_pred             HHHCCCCCCCCEECCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCC-CEE
T ss_conf             0102789873330328776303789988889859999999999999985111999999999999999999843699-667


Q ss_pred             EECCCEEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             504640099987249989999999968989962689889955898688999999999999999
Q gi|254780432|r  325 EVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       325 ~vRG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      +|||+|||+++|+..+...+.+.++++|+++.+.++|+|||.|||+||++|||+++++|+++|
T Consensus       315 ~vRG~Gl~~gie~~~~~~~~~~~~~~~Gll~~~~g~~~ir~~PpL~it~~ei~~~l~~l~~aL  377 (377)
T PRK02936        315 NIRGKGLMIGIECTHEVAPFIEQLREEGLLVLQAGPNVIRLLPPLIVTKEELDQAVYMLKKVL  377 (377)
T ss_pred             EEEECCEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             712556999999778599999999969929943689989996990288999999999999869


No 13 
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed
Probab=100.00  E-value=0  Score=778.64  Aligned_cols=384  Identities=33%  Similarity=0.589  Sum_probs=364.3

Q ss_pred             CCCCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             84314515588887489850103799679976464102267435787899999999999973145068757818999998
Q gi|254780432|r    2 NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFAN   81 (392)
Q Consensus         2 ~~~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~   81 (392)
                      .+++|.+++|.|+|++|+||+|+|+||.|||+||||++|+|++++||+||+|++|+++|++++++.+..+.++..+++++
T Consensus        14 ~~~~~~~~~y~p~Pivi~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~l~~   93 (404)
T PRK00854         14 TEQRLGAHNYKPLDVVLTRGEGVWVWDTDGRRYLDCLSAYSAVNQGHCHPKILAAMVEQAGRLTLTSRAFRNDQLAPLYE   93 (404)
T ss_pred             HHHHHCCCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
T ss_conf             99874588889898479985759999799999988262999775427979999999999856786555426579999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             652010133312356555403567776654320013--478600234354656543212345532113479998643332
Q gi|254780432|r   82 HLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG--KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFD  159 (392)
Q Consensus        82 ~L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g--~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~  159 (392)
                      +|++..+.++++|+||||||||+|+|+||+|++...  .++|++||+|+++|||+|++++++++++.++..++|..+++.
T Consensus        94 ~l~~~~~~~~v~f~~SGsEAve~AiklAr~~~~~~~g~~tgr~~ii~~~~~yHG~t~~~~s~s~~~~~~~~~~~~~~~~~  173 (404)
T PRK00854         94 ELAALTGSHKVLPMNSGAEAVETAIKAVRKWGYEVKGVPEGQAEIIVCADNFHGRTLSIVGFSTDPDARGGFGPFAPGFR  173 (404)
T ss_pred             HHHHCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             99740376848855877999999999999987650378789855999645667860135434677433568889999815


Q ss_pred             CCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22100268875410123322223332222112462101232211022345721310110034444555310111245453
Q gi|254780432|r  160 QAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD  239 (392)
Q Consensus       160 ~~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD  239 (392)
                      .+||+|.++++..+.+++||||+|||||++|+++||++||++||++|++||++||+|||||||||||+||++|++||+||
T Consensus       174 ~~p~~d~~~l~~~~~~~~aAviiEPiqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~TGfGRtG~~fa~e~~gv~PD  253 (404)
T PRK00854        174 VVPFGDAAALEAAITPNTVAFLIEPIQGEAGVIIPPAGYFRRVRELCTANNVTLILDEIQTGLGRTGKLLAEEHEGIEAD  253 (404)
T ss_pred             EECCCCHHHHHHHHCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCCCC
T ss_conf             50566689999863987489999177577896179989999999999970764457500017863557414554248979


Q ss_pred             EEECCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHH
Q ss_conf             021034444443-4432100011122222332234532111100123345543201222101121000026889999886
Q gi|254780432|r  240 IMTIAKGMGGGF-PIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR  318 (392)
Q Consensus       240 i~~~gK~l~gG~-P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~  318 (392)
                      |+|+||+|+||| |+|+|++++++++.+.++.|++||+|||++||||+++|++++++++++|++++|++|+++|+++.  
T Consensus       254 ii~~gKgl~gG~~Pl~av~~~~~i~~~~~~~~h~~T~~gnpla~aaa~a~l~~i~~e~l~~~~~~~g~~l~~~L~~l~--  331 (404)
T PRK00854        254 VTLIGKALSGGFYPVSAVLSNSEVLGVLRPGQHGSTFGGNPLACAVARAALRVLVEEGMIENAAEQGAYFLEGLRAIR--  331 (404)
T ss_pred             EEEECCCCCCCCCCCCEEECCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC--
T ss_conf             897564445887653202047999950679887788898989999999999999865899999999999999998504--


Q ss_pred             CCCEEEEECCCEEEEEEEECCCH---HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             79707550464009998724998---99999999689899626898899558986889999999999999999
Q gi|254780432|r  319 FPNMFLEVRGQGLLIGLKTVFSP---ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       319 ~~~~v~~vRG~Gl~~~ie~~~~~---~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      + +++.+|||+|||+++|+..+.   ..+.+.++++|+++.+.++|+|||.|||+||++|||+++++|+++|.
T Consensus       332 ~-~~i~~VRG~Glm~gve~~~~~~~~~~~~~~~~~~Gll~~~~~~~~ir~~PPL~it~~eid~~l~~l~~~La  403 (404)
T PRK00854        332 G-NIVREVRGRGLMLAVELEPEAGGARQYCEALKARGLLAKDTHDHTIRLAPPLVITREQVDWAVSQIAKVLA  403 (404)
T ss_pred             C-CCEEEEEECCEEEEEEEECCHHHHHHHHHHHHHCCEEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHC
T ss_conf             8-97276644455999998556677999999999799598748999899979957899999999999999966


No 14 
>PRK03244 argD acetylornithine aminotransferase; Provisional
Probab=100.00  E-value=0  Score=775.94  Aligned_cols=378  Identities=39%  Similarity=0.644  Sum_probs=361.7

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             31451558888748985010379967997646410226743578789999999999997314506875781899999865
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHL   83 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L   83 (392)
                      .+|++++|.++|++|+||+|+||||.|||+||||++|+|+++|||+||+|++|+++|++++.++++.|.++...++|++|
T Consensus        15 ~~~~~~~y~~~Pi~i~~a~G~~l~D~~G~~ylD~~~g~~~~~lGh~~p~i~~ai~~q~~~l~~~~~~~~~~~~~~lae~L   94 (398)
T PRK03244         15 QAVMMNNYGTPPLALVRGEGAVVTDVDGKEYLDLLGGIAVNALGHAHPAVVEAVTRQLATLGHVSNLFATEPQIALAERL   94 (398)
T ss_pred             HHHCCCCCCCCCCCEEEEECCEEEECCCCEEEECCCCHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             87514768999854798474999979989999967088754223898999999999997547775653586999999999


Q ss_pred             HHHCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             201013---33123565554035677766543200134786002343546565432123455321134799986433322
Q gi|254780432|r   84 IHSTFA---DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQ  160 (392)
Q Consensus        84 ~~~~~~---~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~  160 (392)
                      ++..+.   .||+|++|||||||+|||+||+       ++|++||+++++|||+|.+++++++++.++.+|.|.+.++.+
T Consensus        95 ~~~~~~~~~~kvff~~SGsEA~E~AlKlAr~-------tgr~~Iis~~~sYHG~T~ga~s~tg~~~~~~~~~p~~~~~~~  167 (398)
T PRK03244         95 VALLGAPEGARVFFCNSGAEANEAAFKLARL-------TGRTKIVAAEGGFHGRTMGALALTGQPAKRAPFEPLPGGVEH  167 (398)
T ss_pred             HHHCCCCCCCEEEEECCHHHHHHHHHHHHHH-------CCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
T ss_conf             9860899656799718677899999999998-------299879998387768876542336885312346788787277


Q ss_pred             CCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             21002688754101233222233322221124621012322110223457213101100344445553101112454530
Q gi|254780432|r  161 AKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI  240 (392)
Q Consensus       161 ~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi  240 (392)
                      +||+|++++++.+.+++||||+|||||++|+++||++||++||++|++||++||+|||||||||||+||++|++||+|||
T Consensus       168 ~p~~d~~~l~~~~~~~iAAii~EPiqg~gG~~~~~~~fl~~l~~lc~~~gillI~DEV~tGfGRtG~~fa~e~~~v~PDI  247 (398)
T PRK03244        168 VPYGDVDALAAAVDDDTAAVFLEPIQGEAGVVPPPAGYLAAAREITDRHGALLVLDEVQTGIGRTGAWFAHQHDGVTPDV  247 (398)
T ss_pred             CCCCCHHHHHHHHCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCCCHHHHCCCCCCE
T ss_conf             15786689999738985899985876889985688889999999985734536666212487766786156533799988


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCC
Q ss_conf             21034444443443210001112222233223453211110012334554320122210112100002688999988679
Q gi|254780432|r  241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFP  320 (392)
Q Consensus       241 ~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~  320 (392)
                      +|+||+||||+|+||+++++++++.+.++.|++||+|||++|+||+++|++++++++++|++++|++|+++|+++  +||
T Consensus       248 v~~gK~lggG~P~sa~~~~~~~~~~~~~~~h~~T~~gnpl~~aaa~a~L~~i~~~~l~~~v~~~g~~l~~~L~~l--~~~  325 (398)
T PRK03244        248 VTLAKGLGGGLPIGACLAFGPAADLLTPGLHGSTFGGNPVACAAALAVLRVIADEGLLENAERLGKQLRAGIEAL--GHP  325 (398)
T ss_pred             EEECCCCCCCCCCEEEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHC--CCC
T ss_conf             997320248876168897188886417887674789898999999999999975579999999999999999854--898


Q ss_pred             CEEEEECCCEEEEEEEECCC-HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             70755046400999872499-899999999689899626898899558986889999999999999999852
Q gi|254780432|r  321 NMFLEVRGQGLLIGLKTVFS-PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       321 ~~v~~vRG~Gl~~~ie~~~~-~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                       +|.+|||+|||++||++.+ ...+...++++|+++...++|+|||.|||+||++|||+++++|+++|.+++
T Consensus       326 -~i~~VRG~Gl~~giel~~~~~~~~~~~~~~~Gll~~~~g~n~ir~~PPl~it~~eid~~~~~l~~~L~~~a  396 (398)
T PRK03244        326 -LVDHVRGRGLLLGIVLTAPVAKAVEAAAREAGFLVNAPAPDVIRLAPPLIITDAQVDAFVAALPAILDAAA  396 (398)
T ss_pred             -CEEEEEEEEEEEEEEECCCHHHHHHHHHHHCCCEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             -61410012689999966731999999999689199318999799949957899999999999999999985


No 15 
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
Probab=100.00  E-value=0  Score=776.01  Aligned_cols=386  Identities=30%  Similarity=0.489  Sum_probs=349.9

Q ss_pred             CCCEECCCCCC-------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCH
Q ss_conf             43145155888-------8748985010379967997646410226743578789999999999997314506-875781
Q gi|254780432|r    3 KNDFLFNTYDQ-------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQST   74 (392)
Q Consensus         3 ~~~~~~~~~~~-------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~   74 (392)
                      +++|+||.|.+       .|++|+||+|+||||.|||+|||+.+|+|++++||+||+|++|+++|++++.|+. ..+.++
T Consensus        11 d~~~~whp~t~~~~~~~~p~~~I~rg~G~~l~D~dG~~YlD~~sg~~~~~lGH~~p~v~~Ai~~Q~~~l~~~~~~~~~~~   90 (467)
T PRK07030         11 DLKVLWHPCTQMKDHEQLPLIPIKRGEGVWLEDFEGKRYLDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQ   90 (467)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEECCCCEEEECCCCEEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCH
T ss_conf             78631589888644356898679936369899799999999454388634148969999999999975777245776877


Q ss_pred             HHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999986520101--3331235655540356777665432001347860023435465654321234553211347999
Q gi|254780432|r   75 QQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFG  152 (392)
Q Consensus        75 ~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~  152 (392)
                      ...+|+|+|++..|  +++|+|+||||||||+|||+||+|+..+|.|+|++||+++++|||+|++++|+++.+.++..|.
T Consensus        91 ~~~elAe~L~~~~P~~l~~v~f~~SGSEAvE~AiKlAr~y~~~~g~~gr~~iis~~~sYHG~T~ga~s~~~~~~~~~~~~  170 (467)
T PRK07030         91 PVIELSERLVKITPAGLDRVFYADNGSSAIEVALKMSFHYWRNRGKPRKKRFVTLTNSYHGETIAAMSVGDVALFTETYK  170 (467)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHHHCCCCCCCCCCC
T ss_conf             99999999997388886879983784899999999999999980898870798733734342177776348701147877


Q ss_pred             CCCCCCCCCCCHH-----------------HHHHHH---HCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             8643332221002-----------------688754---1012332222333-222211246210123221102234572
Q gi|254780432|r  153 PKIEGFDQAKFCD-----------------LQSLKN---QISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDA  211 (392)
Q Consensus       153 p~~~~~~~~~~~d-----------------~~~l~~---~~~~~iAavi~Ep-v~g~~G~~~~~~~~l~~l~~lc~~~g~  211 (392)
                      |..+++.++|+++                 ++.+++   ..++++||||+|| +||+||+++||++||++||++|++||+
T Consensus       171 p~~~~~~~~p~p~~~~~~~g~~~~~~~~~~~~~le~~l~~~~~~iAAvi~EPiiqg~GG~~~~~~~yl~~lr~lc~~~gi  250 (467)
T PRK07030        171 PLLLDTIKVPSPDCYLRPEGMSWEEHSRNMFAHMEQTLAEHHDEIAAVIVEPLIQGAGGMRMYHPVYLKLLREACDRYGV  250 (467)
T ss_pred             CCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             87888667589864356678888999999999999999847997469998232336799727998999999999975594


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCHH
Q ss_conf             1310110034444555310111245453021034444443-4432100011122222-------3322345321111001
Q gi|254780432|r  212 LLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMN-------QGSHGSTYGGNVLAMV  283 (392)
Q Consensus       212 llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~-------~~~~~~T~~gnpl~~a  283 (392)
                      |||+|||||||||||+||++|++||+|||+|+||+|+||| |+|||+++++|++.+.       +..|++||+|||++||
T Consensus       251 LlI~DEV~tGfGRTG~~fa~e~~gv~PDiit~aKgl~gG~~Pl~av~~~~~I~~~~~~~~~~~~~~~Hg~Ty~GnPlacA  330 (467)
T PRK07030        251 HLIHDEIAVGFGRTGTMFACEQAGIRPDFLCLSKALTGGYLPLAAVLTTDTVYQAFYDDYPTLRAFLHSHSYTGNPLACA  330 (467)
T ss_pred             EEECCCCEECCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             68725003178624585320056789988997043116877538998748999876325655557675889997999999


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------------HHHHHHHHH
Q ss_conf             2334554320122210112100002688999988679707550464009998724998-------------999999996
Q gi|254780432|r  284 LGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------------ALLAAKFRD  350 (392)
Q Consensus       284 aa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------------~~~~~~l~~  350 (392)
                      ||+++|++|+++++++|++++|++|+++|++|++ || .|.+|||+|||++||++.++             ..+.+.+++
T Consensus       331 Aala~L~ii~~e~l~~~~~~~g~~l~~~l~~l~~-~p-~VgdVRG~GL~~giElv~d~~t~~p~~~~~~~~~~v~~~~~~  408 (467)
T PRK07030        331 AALATLDIFEQDNVIEANRALARRMAEATAHLAD-HP-HVAEVRQTGMALAIEMVQDKASKTPYPWQERRGLKVYQHALE  408 (467)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC-CC-CEEEEECCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9999999999768999999999999999998707-99-758883475199999703787678885466799999999997


Q ss_pred             CCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             89899626898899558986889999999999999999852
Q gi|254780432|r  351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       351 ~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +|+++++.+ |+|+|+|||+||++|||+++++|+++|.+..
T Consensus       409 ~G~l~~~~g-nvi~~~PPL~it~~eid~~~~~l~~al~~a~  448 (467)
T PRK07030        409 RGALLRPLG-SVVYFLPPYVITPEQIDFLAEVASEGIDIAT  448 (467)
T ss_pred             CCCEEEECC-CEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             898897349-9999979927899999999999999999999


No 16 
>PRK03715 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Provisional
Probab=100.00  E-value=0  Score=771.40  Aligned_cols=384  Identities=41%  Similarity=0.651  Sum_probs=361.0

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             31451558888748985010379967997646410226743578789999999999997314506875781899999865
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHL   83 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L   83 (392)
                      .++++..|.+.|++|+||+|+|+||.|||+||||+||++++++||+||+|++|+++|++++.+..+.|.++...+|+++|
T Consensus         8 ~~~~~~~~~rppivi~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~Q~~~l~~~~~~~~~~~~~~la~~L   87 (395)
T PRK03715          8 IDSLMYITNRPDIVFTHGKGSWLYDHTGKRYLDFIQGWAVNCLGHCNPGMVEALAAQAEKLINPSPAFYNEPMAKLAGLL   87 (395)
T ss_pred             CCCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             54356656999805998354889979879998823178877745896999999999997547677320278999999998


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             20101333123565554035677766543200134786002343546565432123455321134799986433322210
Q gi|254780432|r   84 IHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKF  163 (392)
Q Consensus        84 ~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~  163 (392)
                      ++..+++||+|++|||||||+|||+||+|+... +++|++||+|+++|||+|++++++|+.+.++..|.|..+++...++
T Consensus        88 ~~~~~~~~v~f~~sGsEAvE~AlKlAr~y~~~~-~~gr~~ii~~~~~yHG~T~~~~s~sg~~~~~~~~~p~~~~~~~~~~  166 (395)
T PRK03715         88 TQHSCFDKVFFANSGAEANEGAIKLARKWGRKH-KNGAYEIITFDHSFHGRTLATMSASGKPGWDTIFAPQVPGFPKAEL  166 (395)
T ss_pred             HCCCCCCEEEEECCHHHHHHHHHHHHHHHHHCC-CCCCCEEEEECCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             415588879981875889999999999986246-8998459997578898740221046864445567898899675554


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             02688754101233222233322221124621012322110223457213101100344445553101112454530210
Q gi|254780432|r  164 CDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI  243 (392)
Q Consensus       164 ~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~  243 (392)
                      +|++.+++.+.+++||||+|||||++|+++||++||+++|++|++||++||+|||||||||||+||++|++|++|||+|+
T Consensus       167 ~d~~~~~~~~~~~~aAviiEPiqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~  246 (395)
T PRK03715        167 NDIASVEKLITDKTVAVMLEPVQGEGGVIPATREFMQQLRALTKQHGLLLIVDEVQTGCGRTGTLFAYELAGIEPDIMTL  246 (395)
T ss_pred             CCHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             55899997349980799993788877985298899999999995189735620110388866685300048999998997


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEE
Q ss_conf             34444443443210001112222233223453211110012334554320122210112100002688999988679707
Q gi|254780432|r  244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMF  323 (392)
Q Consensus       244 gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v  323 (392)
                      ||+|+||+|+|||++++++. .+.++.|++||+|||++||||+++|++++++++++|++++|++|+++|++|+++|+  +
T Consensus       247 gKgl~gG~Pl~av~~~~~i~-~~~~g~~g~T~~gnpla~aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~--i  323 (395)
T PRK03715        247 GKGIGGGVPLAALLAKAEVA-VFEAGDQGGTYNGNPLMTAVGYAVISQLVAPGFLEGVRARGEYLKEKLLELSAERG--L  323 (395)
T ss_pred             CCHHHCCCCEEEEEECHHHC-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCC--C
T ss_conf             52442898528999826742-47789888798997189999999999996268999999999999999998650399--1


Q ss_pred             EEECCCEEEEEEEECCCHH----HHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             5504640099987249989----9999999689899626898899558986889999999999999999852
Q gi|254780432|r  324 LEVRGQGLLIGLKTVFSPA----LLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       324 ~~vRG~Gl~~~ie~~~~~~----~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      .+|||+|||+++|++.+..    ..+..+.++|+++....+|+|||.|||+||++|||+++++|+++|.+|+
T Consensus       324 ~~vRG~Gl~~~iel~~~~~~~~~~~~~~~~~~gll~~~~~~n~irl~PpL~it~~eid~~~~~l~~aL~~la  395 (395)
T PRK03715        324 EGERGEGLLRALLLGKDIGPQIVEKARDMQPDGLLLNAPRPNLLRFMPALNVTTDEIDQMIAMLRSVLDKLA  395 (395)
T ss_pred             EEEEECCEEEEEEECCCCCHHHHHHHHHHHHCCEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             357435589999967887089999999998399899228999899979943889999999999999999869


No 17 
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism]
Probab=100.00  E-value=0  Score=772.59  Aligned_cols=380  Identities=41%  Similarity=0.690  Sum_probs=350.9

Q ss_pred             CCEECCCCCC--CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCC-HHHHHHH
Q ss_conf             3145155888--874898501037996799764641022674357878999999999999731450687578-1899999
Q gi|254780432|r    4 NDFLFNTYDQ--SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQS-TQQEIFA   80 (392)
Q Consensus         4 ~~~~~~~~~~--~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~-~~~~~la   80 (392)
                      ++++.++|..  +|++++||+|+||||.|||+||||.||+++.|+|||||+|++|+++|++++.|+++.+.+ +...+|+
T Consensus        26 ~~~~~r~~~~~~~p~~~~ra~G~~l~DvdG~~ylDf~sgi~v~~~GH~hP~Vv~Av~~q~~~~~h~~~~~~~~e~~v~~a  105 (447)
T COG0160          26 EEALARSYGRFRFPLVIVRAEGAYLYDVDGNEYLDFLSGIAVLNLGHNHPRVVEAVKRQLAKLNHTHTRDLYYEPYVELA  105 (447)
T ss_pred             HHHHCCCCCCCCCCCEEEECCCCEEEECCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHH
T ss_conf             98745455555676247740268899589998988256762010378998999999999997301357766633699999


Q ss_pred             HHHHHHCC---CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             86520101---3331235655540356777665432001347860023435465654321234553211-3479998643
Q gi|254780432|r   81 NHLIHSTF---ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQ-YLEGFGPKIE  156 (392)
Q Consensus        81 ~~L~~~~~---~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~-~~~~~~p~~~  156 (392)
                      |+|.+..|   .++++|+||||||||+|||+||.|      |+|+.||+|+++|||+|.+++|+|++.. ++.+++|+++
T Consensus       106 e~L~~~~p~~~~~~~~f~~sGaeA~E~AiKiAr~~------Tgr~~viaf~~afHG~T~galslT~~~~~~~~~~~~~~~  179 (447)
T COG0160         106 EKLTALAPGSGLKKVFFGNSGAEAVEAAIKIARAY------TGRPGVIAFDGAFHGRTLGALSLTGSKPPYKAGFGPLPP  179 (447)
T ss_pred             HHHHHHCCCCCCCEEEECCCCHHHHHHHHHHHHHH------HCCCCEEEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             99997588656776995688377899999999998------589848997886556326668754576653357889999


Q ss_pred             CCCCCCCHH-----------------HHHHHHHC------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEE
Q ss_conf             332221002-----------------68875410------1233222233322221124621012322110223457213
Q gi|254780432|r  157 GFDQAKFCD-----------------LQSLKNQI------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALL  213 (392)
Q Consensus       157 ~~~~~~~~d-----------------~~~l~~~~------~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~ll  213 (392)
                      ++.++||++                 ++.+++.+      ++++||+|+|||||+||+++||++||+++|++|++||++|
T Consensus       180 ~v~~~Pyp~~yr~p~~~~~~~~~~~~~~~~e~~i~~~~~~~~~vAaiI~EpIQgegG~~v~p~~fl~~l~~~~~~~gill  259 (447)
T COG0160         180 GVYHVPYPNPYRCPFGIGGEECGDDALEYIERALFDLEVGPEEVAAIIIEPIQGEGGIIVPPKGFLKALRKLCREHGILL  259 (447)
T ss_pred             CEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEE
T ss_conf             85881688655675556635556899999999987404787754699984210789974798999999999999819889


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             10110034444555310111245453021034444443443210001112222233223453211110012334554320
Q gi|254780432|r  214 IFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQ  293 (392)
Q Consensus       214 I~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~  293 (392)
                      |+|||||||||||+||++|++||+|||+|+||+|+||+|+|+|++++++++ +.++.|++||+|||++||||+++|++|+
T Consensus       260 I~DEVQtG~GRTG~~fa~E~~gv~PDivt~aK~ig~G~Pl~avv~r~ei~~-~~~g~~~~Tf~GNpva~Aaa~AvL~vie  338 (447)
T COG0160         260 IADEVQTGFGRTGKMFAFEHFGVEPDIVTLAKSLGGGLPLSAVVGRAEIMD-WPPGGHGGTFGGNPVACAAALAVLDVIE  338 (447)
T ss_pred             EEECCCCCCCCCCCCHHHHHCCCCCCEEEECCCCCCCCCEEEEECCHHHCC-CCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             995665588866260122420999878985333457872067744577601-4776547777869899999999999998


Q ss_pred             CCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC----------HHHHHHHHHHCCEEEEECC--CC
Q ss_conf             12221011210000268899998867970755046400999872499----------8999999996898996268--98
Q gi|254780432|r  294 SDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS----------PALLAAKFRDECLLTAPSS--DN  361 (392)
Q Consensus       294 ~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~----------~~~~~~~l~~~Gll~~~~~--~~  361 (392)
                      +++|++|++++|++++++|++|+++|| +|.||||+|||+++|++++          ...++..++++||++..+|  +|
T Consensus       339 ~e~L~~~a~~~G~~l~~~L~~l~~~~~-~IgdVRG~Glm~giE~v~d~~t~~p~~~~~~~i~~~~~~~Glil~~~G~~~n  417 (447)
T COG0160         339 EENLLERAAELGEYLRDRLEELQEKHP-LIGDVRGLGLMIGVELVKDRDTKEPDAELAAKIVARAFERGLLLLTCGPHGN  417 (447)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHHHHCC-CEECCCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEECCCCCCC
T ss_conf             742999999999999999999986467-4421244650789998337877899999999999999986988854578786


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             899558986889999999999999999852
Q gi|254780432|r  362 VVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       362 ~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +|||.|||+||++++|+++++|++++.++.
T Consensus       418 viRi~PPL~is~e~~d~~l~il~~al~~~~  447 (447)
T COG0160         418 VLRILPPLTISDEELDEGLDILEEALKEAL  447 (447)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             799828954389999999999999998549


No 18 
>PRK05965 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=767.38  Aligned_cols=387  Identities=28%  Similarity=0.461  Sum_probs=347.5

Q ss_pred             CCCEECCCCCC-------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC--CCC
Q ss_conf             43145155888-------874898501037996799764641022674357878999999999999731450687--578
Q gi|254780432|r    3 KNDFLFNTYDQ-------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL--YQS   73 (392)
Q Consensus         3 ~~~~~~~~~~~-------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~--~~~   73 (392)
                      +++|+||.|.+       .|++|+||+|+|+||.|||+||||++|+|++++||+||+|++|+++|++++.+.+..  +.+
T Consensus        10 d~~~~~hp~t~~~~~~~~~p~vi~~a~G~~l~D~dG~~ylD~~sg~~~~~lGh~hp~v~~Ai~~Q~~~l~~~~~~~~~~~   89 (459)
T PRK05965         10 DRAHLIHPVASYRGHEARGVTVLESAKGAFLTDASGHQLLDAFAGLWCVNVGYGQESIVEAAAKQMRKLPYATGYFHFGS   89 (459)
T ss_pred             HHHHCCCCCCCHHHCCCCCCEEEEEEEECEEEECCCCEEEECCHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99755888888112267899699962508899589999988686288656505979999999999975677356656686


Q ss_pred             HHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             189999986520101--333123565554035677766543200134786002343546565432123455321134799
Q gi|254780432|r   74 TQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGF  151 (392)
Q Consensus        74 ~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~  151 (392)
                      +...+|+++|++..|  +++|+|+||||||||+|||+||+|+.+++.|+|++||+|+++|||+|.+++++++.+.+++.|
T Consensus        90 ~~~~~la~~L~~~~p~~l~~v~f~~SGSEAvE~AlKlar~y~~a~g~~~r~~ii~~~~syHG~T~~~~slt~~~~~~~~~  169 (459)
T PRK05965         90 EPAIRLAAELAERAPGSLNHVYFTLGGSDAVDSAVRFITHYWNATGRPSKKQFIALERGYHGSSSVGAGLTALPAFHRGF  169 (459)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCEEECCCCCCCCCCCC
T ss_conf             69999999999857888687998486799999999999999997279987579997178589974310257774322356


Q ss_pred             CCCCCCCCCCCC-----------------HHHHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             986433322210-----------------0268875410----1233222233322221124621012322110223457
Q gi|254780432|r  152 GPKIEGFDQAKF-----------------CDLQSLKNQI----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDID  210 (392)
Q Consensus       152 ~p~~~~~~~~~~-----------------~d~~~l~~~~----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g  210 (392)
                      ++..++..++|.                 .+++++++.+    +++|||||+|||||+||+++||++||+++|++|++||
T Consensus       170 ~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~~vAAvi~EPi~g~gG~~~pp~~yl~~lr~lc~~~g  249 (459)
T PRK05965        170 DLPLPWQHHIPSPYAYRNPVGDDPQAIIAASVAALEAKVAELGADNVAAFFCEPIQGSGGVIVPPKGWLKAMREACRELG  249 (459)
T ss_pred             CCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             89999862357886556878897788999999999999986188757999954644668853287688799999987569


Q ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCH
Q ss_conf             21310110034444555310111245453021034444443-443210001112222233-------2234532111100
Q gi|254780432|r  211 ALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG-------SHGSTYGGNVLAM  282 (392)
Q Consensus       211 ~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~-------~~~~T~~gnpl~~  282 (392)
                      ++||+|||||||||||+||++|++||+|||+|+||+|+||| |+|+++++++|++.+..+       .|++||+|||++|
T Consensus       250 illI~DEV~TGfGRtG~~fa~e~~gv~PDiv~~gKgL~gG~~Plsav~~~~~i~~~~~~~~~~~~~~~hg~T~~gnpla~  329 (459)
T PRK05965        250 ILFVADEVITGFGRTGPLFACEAEGVVPDLMTVAKGLTSGYVPMGAVLMSDHVYQGIADGAGAAAPVGHGYTYSAHPVSA  329 (459)
T ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             17998305417762447410036661888888734345786751689764899987611566565445677899898999


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------------HHHHHHHH
Q ss_conf             12334554320122210112100002688999988679707550464009998724998-------------99999999
Q gi|254780432|r  283 VLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------------ALLAAKFR  349 (392)
Q Consensus       283 aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------------~~~~~~l~  349 (392)
                      |||+++|++++++++++|++++|++|.++|++|.+ || .|.+|||+|||+++|++.+.             ..+..+++
T Consensus       330 Aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~L~~-~p-~i~dVRG~GLm~gielv~d~~~~~~~~~~~~~~~~i~~~~~  407 (459)
T PRK05965        330 AVGLEVLRLYHEGGLLANGQAAAPRFAAGLDALRA-HP-LVGDVRGRGLLGALELVADKASKTPFDAALEPADRIFDRAY  407 (459)
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC-CC-CEEEEEECCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             99999999998634999999999999999998764-99-76867825627999971265446677554799999999999


Q ss_pred             HCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             689899626898899558986889999999999999999852
Q gi|254780432|r  350 DECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       350 ~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      ++|+++.+.++|++||.|||+||++|||+++++|+++|.+|.
T Consensus       408 ~~Glli~~~g~~vl~l~PPL~It~~eid~~~~~l~~al~evl  449 (459)
T PRK05965        408 ANGLVFRAFGDGVLGFAPALCCTEGEFDLIFERTRKTLDDVL  449 (459)
T ss_pred             HCCEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             699299807999899978820899999999999999999998


No 19 
>PRK08593 4-aminobutyrate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=766.15  Aligned_cols=384  Identities=27%  Similarity=0.469  Sum_probs=350.2

Q ss_pred             CCCCEECCCC--CCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCHHHHH
Q ss_conf             8431451558--88874898501037996799764641022674357878999999999999731450687-57818999
Q gi|254780432|r    2 NKNDFLFNTY--DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL-YQSTQQEI   78 (392)
Q Consensus         2 ~~~~~~~~~~--~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~-~~~~~~~~   78 (392)
                      ++++|.+++.  .++|++|+||+|+||||.|||+||||+||+|+++|||+||+|++|+++|++++.+..+. +.++...+
T Consensus        13 ~~~~~~~~~~~~~~~P~~i~ra~G~~l~D~dG~~yLD~~sg~~~~~lGh~~p~v~~Ai~~ql~~l~~~~~~~~~~~~~~~   92 (448)
T PRK08593         13 EDEHYFAKSGRIKYYPLVIDHGYGATLVDIEGKTYIDLLASASSQNVGHAPPEVVEAIKAQADKFIHYTPAYMYHEPLVR   92 (448)
T ss_pred             HHHHHCCCCCCCCCCCCEEEEEECCEEEECCCCEEEEECCCHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHH
T ss_conf             99974567889871598489735498996996999993523764010489899999999998407673666314679999


Q ss_pred             HHHHHHHHCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC
Q ss_conf             99865201013---33123565554035677766543200134786002343546565432123455321-134799986
Q gi|254780432|r   79 FANHLIHSTFA---DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFGPK  154 (392)
Q Consensus        79 la~~L~~~~~~---~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~p~  154 (392)
                      |+++|++..|.   .+|+|++|||||||+|||+||+|      |||++||+|+++|||+|++++|+|+.. ..++.++|.
T Consensus        93 la~~L~~~~p~~~~~~v~f~~SGsEAvE~AlKlAr~~------tgr~~ii~~~~~yHG~T~ga~s~sg~~~~~~~~~~p~  166 (448)
T PRK08593         93 LAKKLCELAPGDFEKRVTFGLSGSDANDGIIKFARAY------TGRPYIISFTNAYHGSTYGSLSMSAISLNMRKKYGPL  166 (448)
T ss_pred             HHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHHC------CCCCEEEEEECCCCCCCCCCHHCCCCCCCCCCCCCCC
T ss_conf             9999998578676637997187578999999999754------8998799994787768734001047875654456899


Q ss_pred             CCCCCCCCCHH-----------------HHHHHHH----C-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCE
Q ss_conf             43332221002-----------------6887541----0-123322223332222112462101232211022345721
Q gi|254780432|r  155 IEGFDQAKFCD-----------------LQSLKNQ----I-SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDAL  212 (392)
Q Consensus       155 ~~~~~~~~~~d-----------------~~~l~~~----~-~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~l  212 (392)
                      ++++.++|+++                 ++.+++.    + .++|||||+|||||++|+++||++||+++|++|++||++
T Consensus       167 ~p~~~~vp~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iAAvi~EPvqg~gG~~~~p~~yl~~lr~lc~~~gil  246 (448)
T PRK08593        167 LPGFYHIPFPDKYRGMYEEPQANSVEEYLAPLKEMFEKYVPADEVACIVIETIQGDGGLLEPVPGYFEALYKFCREHGIL  246 (448)
T ss_pred             CCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCEE
T ss_conf             99957807986334545787067999999999999985178897699999788788898738878868999999866806


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             31011003444455531011124545302103444444344321000111222223322345321111001233455432
Q gi|254780432|r  213 LIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       213 lI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
                      ||+|||||||||||+||++|++||+|||+|+||+|+||+|+||++++++|++.+.+..|++||+|||++||||+++|+++
T Consensus       247 lI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gKgl~gG~Plsav~~~~ei~~~~~~~~h~~T~~Gnpla~aaa~a~L~~i  326 (448)
T PRK08593        247 FAVDDIQQGLGRTGKWSSISHFNITPDLMTFGKSLAGGMPMSAIVGRKEIMESLEAPAHLFTTGANPVSCEAALATIDMI  326 (448)
T ss_pred             EEEEEEECCCCCCCCCHHHHHCCCCCCEEEECCCCCCCCCEEEEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             98743001777567603554305288867773002588740799875898852178865657899989999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEECCCCE
Q ss_conf             0122210112100002688999988679707550464009998724998----------999999996898996268988
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLLTAPSSDNV  362 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~Gll~~~~~~~~  362 (392)
                      +++++++|++++|++|+++|+++.++|| .|.+|||+|||++||++.++          ..+.+.++++|+++.+.++|+
T Consensus       327 ~~~~l~~~~~~~g~~l~~~L~~l~~~~p-~v~dVRG~GL~~giElv~~~~~~~~~~~~~~~v~~~~~~~Gll~~~~~gn~  405 (448)
T PRK08593        327 EDESLLQASAEKGEYVRKRFDQWVSKYN-FVGDVRGKGLSIGIDIVSDKKLKTRDAEAALKICNYCFEHGVVIIAVAGNV  405 (448)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHCCC-CEEEECCCCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCE
T ss_conf             7443999999999999999999986299-788730255178999964555578888999999999997890898679998


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             995589868899999999999999998529
Q gi|254780432|r  363 VRILPPLTITAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       363 irl~Ppl~it~~eid~~i~~l~~al~~L~~  392 (392)
                      |||.|||+||++|||+++++|+++|.+|.+
T Consensus       406 ir~~PpL~it~~eid~~~~~l~~al~~l~a  435 (448)
T PRK08593        406 LRFQPPLVITYEQLDTALNTIEDALTALEA  435 (448)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             999789008899999999999999999874


No 20 
>PRK04260 acetylornithine aminotransferase; Provisional
Probab=100.00  E-value=0  Score=767.56  Aligned_cols=374  Identities=41%  Similarity=0.695  Sum_probs=356.4

Q ss_pred             CEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             14515588887489850103799679976464102267435787899999999999973145068757818999998652
Q gi|254780432|r    5 DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLI   84 (392)
Q Consensus         5 ~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~   84 (392)
                      .|++++|+++|++|+||+|+|+||.|||+||||.||+|++++|| ||+|.+|+++|++++++.++.+.+...++++++|.
T Consensus         2 ~~~~~~y~~~Pi~~~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh-~p~i~~ai~~q~~~~~~~~~~~~~~~~~~la~~l~   80 (375)
T PRK04260          2 TYLFSNYKRAAIEFVKAEGNYLIDTTGKTYLDFSSGIGVTNLGF-HPQVQQALTDQAGLIWHSPNLYLSSLQEEVAQKLT   80 (375)
T ss_pred             CCCCCCCCCCCCCEEEEECCEEEECCCCEEEEECCCHHHHCCCC-CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCC
T ss_conf             70556689999888985749999697799999153787640278-99999999999856569874778899999998523


Q ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             01013331235655540356777665432001347860023435465654321234553211347999864333222100
Q gi|254780432|r   85 HSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFC  164 (392)
Q Consensus        85 ~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~  164 (392)
                      ... ..+++|++|||||||+|||+||++      |+|++||+|+++|||+|.+++++|+++.++++|+|..+.+...+++
T Consensus        81 ~~~-~~~~~f~~SGSEAve~AlklAr~~------tgr~~ii~~~~~yHG~t~ga~s~tg~~~~~~~~~~~~p~~~~~~~~  153 (375)
T PRK04260         81 GDK-DYLAFFCNSGAEANEAAIKLARKA------TGKQEIITFQNSFHGRTFGAMSATGQDKIKQGFGDGVPHFSYAIFN  153 (375)
T ss_pred             CCC-CCEEEECCCHHHHHHHHHHHHHHC------CCCCEEEEECCCCCCCCCHHHHHCCCCCCCCCCCCCCCCEEEECCC
T ss_conf             666-747997086789999999987654------7998699977889967440122048743345778899873452104


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             26887541012332222333222211246210123221102234572131011003444455531011124545302103
Q gi|254780432|r  165 DLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA  244 (392)
Q Consensus       165 d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g  244 (392)
                      |++.+++...+++||||+|||||++|+++||++||++||++|++||++||+|||||||||||+||++|++|++|||+|+|
T Consensus       154 d~~~~~~~~~~~iAAiiiEpiqg~~G~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~g  233 (375)
T PRK04260        154 DLNSVKALVNKNTAAVMLELVQGESGVLPADKAFVKALADYCQETGILLIVDEVQTGIGRTGKLYAFEHYGIEPDIFTLA  233 (375)
T ss_pred             CHHHHHHHHCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCHHHCCCCCCCEEEEC
T ss_conf             58899986377835999981058898757898999999999998476257301211787656865543169888789871


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEE
Q ss_conf             44444434432100011122222332234532111100123345543201222101121000026889999886797075
Q gi|254780432|r  245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFL  324 (392)
Q Consensus       245 K~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~  324 (392)
                      |+||||+|+|||++++++++.+.++.|++||+|||++||||+++|++++++++++|++++|++|+++|+++.++|| .|.
T Consensus       234 Kglg~G~P~sav~~~~~i~~~~~~~~h~~T~~gnpla~aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~~~~~~~-~i~  312 (375)
T PRK04260        234 KGLANGLPVGAMLGKSSLGGAFGYGSHGSTFGGNKLSMAAAKATLEIMLTAGFLETVLSKGNKLQEQLQEALQDKE-TVT  312 (375)
T ss_pred             HHCCCCCCEEEEEECHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCC-CEE
T ss_conf             0104886439999867874466787857779989899999999999998646999999999999999999985399-737


Q ss_pred             EECCCEEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             504640099987249989999999968989962689889955898688999999999999999
Q gi|254780432|r  325 EVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       325 ~vRG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      +|||+|||+++|++.+...+.+.++++|+++.+.+.|+|||.|||+||++|||+++++|++++
T Consensus       313 ~vRG~Gl~~gie~~~~~~~~~~~~~~~Gll~~~~g~nvi~~~Ppl~it~~eid~~~~~l~~vF  375 (375)
T PRK04260        313 TVRGLGYMIGIETTADLSQLVQAARDKGLIILTAGTNVIRLLPPLTISKAEIEKGIAILSEIF  375 (375)
T ss_pred             EEEEEEEEEEEEECCCHHHHHHHHHHCCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             630557999999578999999999968969940799989998993488999999999999869


No 21 
>PRK07678 aminotransferase; Validated
Probab=100.00  E-value=0  Score=764.43  Aligned_cols=388  Identities=28%  Similarity=0.495  Sum_probs=351.1

Q ss_pred             CCCEECCCCC----CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHH
Q ss_conf             4314515588----887489850103799679976464102267435787899999999999973145068757818999
Q gi|254780432|r    3 KNDFLFNTYD----QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI   78 (392)
Q Consensus         3 ~~~~~~~~~~----~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~   78 (392)
                      +++|+||.+.    ..|++|+||+|+||||.|||+||||.||+|+++|||+||+|++|+++|++++.+.+..+.++...+
T Consensus        14 d~~~~~h~~~~~~~~~p~vi~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~q~~~l~~~~~~~~~~~~~~   93 (451)
T PRK07678         14 DEQYVWHGMRPFNPNATMVGAKAEGCWVTDIQGKRYLDGMSGLWCVNVGYGRKELAEAAYEQLQTLSYFPLSQSHEPAIK   93 (451)
T ss_pred             HHHHCCCCCCCCCCCCCEEEEEEEECEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHH
T ss_conf             89867986766688899789960448899798899999870898634269969999999999975888677534689999


Q ss_pred             HHHHHHHHCCCC-CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             998652010133-3123565554035677766543200134786002343546565432123455321134799986433
Q gi|254780432|r   79 FANHLIHSTFAD-RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEG  157 (392)
Q Consensus        79 la~~L~~~~~~~-~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~  157 (392)
                      |+++|++..|.+ +++|+||||||||+|||+||+|+..+|.|+|++||++++||||+|.+++++|++..++..|.|..++
T Consensus        94 lae~L~~~~p~~~~vff~~SGsEAvE~AiKlAr~y~~~~g~~~r~~ii~~~~~yHG~T~ga~s~tg~~~~~~~~~p~~~~  173 (451)
T PRK07678         94 LAEKLNEWLGGEYVIFFSNSGSEANETAFKIARQYHAQKGEPHRYKFISRYRGYHGNTMGALAATGQAQRKYKYEPLAPG  173 (451)
T ss_pred             HHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHCCCHHCCCCCCCCCCC
T ss_conf             99999975797618995397389999999999999986099974243462674038972345115743105788888888


Q ss_pred             CCCCCCHH-----------------HHHHHH----HCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEEC
Q ss_conf             32221002-----------------688754----101233222233322221124621012322110223457213101
Q gi|254780432|r  158 FDQAKFCD-----------------LQSLKN----QISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFD  216 (392)
Q Consensus       158 ~~~~~~~d-----------------~~~l~~----~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~D  216 (392)
                      +.++++++                 ++.+++    ..+++|||||+||||+++|+++||++||++||++|++||++||+|
T Consensus       174 ~~~~~~p~~~r~~~~~~~~~~~~~~~~~le~~i~~~~~~~iAaii~EPi~g~gG~~~p~~~yl~~lr~lc~~~gillI~D  253 (451)
T PRK07678        174 FLHVAPPDCYRMPGIESEDIYDLECVKEIDRVMTWELSETIAAFIMEPIITGGGILMPPQDYMKAVHEICQKHGALLISD  253 (451)
T ss_pred             EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHEEECCCEEEEC
T ss_conf             15738984235776665226679999999999875078867999997537778823188798677877412459557732


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCHHHHHHHH
Q ss_conf             10034444555310111245453021034444443-443210001112222233------22345321111001233455
Q gi|254780432|r  217 EVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG------SHGSTYGGNVLAMVLGEKVL  289 (392)
Q Consensus       217 EV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~------~~~~T~~gnpl~~aaa~a~L  289 (392)
                      ||||||||||+||++|++||+|||+|+||+|+||| |+|+|+++++|++.+.+.      .|++||+|||++||+|+++|
T Consensus       254 EV~tGfGRtG~~fa~e~~gv~PDiv~~gK~l~gG~~Plsav~~~~ei~~~~~~~~~~~~~~h~~T~~gnpla~aaa~a~L  333 (451)
T PRK07678        254 EVICGFGRTGKAFGFMNYGVKPDIITMAKGITSAYLPLSATAVKKEIYEAFKGKGEYEFFRHINTFGGNPAACALALKNL  333 (451)
T ss_pred             CCCCCCCCCCCCCCHHHCCCCCCEEEECCCCCCCCCCCEEEEECHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             24027874566500110595277200133445777761677762989976357887666434788987989999999999


Q ss_pred             HHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-----------HHHHHHHHHCCEEEEEC
Q ss_conf             4320122210112100002688999988679707550464009998724998-----------99999999689899626
Q gi|254780432|r  290 NIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-----------ALLAAKFRDECLLTAPS  358 (392)
Q Consensus       290 ~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-----------~~~~~~l~~~Gll~~~~  358 (392)
                      ++++++++++|++++|++|.++|+++.++|| +|.+|||+|||++||++.+.           ..+...++++|+++.+.
T Consensus       334 ~~l~~~~l~~~~~~~g~~l~~~L~~~~~~~p-~i~dVRG~GLm~gielv~d~~~~~p~~~~~~~~i~~~~~~~Glli~~~  412 (451)
T PRK07678        334 EIMENENLIERSAQLGSLLLEQLKEELGEHP-LVGDIRGKGLLVGIELVNDKETKEPADNDKVASVVNACKEKGLIIGKN  412 (451)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEEECCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCEEECC
T ss_conf             9984150999999999999999999974599-888876165689999853665578799999999999999779888147


Q ss_pred             C------CCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             8------98899558986889999999999999999852
Q gi|254780432|r  359 S------DNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       359 ~------~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +      +|+|||.|||+||++|||+++++|+++|.+|.
T Consensus       413 g~~~~~~~n~lr~~PPL~it~~eid~~~~~l~~al~~v~  451 (451)
T PRK07678        413 GMTVAGYNNVLTLAPPLCISSEELAFVVGTLKTAMERIK  451 (451)
T ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             873257899899978824889999999999999999639


No 22 
>PRK07482 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=763.52  Aligned_cols=388  Identities=22%  Similarity=0.383  Sum_probs=345.5

Q ss_pred             CCCEECCCCCC---------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC--CC
Q ss_conf             43145155888---------87489850103799679976464102267435787899999999999973145068--75
Q gi|254780432|r    3 KNDFLFNTYDQ---------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN--LY   71 (392)
Q Consensus         3 ~~~~~~~~~~~---------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~--~~   71 (392)
                      +++|+||.+.+         .|++|+||+|+||||.|||+||||++|+|++++||+||+|++|+++|++++.+.+.  .+
T Consensus        12 d~~~~whp~~~~~~~~~~~~p~~vi~~a~G~~l~D~dG~~ylD~~~g~~~~~lGH~~p~v~~Ai~~Q~~~l~~~~~~~~~   91 (461)
T PRK07482         12 DRDHFFHPSTHLGDHARGELPGRIVAGGEGIRITDHQGRRYIDAFAGLYCVNVGYGRTEVAEAIAEQAKELAYYHTYVGH   91 (461)
T ss_pred             HHHHCCCCCCCCHHHHCCCCCCEEEEEEEEEEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             88644488877022431578985899642468997999999996635886425769499999999999658761146775


Q ss_pred             CCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78189999986520101--3331235655540356777665432001347860023435465654321234553211347
Q gi|254780432|r   72 QSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLE  149 (392)
Q Consensus        72 ~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~  149 (392)
                      .++...+||++|++..|  ++||+|+||||||||+|||+||+|+...|+|+|++||+|++||||+|++++|+++.+.++.
T Consensus        92 ~~~~~~~lAe~L~~~~p~~l~~v~f~~SGSEAvE~AiKlAr~y~~~~g~~~r~~Iis~~~syHG~T~~a~s~tg~~~~~~  171 (461)
T PRK07482         92 GTEASIELSKRIIDRAPAGMSKVYYGLSGSDANETQIKLVWYYNNVLGRPEKKKIISRWRGYHGSGIVTGSLTGLSLFHQ  171 (461)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
T ss_conf             68899999999997578886879961866999999999999998861887654599961785567531300246633346


Q ss_pred             CCCCCCCCCCCCCCH------------------HHHHHHHH----CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCC
Q ss_conf             999864333222100------------------26887541----01233222233322221124621012322110223
Q gi|254780432|r  150 GFGPKIEGFDQAKFC------------------DLQSLKNQ----ISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICD  207 (392)
Q Consensus       150 ~~~p~~~~~~~~~~~------------------d~~~l~~~----~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~  207 (392)
                      .|++..+++.+.+.+                  .++.+++.    .+++|||||+|||||++|+++||++||++||++|+
T Consensus       172 ~~~~~~~~~~~~~~P~~~~~~~~~~~~~~~~~~~~~~le~~i~~~~~~~iAAvI~EPi~g~gG~~~p~~~yl~~lr~lc~  251 (461)
T PRK07482        172 HFDLPIDRVLHTEAPHYYRRADAGMSEEQFSAYCADELEELILAEGPDTIAAFIGEPVLGTGGIVPPPAGYWEAIQAVLK  251 (461)
T ss_pred             CCCCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             66799878322468854567886633777789999999999985098848999805635768855188789799999962


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC-------CCCCCCCCCC
Q ss_conf             45721310110034444555310111245453021034444443-443210001112222233-------2234532111
Q gi|254780432|r  208 DIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG-------SHGSTYGGNV  279 (392)
Q Consensus       208 ~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~-------~~~~T~~gnp  279 (392)
                      +||++||+|||||||||||+||++|++||+|||+|+||+|+||| |+|++++++++++.+..+       .|++||+|||
T Consensus       252 ~~gilLI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gKgl~gG~~Pl~av~~~~~i~~~~~~~~~~~~~~~h~~T~~GnP  331 (461)
T PRK07482        252 KYDILLIADEVVTGFGRLGSMFGSQHYGIEPDLITIAKGLTSAYAPLSGSIVGEKVWDVLEQGSDEHGAMGHGWTYSGHP  331 (461)
T ss_pred             CCCCEEEECCCEECCCCCCCCCHHCCCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCH
T ss_conf             45963771544324750358411116899997776324445776762799856889987632654466640156899998


Q ss_pred             CCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------------HHHHH
Q ss_conf             10012334554320122210112100002688999988679707550464009998724998-------------99999
Q gi|254780432|r  280 LAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------------ALLAA  346 (392)
Q Consensus       280 l~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------------~~~~~  346 (392)
                      ++||||+++|++++++++++|++++|++|+++|+++.++|| +|.+|||+|||+++|++.+.             ..+.+
T Consensus       332 lacAaa~a~L~~l~~~~l~~~~~~~G~~l~~~L~~~~~~~p-~v~~VRG~GL~~gvelv~~~~~~~~~~~~~~~~~~i~~  410 (461)
T PRK07482        332 ICAAAALANLDILERENLVGNAGEVGAYFRAQLRAAFGGHP-LVGEVRGVGMLAAVEFVADRDDRTFFDPALKIGPQVSA  410 (461)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEEECCEEEEEEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999999983062999999999999999999985499-87888806758999995056546666745799999999


Q ss_pred             HHHHCCEEEEEC-CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             999689899626-898899558986889999999999999999852
Q gi|254780432|r  347 KFRDECLLTAPS-SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       347 ~l~~~Gll~~~~-~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      .++++|+++... .+|+|||.|||+||++|||+++++|+++|.+|+
T Consensus       411 ~~~~~Gll~~~~~~g~vl~~~PPL~Is~~eid~~~~~l~~al~~v~  456 (461)
T PRK07482        411 AALERGVIARAMPHGDILGFAPPLVLTRAEADEIVAIAAKAVDEVA  456 (461)
T ss_pred             HHHHCCCEEEECCCCCEEEEECCEECCHHHHHHHHHHHHHHHHHHH
T ss_conf             9997898896059999899979940889999999999999999999


No 23 
>PRK06541 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=765.29  Aligned_cols=387  Identities=27%  Similarity=0.480  Sum_probs=350.5

Q ss_pred             CCCEECCCCCC-------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCH
Q ss_conf             43145155888-------87489850103799679976464102267435787899999999999973145068-75781
Q gi|254780432|r    3 KNDFLFNTYDQ-------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQST   74 (392)
Q Consensus         3 ~~~~~~~~~~~-------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~   74 (392)
                      +.+|+||.|.+       .|++|+||+|+||||.|||+||||++|+++++|||+||+|.+|+++|++++.+.+. .|.++
T Consensus        16 d~~~~w~p~~~~~~~~~~~p~vi~rg~G~~l~D~dG~~ylD~~~g~~~~~lGH~hp~v~~Ai~~Q~~~l~~~~~~~~~~~   95 (460)
T PRK06541         16 AKRHLWMHFTRHGAYRGIALPVIVRGEGVYIWDDRGKRYLDGLAGLFVVQVGHGRAELAEAAAEQAGTLAFFPLWSYAHP   95 (460)
T ss_pred             HHHHCCCCCCCCCCCCCCCCCEEEECCCCEEEECCCCEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCH
T ss_conf             99754889898522146899669966149899699999999651487531178989999999999975787567755787


Q ss_pred             HHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999986520101--3331235655540356777665432001347860023435465654321234553211347999
Q gi|254780432|r   75 QQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFG  152 (392)
Q Consensus        75 ~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~  152 (392)
                      ...+|+++|++..|  +++|+|+||||||||+|||+||+|+...|+|+|++||+|+++|||+|.+++|+|+.+.++++|+
T Consensus        96 ~~~~lae~L~~~~p~~l~~v~f~~SGsEA~E~AiklAr~y~~~~G~~~r~~iis~~~~yHG~t~ga~s~tg~~~~~~~~~  175 (460)
T PRK06541         96 PAIELAERLAALAPGDLNRVFFTTGGSEAVESAWKLAKQYFKLTGKPGKHKVISRAIAYHGTTQGALAITGLPAFKAPFE  175 (460)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHHHCCCHHHCCCCC
T ss_conf             99999999997488886989970874899999999999999961999861899966871678657887518800037887


Q ss_pred             CCCCCCCCCCCHH------------------HHHHHHH----CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             8643332221002------------------6887541----01233222233322221124621012322110223457
Q gi|254780432|r  153 PKIEGFDQAKFCD------------------LQSLKNQ----ISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDID  210 (392)
Q Consensus       153 p~~~~~~~~~~~d------------------~~~l~~~----~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g  210 (392)
                      |..+++.++|+++                  ++.+++.    .+++|||||+|||||++|+++||++||+.||++|++||
T Consensus       176 p~~~g~~~vp~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~iAavI~EPi~g~gG~~~~~~~fl~~lr~lc~~~g  255 (460)
T PRK06541        176 PLTPGGFRVPNTNFYRAPEHGDDPEAFGRWAADRIEEAIEFEGPDTVAAVFLEPVQNAGGCFPPPPGYFERVREICDRYD  255 (460)
T ss_pred             CCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             88999167688864457767899889999999999999985199857899845777878865686899999999746479


Q ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCHHHH
Q ss_conf             21310110034444555310111245453021034444443-443210001112222233----2234532111100123
Q gi|254780432|r  211 ALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG----SHGSTYGGNVLAMVLG  285 (392)
Q Consensus       211 ~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~----~~~~T~~gnpl~~aaa  285 (392)
                      ++||+|||||||||||+||++|++||+|||+|+||+|+||| |+||++++++|++.+.++    .|++||+|||++|+||
T Consensus       256 illI~DEVqtGfGRtG~~fa~e~~gv~PDiv~~gKglg~G~~Pl~av~~~~~i~~~~~~~~~~~~hg~T~~gnpla~aaa  335 (460)
T PRK06541        256 VLLVSDEVICAFGRLGEMFGCERFGYVPDIITCAKGITSGYSPLGAMIASDRLVEPFLDGKTMFLHGYTFGGHPVSAAVA  335 (460)
T ss_pred             CEEECCCCEECCCCCCCCCHHCCCCCCCCHHHHHHHCCCCCCCCEEEECCHHHHHHHCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             53766751207865337322016894895141223125887770467403999876526885313576788898999999


Q ss_pred             HHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------------HHHHHHHH
Q ss_conf             34554320122210112100002688999988679707550464009998724998----------------99999999
Q gi|254780432|r  286 EKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------------ALLAAKFR  349 (392)
Q Consensus       286 ~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------------~~~~~~l~  349 (392)
                      +++|++|+++++++|++++|++|+++|++|.+ || +|.+|||+|||++||++.+.                ..+.+.++
T Consensus       336 ~avL~~i~~~~l~~~v~~~G~~l~~~L~~l~~-~p-~v~dVRG~GL~~giElv~d~~~~~~~~~~~~~~~~~~~l~~~~~  413 (460)
T PRK06541        336 LANLDIFEREGLLDHVRDNEPAFRATLEKLLD-LP-IVGDVRGDGYFYGIELVKDKATKETFTDDESERLLRGFLSPALF  413 (460)
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC-CC-CEEEEECCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999998657999999999999999999746-99-77874107738999954576545667646778999999999999


Q ss_pred             HCCEEEEEC--CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             689899626--898899558986889999999999999999852
Q gi|254780432|r  350 DECLLTAPS--SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       350 ~~Gll~~~~--~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      ++|+++.+.  ++|+|||.|||+||++|||+++++|+++|.|+.
T Consensus       414 ~~Gl~~~~~~~~~~virl~PPL~it~~eid~~l~~l~~aL~e~~  457 (460)
T PRK06541        414 EAGLYCRADDRGDPVVQLAPPLISGQEEFDEIEAILRSVLTEAW  457 (460)
T ss_pred             HCCEEEEECCCCCCEEEEECCEECCHHHHHHHHHHHHHHHHHHH
T ss_conf             78959974589998899978933789999999999999999999


No 24 
>PRK06148 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=764.18  Aligned_cols=376  Identities=27%  Similarity=0.462  Sum_probs=333.1

Q ss_pred             CEECCC---CCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             145155---88887489850103799679976464102267435787899999999999973145068757818999998
Q gi|254780432|r    5 DFLFNT---YDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFAN   81 (392)
Q Consensus         5 ~~~~~~---~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~   81 (392)
                      +++.++   ||..|+.|+||+|+||||.+||+|||++||  +.++||+||+|++|+++|++++ ++++.|.++...+|||
T Consensus       596 ~~~~~~~~~~y~~Pi~ivRGeG~yL~D~~Gr~YLD~~~n--V~~vGH~hP~v~~ai~~Q~~~L-~t~t~y~~~~~~~lAe  672 (1015)
T PRK06148        596 ELLLPNLSISYSDPIKFVRGDGVWLIDNRGRAYLDCFNN--VCHVGHAHPRVVEAAARQAARL-NTNTRYLHDAIVAYAE  672 (1015)
T ss_pred             HHCCCCCCCCCCCCCEEEECCEEEEECCCCCEEEECCCC--CCCCCCCCHHHHHHHHHHHHHH-CCCCCCCCCHHHHHHH
T ss_conf             861754112478997687603537996899877761467--5543557989999999999762-4266656836999999


Q ss_pred             HHHHHC--CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             652010--1333123565554035677766543200134786002343546565432123455321134799986433--
Q gi|254780432|r   82 HLIHST--FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEG--  157 (392)
Q Consensus        82 ~L~~~~--~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~--  157 (392)
                      +|++..  ++++|||+||||||||+||||||+|      |||+.||++++||||+|.+++++|+....++...+.++.  
T Consensus       673 rL~~~~P~~l~~vfF~NSGSEAnE~AiKlAr~~------tgr~~iI~~~~aYHG~T~gals~s~~~~~~~~g~~~~~~v~  746 (1015)
T PRK06148        673 RLTATLPEGLTVASFVNSGSEANSLALRLARAH------TGARDAIVLDWAYHGTTQELIDLSPYKFKRKGGKGRPDHVE  746 (1015)
T ss_pred             HHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHH------HCCCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCCCCCCEE
T ss_conf             999847777655763077388999999999986------08997488603556863667763677455677889998537


Q ss_pred             ------CCCCCCH----H-----HHHHHHH------CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEEC
Q ss_conf             ------3222100----2-----6887541------01233222233322221124621012322110223457213101
Q gi|254780432|r  158 ------FDQAKFC----D-----LQSLKNQ------ISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFD  216 (392)
Q Consensus       158 ------~~~~~~~----d-----~~~l~~~------~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~D  216 (392)
                            ..+.+++    +     .+.+++.      ..+.+||||+|||||+||+++||++||+++|++|++||+++|+|
T Consensus       747 ~~~~P~~yr~~~~~~~~~~~~~~~~~~~~~i~~l~~~~~~~Aa~I~EpIqg~gG~~~~p~gyl~~v~~~c~~~G~LlI~D  826 (1015)
T PRK06148        747 EAEVPDSYRAPERWPDAEHGRRFAESVAEQIAAMRAQGRAPAFFIAESIPSVAGQVFLPEGYLREVYAMVRAAGGVCIAD  826 (1015)
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             78899765677789816789999999999999987158815899978833788840798899999999999839789995


Q ss_pred             CCCCCCCCCCC-CCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             10034444555-310111245453021034444443443210001112222233-2234532111100123345543201
Q gi|254780432|r  217 EVQTGYGRTGK-LFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQG-SHGSTYGGNVLAMVLGEKVLNIIQS  294 (392)
Q Consensus       217 EV~tG~GRtG~-~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~-~~~~T~~gnpl~~aaa~a~L~~l~~  294 (392)
                      ||||||||||+ ||+||++||+|||+|+||+||||||+|||+++++|++.+.++ .|++||+|||++||||+++|++|++
T Consensus       827 EVQtGfGRTG~~~fa~e~~gV~PDIvt~aKglg~G~PlgAv~~~~ei~~~f~~g~~~~sTfgGnPlacAaalavLdii~~  906 (1015)
T PRK06148        827 EVQVGFGRVGSHWWAFETQGVVPDIVTMGKPIGNGHPMSAVVTTREIADSFDNGMEYFNTFGGNPVSCAIGLAVLDIIED  906 (1015)
T ss_pred             CCCCCCCCCCCCCCEEHHCCCCCCEEEECCCCCCCCCCEEEEECHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             45338782366300003129988879865644478676788985999975426875268878699999999999999987


Q ss_pred             CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEECC--CCE
Q ss_conf             22210112100002688999988679707550464009998724998----------999999996898996268--988
Q gi|254780432|r  295 DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLLTAPSS--DNV  362 (392)
Q Consensus       295 ~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~Gll~~~~~--~~~  362 (392)
                      ++|++|++++|++|+++|++++++|| +|.+|||.|||+|||++.++          ..++..|+++||++...|  +|+
T Consensus       907 e~L~~na~~~G~~l~~~L~~L~~~~p-~IgdVRG~GLm~GiElV~d~~tk~Pa~~~~~~v~~~~~e~GvLi~~~G~~~nV  985 (1015)
T PRK06148        907 EDLRRNALEIGNYLLAGFRSLQQRFD-IIGDVRGLGLFLGIELVTDRKTKAPATAIARKVKDGARERGILIGTEGPKDNV  985 (1015)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEECCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCEEEECCCCCCCE
T ss_conf             37999999999999999999886089-68876127708999963587778963999999999999789189327899887


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9955898688999999999999999985
Q gi|254780432|r  363 VRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       363 irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      ||+.|||+||++++|.++++|+++|.+.
T Consensus       986 lri~PPL~it~e~~D~~l~~Ld~vl~a~ 1013 (1015)
T PRK06148        986 LKMRPPMIFSRADADHLLEVLDDSFAAA 1013 (1015)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9980896455999999999999999997


No 25 
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=761.98  Aligned_cols=373  Identities=34%  Similarity=0.598  Sum_probs=349.1

Q ss_pred             EEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCC
Q ss_conf             4898501037996799764641022674357878999999999999731450687578189999986520101--33312
Q gi|254780432|r   16 IRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVF   93 (392)
Q Consensus        16 ~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~   93 (392)
                      +.|..+-|+||+|.|||+||||.||+|++++||+||+|++|+++|++++.+.+..+.++.+++||++|++..|  +++||
T Consensus        75 ~~~~~~~~~~L~D~~G~rYLD~~sG~~~~~lGH~~P~I~eAv~~Ql~~~~~~s~~~~~p~~~~LAe~L~~~~P~~l~~vF  154 (468)
T PRK11522         75 VEWQAGGLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTPGKLKYSF  154 (468)
T ss_pred             EEEECCCCCEEEECCCCEEEECCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             99965987879969999877745769971267799899999999985357512772766999999999974888889797


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHC
Q ss_conf             35655540356777665432001347860023435465654321234553211347999864333222100268875410
Q gi|254780432|r   94 FTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI  173 (392)
Q Consensus        94 f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~  173 (392)
                      |+||||||||+|||+||+|+..   +||++||++++||||+|++++|+|+++.++.+|.|..+++.++||+|++++++.+
T Consensus       155 F~nSGSEAvE~AiKlAr~y~~~---~Gr~~IIs~~~sYHG~T~galS~tg~~~~~~~f~pl~p~~~~vp~~d~~~~~~~~  231 (468)
T PRK11522        155 FCNSGTESVEAALKLAKAYQSP---RGKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTAL  231 (468)
T ss_pred             ECCCCHHHHHHHHHHHHHHHHH---HCCCEEEEECCCCCCCCCHHHEECCCHHCCCCCCCCCCCCEECCCCCHHHHHHHH
T ss_conf             3797289999999999997774---0991899971786776422203127621025777899984563789999999999


Q ss_pred             ------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             ------12332222333222211246210123221102234572131011003444455531011124545302103444
Q gi|254780432|r  174 ------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGM  247 (392)
Q Consensus       174 ------~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l  247 (392)
                            .++|||||+|||||+||+++||++||++||++|++||++||+|||||||||||+||++|++||+|||+|+||+|
T Consensus       232 ~~~~~~~~~vAAvIvEPIqG~gGv~~pp~~yl~~lr~lc~~~giLLI~DEVqTGfGRTG~~fa~e~~gV~PDivt~aKgL  311 (468)
T PRK11522        232 SECKKTGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKAL  311 (468)
T ss_pred             HHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCEEECCCCCCCEEEECCCC
T ss_conf             98651489689999977767789826998999999998753807882264122788657851452367898889961555


Q ss_pred             CCCC-CCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEE
Q ss_conf             4443-443210001112222--2332234532111100123345543201222101121000026889999886797075
Q gi|254780432|r  248 GGGF-PIGACLATNEVAACM--NQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFL  324 (392)
Q Consensus       248 ~gG~-P~sav~~~~~i~~~~--~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~  324 (392)
                      |||| |+||++++++|++.+  .+..|++||+|||++||||+++|++++++++++|++++|++|+++|+++.++||++|.
T Consensus       312 ggG~~Pigav~~~~~i~~~~~~~~~~hg~Tf~GnPlacAaala~L~ii~~e~l~~~a~~~G~~L~~~L~~l~~~~p~~i~  391 (468)
T PRK11522        312 GGGVMPIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPDLVQ  391 (468)
T ss_pred             CCCCCCEEEEEECHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             57877505897629999998517774466767997999999999999986459999999999999999999876867112


Q ss_pred             EECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEEC--CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             5046400999872499--899999999689899626--898899558986889999999999999999852
Q gi|254780432|r  325 EVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPS--SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       325 ~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~--~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +|||+|||+|+|++.+  ...+.+.++++|+++.+.  ++++|||.|||+||++|||+++++|+++|.+|.
T Consensus       392 dVRG~GLm~giel~~~~~~~~v~~~~~~~Gvlv~~~~~~~~~lr~~PPL~It~eeid~~l~~l~~aL~~l~  462 (468)
T PRK11522        392 EARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLTLTIEQCEQVIKAARKALAAMR  462 (468)
T ss_pred             EEEECCEEEEEEECCCCHHHHHHHHHHHCCEEEEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             51003169999957850089999999978919987489998899959965799999999999999999997


No 26 
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
Probab=100.00  E-value=0  Score=764.10  Aligned_cols=385  Identities=27%  Similarity=0.449  Sum_probs=345.8

Q ss_pred             CCCEECCCCCC-------CCEE-EEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCC
Q ss_conf             43145155888-------8748-985010379967997646410226743578789999999999997314506-87578
Q gi|254780432|r    3 KNDFLFNTYDQ-------SDIR-FEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQS   73 (392)
Q Consensus         3 ~~~~~~~~~~~-------~p~~-i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~   73 (392)
                      +.+|+||.|.+       .|++ |+||+|+||||.|||+|||++||+|++++||+||+|.+|+++|++++.++. ..+.+
T Consensus        27 D~~~~wHP~t~~~~~~~~~p~i~I~rgeG~~l~D~dG~~yLD~~sg~~~~~lGh~~p~i~~Ai~~Q~~~l~~~~~~~~~~  106 (472)
T PRK08742         27 DLAVVWHPCTQMREHPHTLPLVPIARGEGAWLVGHDGRRYLDAVSSWWTNLFGHAEPRIGAAIAAQAGELEQVMLAGFTH  106 (472)
T ss_pred             HHHHCCCCCCCCCCCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             89773688888200134599713897145889979999998866448964755798999999999997666601377677


Q ss_pred             HHHHHHHHHHHHHCC-------CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             189999986520101-------3331235655540356777665432001347860023435465654321234553211
Q gi|254780432|r   74 TQQEIFANHLIHSTF-------ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQ  146 (392)
Q Consensus        74 ~~~~~la~~L~~~~~-------~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~  146 (392)
                      +...+|+++|++..|       ++||+|+||||||||+|||+||+|+..+|.|+|++||+++++|||+|++++|+++.+.
T Consensus       107 ~~~~~Lae~L~~~~P~~~~~~~l~~Vff~~SGSEAvE~AiKlA~~y~~~rg~~~r~~ii~~~~~YHG~T~ga~s~~~~~~  186 (472)
T PRK08742        107 EPAVQLAERLLAIAPRQPGRAPLSKVFYADNGSAGVEVALKMAFHYFHNRGEHRRTRFIALENGYHGETIGALSVGDIPL  186 (472)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHCCCCC
T ss_conf             18999999999857344566776879971866899999999999999953998771587305878887276565158832


Q ss_pred             CCCCCCCCCCCCCCCCCHH-----------------HHHHH---HHCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHCC
Q ss_conf             3479998643332221002-----------------68875---41012332222333-222211246210123221102
Q gi|254780432|r  147 YLEGFGPKIEGFDQAKFCD-----------------LQSLK---NQISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKI  205 (392)
Q Consensus       147 ~~~~~~p~~~~~~~~~~~d-----------------~~~l~---~~~~~~iAavi~Ep-v~g~~G~~~~~~~~l~~l~~l  205 (392)
                      +++.|+|..++..+.|+++                 .+.++   +..+++|||||+|| +||+||+++||++||+++|++
T Consensus       187 ~~~~~~~~~~~~~~~p~p~~~~~~~~~~~~~~~~~~~~~le~~~~~~~~~iAA~IiEPviqg~GG~~~p~~~yl~~lr~l  266 (472)
T PRK08742        187 YRRVYAPLLLESLFAPSPDAYLAEPGQSAEDYALQAADALQALFEQSPGEICALILEPRVQCAGGMRMHHPAYLRRAREL  266 (472)
T ss_pred             CCCCCCCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCEECCCHHHHHHHHHH
T ss_conf             25677787888456589975346788877899999899999999857886479997157665387056899999999999


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCC------CCCCCCCCCC
Q ss_conf             2345721310110034444555310111245453021034444443-44321000111222223------3223453211
Q gi|254780432|r  206 CDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQ------GSHGSTYGGN  278 (392)
Q Consensus       206 c~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~------~~~~~T~~gn  278 (392)
                      |++||+|||+|||||||||||+||++|++||+|||+|+||+||||| |+|||+++++|++.+.+      ..|++||+||
T Consensus       267 c~~~giLLI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~aKgltgGy~Plsav~~~~eI~~~~~~~~~~~~~~hg~Ty~Gn  346 (472)
T PRK08742        267 CDAHGAFLIADEIATGFGRTGTLFACEQAGVMPDLLCLSKGLTGGFLPLSAVLATQQLYDAFLDDSRERAFLHSHSYTGN  346 (472)
T ss_pred             HHHHCCEEEECCCCCCCCCCCCCEEECCCCCCCCEEEECHHHCCCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             88729668840330168713445231246779972012121038877707898769999765147766651357899999


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------------HHHH
Q ss_conf             110012334554320122210112100002688999988679707550464009998724998-------------9999
Q gi|254780432|r  279 VLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------------ALLA  345 (392)
Q Consensus       279 pl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------------~~~~  345 (392)
                      |++||||+++|++|+++++++|++.+|++|.+.++.+. +|| .|.+|||+|||+++|++.+.             ..+.
T Consensus       347 PlacAaala~L~i~~~e~l~~~~~~~g~~l~~~~~~l~-~~p-~V~dVRg~GL~~gvElv~d~~~~~~~~~~~~~~~~~~  424 (472)
T PRK08742        347 PLACAAALATLDIFADDDVIARNQPIAARMTQLAAQIG-EHP-AVADVRQAGMIVAFELTRGGNKRTPFPPAARVGLHAY  424 (472)
T ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC-CCC-CEEEECCCCEEEEEEECCCCCCCCCCCHHHHHHHHHH
T ss_conf             89999999999999865599999999999999999615-899-7898426864999997158765787877789999999


Q ss_pred             HHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999968989962689889955898688999999999999999985
Q gi|254780432|r  346 AKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       346 ~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +.++++|+++++.+ |+|+|.|||+||++|||+++++|++++.+.
T Consensus       425 ~~~~~~Gll~r~~G-~~i~~~PPL~it~~eid~~~~~l~~al~ea  468 (472)
T PRK08742        425 RAALARGVVLRPLG-DVLYWMPPYCVDEAQLALLADTTRHAIDEA  468 (472)
T ss_pred             HHHHHCCCEEEECC-CEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             99997894898549-999997994068999999999999999999


No 27 
>PRK07481 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=761.93  Aligned_cols=387  Identities=28%  Similarity=0.502  Sum_probs=351.3

Q ss_pred             CCCEECCCCC-------CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC--CCCC
Q ss_conf             4314515588-------887489850103799679976464102267435787899999999999973145068--7578
Q gi|254780432|r    3 KNDFLFNTYD-------QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN--LYQS   73 (392)
Q Consensus         3 ~~~~~~~~~~-------~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~--~~~~   73 (392)
                      +++|+||.|.       +.|++|+||+|+||||.|||+||||++|+|++++||+||+|.+|+++|++++.+.+.  .+.+
T Consensus         6 d~~~~whp~~~~~~~~~~~Pi~i~~g~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~~~~~~~~~~~~~   85 (448)
T PRK07481          6 NARRFWHPMAHPAEMKARPPIIIVRGDGCYVYDIDGKKLLDGVGGLWNVNVGHNREEVKEAIVRQLDELEYYSTFDGTTH   85 (448)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             54123289988442357899589971518899698899999543588633257979999999999965677136664468


Q ss_pred             HHHHHHHHHHHHHC---CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             18999998652010---133312356555403567776654320013478600234354656543212345532113479
Q gi|254780432|r   74 TQQEIFANHLIHST---FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEG  150 (392)
Q Consensus        74 ~~~~~la~~L~~~~---~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~  150 (392)
                      +...+|+++|++..   +++||+|+||||||||+|||+||+|+...|+|+|++||+|+++|||+|++++++|++..++++
T Consensus        86 ~~~~~la~~L~~~~~p~~~~rv~f~~SGseA~E~AiKlAr~y~~~~g~~~r~~Ii~~~~syHG~t~g~~s~sg~~~~~~~  165 (448)
T PRK07481         86 PRAIELSYKLIDMFEPEGMRRVFFSSGGSDSVETALKLARQYWKVRGQPERTKFISLKQGYHGTHFGGASVNGNTVFRRN  165 (448)
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCC
T ss_conf             89999999999851877878899749779999999999999999718988636996368637766221214688434468


Q ss_pred             CCCCCCCCCCCCC--------HH---------HHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCC
Q ss_conf             9986433322210--------02---------68875410----123322223332222112462101232211022345
Q gi|254780432|r  151 FGPKIEGFDQAKF--------CD---------LQSLKNQI----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDI  209 (392)
Q Consensus       151 ~~p~~~~~~~~~~--------~d---------~~~l~~~~----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~  209 (392)
                      |+|..+++.+++.        ++         .+.+++.+    +++|||||+|||||++|+++||++||++||++|++|
T Consensus       166 ~~~~~~~~~~~~~p~~~~~p~~~~~~~~~~~~~~~le~~i~~~~~~~iAavi~EPiqg~gG~~~p~~~yl~~lr~lc~~~  245 (448)
T PRK07481        166 YEPLLPGCFHVETPWLYRNPFTQDPEELGRLCARLLEREIAFQGPDTIAAFIAEPVQGAGGVIVPPANYWPLVREVCDRH  245 (448)
T ss_pred             CCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCEECCCHHHHHHHHHHHHHC
T ss_conf             88999982782687522377789989999999999999987418884799996046667971459999999999999977


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC-------CCCCCCCCCCCC
Q ss_conf             721310110034444555310111245453021034444443-443210001112222233-------223453211110
Q gi|254780432|r  210 DALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG-------SHGSTYGGNVLA  281 (392)
Q Consensus       210 g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~-------~~~~T~~gnpl~  281 (392)
                      |++||+|||||||||||+||++|++||+|||+|+||+||||| |+||+++++++++.+.+.       .|++||+|||++
T Consensus       246 gillI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gK~lggG~~Plsa~~~~~~i~~~~~~~~~~~~~~~hg~T~~gnpla  325 (448)
T PRK07481        246 GILLIADEVVTGFGRTGSWFGSRGWGVKPDIMCLAKGISSGYVPLGATMVNARIEDAFEANADFGGAIMHGYTYSGHPVA  325 (448)
T ss_pred             CEEEEEEECCCCCCCCCCHHHHHCCCCCCCEEEECCCCCCCCCCCCHHHCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             92799951453888476325765689999710012243589776421115689999765688766521006677889799


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC-------------HHHHHHHH
Q ss_conf             01233455432012221011210000268899998867970755046400999872499-------------89999999
Q gi|254780432|r  282 MVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS-------------PALLAAKF  348 (392)
Q Consensus       282 ~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~-------------~~~~~~~l  348 (392)
                      ||||+++|++++++++++|++++|++|+++|++++++|| ++.+|||+|+|+++|++.+             ...+...+
T Consensus       326 ~aaala~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~-~i~~VRG~Glm~~ielv~d~~~~~~~~~~~~~~~~v~~~~  404 (448)
T PRK07481        326 CAAALASLDIVVREDLPANAAKRGAYLLEGLQPLVERFE-LVGDVRGKGLMVALDLVADKATRAPIDPSKGYANAVADVA  404 (448)
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEECCEEEEEEEEECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             999999999997556999999999999999999998489-8467552249999999606655676771279999999999


Q ss_pred             HHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             9689899626898899558986889999999999999999852
Q gi|254780432|r  349 RDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       349 ~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +++|+++.+.+ |.++|.|||+||++|||+++++|+++|.+|.
T Consensus       405 ~~~Gll~~~~g-~~i~~~PpL~it~~eid~~l~~l~~al~~v~  446 (448)
T PRK07481        405 RENGVLVRPSG-TKIILSPPLVIQREDVDRIVDALDAGFAAVP  446 (448)
T ss_pred             HHCCEEEEECC-CEEEEECCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             96994997249-9899989978899999999999999999753


No 28 
>PRK06105 aminotransferase; Provisional
Probab=100.00  E-value=0  Score=760.88  Aligned_cols=386  Identities=26%  Similarity=0.428  Sum_probs=346.8

Q ss_pred             CCCEECCCCCC-------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC--CCCCC
Q ss_conf             43145155888-------8748985010379967997646410226743578789999999999997314506--87578
Q gi|254780432|r    3 KNDFLFNTYDQ-------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS--NLYQS   73 (392)
Q Consensus         3 ~~~~~~~~~~~-------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~--~~~~~   73 (392)
                      +++|+||.|.+       .|++|+||+|+|+||.|||+||||+||+|++++||+||+|++|+++|++++++.+  ..+.+
T Consensus        12 d~~~~whp~~~~~~~~~~~P~vi~rg~G~~l~D~dG~~ylD~~sg~~~~~lGh~hp~i~~Ai~~Q~~~~~~~~~~~~~~~   91 (460)
T PRK06105         12 DIAYQLHPYTNARRHEEVGPLVIERGEGVYVYDDAGKRYIEGMAGLWSVAVGFSEQRLVEAAARQMKKLPFYHTFSHKSH   91 (460)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHCCCCCCCHHHHHHHHHHHHHCCCEECCCCCCC
T ss_conf             88613289888331367899679960418899799999999762387510267999999999999965786012587678


Q ss_pred             HHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             189999986520101--333123565554035677766543200134786002343546565432123455321134799
Q gi|254780432|r   74 TQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGF  151 (392)
Q Consensus        74 ~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~  151 (392)
                      +...+||++|++..|  ++||+|++|||||||+|||+||+|+..+|.|+|++||+|++||||+|++++|+|+.+..++.|
T Consensus        92 ~~~~~lAe~L~~~~p~~l~~v~f~~sGSEAvE~AlKlA~~y~~a~g~~~r~~iis~~~syHG~T~ga~s~tg~~~~~~~~  171 (460)
T PRK06105         92 GPVIDLAEKLVAMAPVPMSKVFFTNSGSEANDTVVKLIWYYNNALGRPEKKKIISRKRGYHGVTIASASLTGLPNNHRSF  171 (460)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHCCCCCCCCCC
T ss_conf             89999999999737888487998377088999999999999996389886369972376366504455420895335566


Q ss_pred             CCCCCCCCCCCCHH------------------HHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCC
Q ss_conf             98643332221002------------------68875410----123322223332222112462101232211022345
Q gi|254780432|r  152 GPKIEGFDQAKFCD------------------LQSLKNQI----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDI  209 (392)
Q Consensus       152 ~p~~~~~~~~~~~d------------------~~~l~~~~----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~  209 (392)
                      ++..+++.+.++++                  ++.+++.+    +++|||||+|||||++|+++||++||+++|++||+|
T Consensus       172 ~~~~~~~~~~~~P~~~r~~~~~~~~~~~~~~~~~~le~~i~~~~~~~iAavIvEPiqg~gG~~~~p~~yl~~lr~lc~~~  251 (460)
T PRK06105        172 DLPIDRILHTGCPHYYRFGLPGESEEAFATRLANELEALILAEGPDTIAAFIGEPVMGAGGVIVPPKTYWEKIQAVLRKY  251 (460)
T ss_pred             CCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             89988804467884346688887889999999999999998519885679983672488887269868989999999856


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCC
Q ss_conf             721310110034444555310111245453021034444443-44321000111222223-------3223453211110
Q gi|254780432|r  210 DALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQ-------GSHGSTYGGNVLA  281 (392)
Q Consensus       210 g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~-------~~~~~T~~gnpl~  281 (392)
                      |++||+|||||||||||+||++|++||+|||+|+||+||||| |+||+++++++++.+.+       ..|++||+|||++
T Consensus       252 gillI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gKglggG~~Pl~av~~~~~i~~~~~~~~~~~~~~~hg~T~~gnpla  331 (460)
T PRK06105        252 DILLVADEVICGFGRTGNMFGCETFGIKPDILVLSKQLTSSYQPLSAVLINERVYDPIADESGKIGTFGHGFTASGHPVA  331 (460)
T ss_pred             CCEEEECCCCCCCCCCCCCCEEECCCCCCCEEEEECCCCCCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             97799335411787333761220587378745661123578775048842388987650366666665325689999899


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------------HHHHHHH
Q ss_conf             012334554320122210112100002688999988679707550464009998724998-------------9999999
Q gi|254780432|r  282 MVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------------ALLAAKF  348 (392)
Q Consensus       282 ~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------------~~~~~~l  348 (392)
                      ||||+++|++|+++++++|++++|++|+++|++|+ +|| .|.+|||+|+|++||++.++             ..+.+++
T Consensus       332 ~Aaala~L~~i~~~~l~~~~~~~g~~l~~~L~~l~-~~p-~i~~VRG~Gl~~gielv~~~~~~~~~~~~~~~~~~v~~~~  409 (460)
T PRK06105        332 AAVALENLAIIEERDLVGNAAELGARFQDRLRALA-DHP-LVGEVRGVGLIAAVELVADKATKTPFDPPGAVGARANARA  409 (460)
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH-CCC-CEEEEECCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999999864899999999999999999862-699-7688851673999998516544556772079999999999


Q ss_pred             HHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             9689899626898899558986889999999999999999852
Q gi|254780432|r  349 RDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       349 ~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +++||++.+.+ |+|+|.|||+||++|||+++++|+++|.+++
T Consensus       410 ~~~Gll~~~~g-n~i~i~PPL~it~~eid~~~~~l~~aL~e~~  451 (460)
T PRK06105        410 HEHGVISRAMG-DTLAFCPPLIITAAQVDEMVDRFGRALDDTA  451 (460)
T ss_pred             HHCCCEEEECC-CEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             97896893069-9899979924889999999999999999999


No 29 
>cd00610 OAT_like Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase, alanine-glyoxylate aminotransferase, dialkylglycine decarboxylase, 4-aminobutyrate aminotransferase, beta-alanine-pyruvate aminotransferase, adenosylmethionine-8-amino-7-oxononanoate aminotransferase, and glutamate-1-semialdehyde 2,1-aminomutase. All the enzymes belonging to this family act on basic amino acids and their derivatives are involved in transamination or decarboxylation.
Probab=100.00  E-value=0  Score=760.90  Aligned_cols=378  Identities=43%  Similarity=0.748  Sum_probs=353.4

Q ss_pred             CCCEECCCC--CCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCHHHHHH
Q ss_conf             431451558--88874898501037996799764641022674357878999999999999731450687-578189999
Q gi|254780432|r    3 KNDFLFNTY--DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL-YQSTQQEIF   79 (392)
Q Consensus         3 ~~~~~~~~~--~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~-~~~~~~~~l   79 (392)
                      +++|+++.|  .|+|++|+||+|+|+||.|||+||||++|+|++++||+||+|.+|+++|++++.+++.. +.++...+|
T Consensus         5 ~~~~~~~~~~~~~~P~~i~~~~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~~~~~~~~~~~~~~~~~l   84 (413)
T cd00610           5 DRKVLWHGYTVRPYPLVIVRAEGAYLYDVDGNRYLDFLSGIGVLNLGHNHPEVVEALKEQLAKLTHFSLGFFYNEPAVEL   84 (413)
T ss_pred             HHHHCCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHH
T ss_conf             44107788899999914998565999979979999967067644657898899999999997489725786688899999


Q ss_pred             HHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             986520101--333123565554035677766543200134786002343546565432123455321134799986433
Q gi|254780432|r   80 ANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEG  157 (392)
Q Consensus        80 a~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~  157 (392)
                      +++|++..|  +++|+|+||||||||+|||+||+|      |+|++||+++++|||+|.+++|+|+.+.++..+.|..++
T Consensus        85 a~~l~~~~p~~~~~v~f~~sGsEA~e~AiklAr~~------t~r~~ii~~~~~yHG~t~~als~t~~~~~~~~~~~~~~~  158 (413)
T cd00610          85 AELLLALTPEGLDKVFFVNSGTEAVEAALKLARAY------TGRKKIISFEGAYHGRTLGALSLTGSKKYRGGFGPLLPG  158 (413)
T ss_pred             HHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCEEEEECCCCCCCCHHHEEECCCCCCCCCCCCCCCC
T ss_conf             99999856998487998187779999999999997------399889998688478766334413783224577888899


Q ss_pred             CCCCCCH-----------HHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC
Q ss_conf             3222100-----------268875410---12332222333222211246210123221102234572131011003444
Q gi|254780432|r  158 FDQAKFC-----------DLQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG  223 (392)
Q Consensus       158 ~~~~~~~-----------d~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G  223 (392)
                      +.++|++           |++++++.+   .++|||||+|||||++|+++||++||++||++|++||++||+||||||||
T Consensus       159 ~~~~p~~~~~~~~~~~~~d~~~l~~~~~~~~~~iAavi~EPi~g~~G~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfG  238 (413)
T cd00610         159 VLHVPYPYRYRPPAELADDLEALEEALEEHPEEVAAVIVEPIQGEGGVIVPPPGYLKALRELCRKHGILLIADEVQTGFG  238 (413)
T ss_pred             CEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHEEECCCEEEEEECEECCC
T ss_conf             66808987655543227789999999973899789999979878899873888997888632860580698520200777


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHH
Q ss_conf             45553101112454530210344444434432100011122222--3322345321111001233455432012221011
Q gi|254780432|r  224 RTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMN--QGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV  301 (392)
Q Consensus       224 RtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~--~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~  301 (392)
                      |||+||++|++||+|||+|+||+||||||+|||+++++|++.+.  +..|++||+|||++||||+++|++++++++++|+
T Consensus       239 RtG~~~a~~~~gv~PDivt~gK~lggG~Pisav~~~~~i~~~~~~~~~~h~~T~~gnp~~~Aaa~a~L~~i~~e~l~~~~  318 (413)
T cd00610         239 RTGKMFAFEHFGVEPDIVTLGKGLGGGLPLGAVLGREEIMDAFPAGPGLHGGTFGGNPLACAAALAVLEVLEEEGLLENA  318 (413)
T ss_pred             CCCCCCHHHHCCCCCCEEEECCCCCCCCCCEEEEECHHHHHHHHCCCCEECCCCCCCHHHHHHHHHHHHHHHHCCHHHHH
T ss_conf             54543123325817875652334568898604777599999863388506778888849999999999998425699999


Q ss_pred             HHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEECCCCEEEECCCCCC
Q ss_conf             2100002688999988679707550464009998724998----------999999996898996268988995589868
Q gi|254780432|r  302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLLTAPSSDNVVRILPPLTI  371 (392)
Q Consensus       302 ~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~i  371 (392)
                      +++|++|+++|++++++|| ++.+|||.|+|+++|++.++          ..+.+.++++||++.+.++|+|+|.|||+|
T Consensus       319 ~~~g~~l~~~L~~l~~~~~-~i~~vrG~Gl~~gie~~~~~~~~~~~~~~~~~i~~~~~~~Gvl~~~~g~~~l~~~Ppl~i  397 (413)
T cd00610         319 AELGEYLRERLRELAEKHP-LVGDVRGRGLMIGIELVKDRATKPPDKELAAKIIKAALERGLLLRPSGGNVIRLLPPLII  397 (413)
T ss_pred             HHHHHHHHHHHHHHHHHCC-CCEEEEEECEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCEEEECCCCCEEEEECCCCC
T ss_conf             9999999999999997489-936964324499999936877677589999999999997994891179998999788368


Q ss_pred             CHHHHHHHHHHHHHHH
Q ss_conf             8999999999999999
Q gi|254780432|r  372 TAEEIHEGLERIERTA  387 (392)
Q Consensus       372 t~~eid~~i~~l~~al  387 (392)
                      |++|||+++++|+++|
T Consensus       398 t~~eid~~~~~l~~aL  413 (413)
T cd00610         398 TEEEIDEGLDALDEAL  413 (413)
T ss_pred             CHHHHHHHHHHHHHHC
T ss_conf             9999999999999869


No 30 
>PRK07495 4-aminobutyrate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=760.90  Aligned_cols=380  Identities=32%  Similarity=0.552  Sum_probs=344.8

Q ss_pred             CEECCCCC-CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCHHHHHHHHH
Q ss_conf             14515588-8874898501037996799764641022674357878999999999999731450687-578189999986
Q gi|254780432|r    5 DFLFNTYD-QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL-YQSTQQEIFANH   82 (392)
Q Consensus         5 ~~~~~~~~-~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~-~~~~~~~~la~~   82 (392)
                      +-+.++|+ ++|++|+||+|+||||.|||+||||+||+|+++|||+||+|.+|+++|++++.|+... +.++...+|+++
T Consensus        10 ~~~~~~~~~~~pi~i~raeG~~l~D~dG~~ylD~~sg~~~~~lGh~~p~i~~Ai~~ql~~l~~~~~~~~~~~~~~~lae~   89 (422)
T PRK07495         10 AAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVVNTGHRHPKVIAAVKAQLDRFTHTCHQVVPYENYVRLAER   89 (422)
T ss_pred             HHCCCCCCCCCCEEEEECCCCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             75278778899879995503989989889999926088976345797999999999985466755665465799999999


Q ss_pred             HHHHCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             5201013---3312356555403567776654320013478600234354656543212345532-11347999864333
Q gi|254780432|r   83 LIHSTFA---DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK-LQYLEGFGPKIEGF  158 (392)
Q Consensus        83 L~~~~~~---~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~-~~~~~~~~p~~~~~  158 (392)
                      |.+..|.   ++++|++|||||||+|||+||.+      |+|++||+|+++|||+|++++++|++ ..++.+|+|.++++
T Consensus        90 L~~~~p~~~~~~~~F~~SGsEAvE~AiKlAr~~------tgr~~iis~~~~yHG~T~~a~s~tg~~~~~~~~~~~~~~~~  163 (422)
T PRK07495         90 LNALVPGDFEKKTIFVTTGAEAVENAVKIARAA------TGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPPDV  163 (422)
T ss_pred             HHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHC------CCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             997568774547997278625999999975652------79987999878877864212431388765435678899993


Q ss_pred             CCCCCHH----------HHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC
Q ss_conf             2221002----------68875410-----12332222333222211246210123221102234572131011003444
Q gi|254780432|r  159 DQAKFCD----------LQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG  223 (392)
Q Consensus       159 ~~~~~~d----------~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G  223 (392)
                      .+.|++.          ++.+++.+     +++|||||+|||||++|+++||++||+++|++|++||++||+||||||||
T Consensus       164 ~~~p~p~~~~~~~~~~~~~~l~~~~~~~~~~~~iAAvIvEPiqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~TGfG  243 (422)
T PRK07495        164 FHVPFPVELHGVSVDQSLAALDKLFKADVDPQRVAAIIIEPVQGEGGFYPAPAAFMKALRELCDQHGILLIADEVQTGFA  243 (422)
T ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHCCCEEECCCCCCCCC
T ss_conf             67078832357766779999999987516877578999667647888663888999999999987396687763010887


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHH
Q ss_conf             45553101112454530210344444434432100011122222332234532111100123345543201222101121
Q gi|254780432|r  224 RTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN  303 (392)
Q Consensus       224 RtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~  303 (392)
                      |||+||++|++||+|||+|+||+||||||+|||+++++|++.+.++.|++||+|||++||||+++|++++++++++|+++
T Consensus       244 RtG~~fa~e~~gv~PDiv~~gKgl~gG~Pl~av~~~~~i~~~~~~~~~~~Tf~Gnpla~aaa~a~L~i~~~~~l~~~~~~  323 (422)
T PRK07495        244 RTGKLFAMEHHEVAADLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPLGIAAAHAVLDVIEEEDLCERANQ  323 (422)
T ss_pred             CCCCCHHHHCCCCCCCEEEECHHHHCCCCCEEEEECHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHH
T ss_conf             66550265448999809996415428875168887399883558888666799898999999999999986489999999


Q ss_pred             HCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC---------HHHHHHHHHHCCEEEEECC--CCEEEECCCCCCC
Q ss_conf             0000268899998867970755046400999872499---------8999999996898996268--9889955898688
Q gi|254780432|r  304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS---------PALLAAKFRDECLLTAPSS--DNVVRILPPLTIT  372 (392)
Q Consensus       304 ~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~---------~~~~~~~l~~~Gll~~~~~--~~~irl~Ppl~it  372 (392)
                      +|++|+++|++++++|| .+.+|||+|||+++|+..+         ...+..+++++|+++.+.+  +|+|||.|||+||
T Consensus       324 ~g~~l~~~L~~l~~~~p-~v~dvRG~GLm~giel~~~~~~~p~~~~~~~v~~~~~~~Gll~~~~g~~~nvi~~~PPL~it  402 (422)
T PRK07495        324 LGNRLKQRLASIRETVP-EIADIRGPGFMNAVEFNDADTGLPSAEFANRVRLEALEKGLILLTCGVHGNVIRFLAPITIQ  402 (422)
T ss_pred             HHHHHHHHHHHHHHCCC-CEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCEEEEECCCCCC
T ss_conf             99999999999985499-88988624569999983388889788999999999997798898348899989997990257


Q ss_pred             HHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999999999852
Q gi|254780432|r  373 AEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       373 ~~eid~~i~~l~~al~~L~  391 (392)
                      +++||+++++|+++|.|+.
T Consensus       403 ~~eid~~~~~l~~aL~E~~  421 (422)
T PRK07495        403 DEVFGEALDILEASILEAR  421 (422)
T ss_pred             HHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999960


No 31 
>PRK13360 omega amino acid--pyruvate transaminase; Provisional
Probab=100.00  E-value=0  Score=760.21  Aligned_cols=386  Identities=29%  Similarity=0.493  Sum_probs=348.3

Q ss_pred             CCCEECCCC------CCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHH
Q ss_conf             431451558------8887489850103799679976464102267435787899999999999973145068-757818
Q gi|254780432|r    3 KNDFLFNTY------DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQ   75 (392)
Q Consensus         3 ~~~~~~~~~------~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~   75 (392)
                      +++|+||.|      ++.|++|+||+|+||||.|||+||||+||+|++|+||+||+|++|+++|++++.+++. .+.++.
T Consensus        10 d~~~~w~p~t~~~~~~~~P~~i~~g~G~~l~D~dG~~ylD~~~g~~~~~lGh~hp~i~~Ai~~q~~~l~~~~~~~~~~~~   89 (441)
T PRK13360         10 DLSAFWMPFTANRQFKKAPRLLVAAKGMYYTSHDGRRVLDGTAGLWCVNAGHGRDEIVEAVRAQAGELDYAPTFQMGHPK   89 (441)
T ss_pred             CHHHCCCCCCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHH
T ss_conf             36442789999744478996489865388996999999996533886400779799999999998655873467678779


Q ss_pred             HHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9999986520101--33312356555403567776654320013478600234354656543212345532113479998
Q gi|254780432|r   76 QEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGP  153 (392)
Q Consensus        76 ~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p  153 (392)
                      ..+||++|++..|  ++||+|++|||||||+|||+||+|++..|+++|++||+++++|||+|++++|+++...++..|+|
T Consensus        90 ~~~lae~L~~~~p~~l~~v~f~~SGsEA~E~AiKlAr~y~~~~g~~~r~~ii~~~~syHG~t~ga~s~sg~~~~~~~~~~  169 (441)
T PRK13360         90 AFELATRIAEIAPGGLNHVFFTNSGSESVDTALKIALAYHRARGQGQRTRLIGRERGYHGVGFGGISVGGIAPNRKAFGA  169 (441)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999999985788868799848789999999999999988609987228993278627988465535588754456778


Q ss_pred             CCCCCCCCCCHH------------------HHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             643332221002------------------68875410----12332222333222211246210123221102234572
Q gi|254780432|r  154 KIEGFDQAKFCD------------------LQSLKNQI----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDA  211 (392)
Q Consensus       154 ~~~~~~~~~~~d------------------~~~l~~~~----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~  211 (392)
                      ..+++.++|++.                  .+.+++.+    +++|||||+|||||++|+++||++||+++|++|++||+
T Consensus       170 ~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~le~~~~~~~~~~iAAii~EPiqg~gG~~~~p~~yl~~lr~lc~~~gi  249 (441)
T PRK13360        170 LLPGVDHLPHTLDLARNAFSKGQPEHGAELADELERLVTLHDASTIAAVIVEPVAGSTGVLIPPKGYLQRLREICDKHGI  249 (441)
T ss_pred             CCCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             89985135887642224334575256799999999999854988579999777667789523899999999999863595


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCC-CCCCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCHH
Q ss_conf             131011003444455531011124545302103444444-3443210001112222233-------22345321111001
Q gi|254780432|r  212 LLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGG-FPIGACLATNEVAACMNQG-------SHGSTYGGNVLAMV  283 (392)
Q Consensus       212 llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG-~P~sav~~~~~i~~~~~~~-------~~~~T~~gnpl~~a  283 (392)
                      +||+|||||||||||+||++|++|++|||+|+||+|+|| +|+|+++++++|++.+.++       .|++||+|||++|+
T Consensus       250 llI~DEV~tG~GRTG~~fa~e~~gv~PDiv~~gKgl~gG~~Plsav~~~~~i~~~~~~~~~~~~~~~hg~T~~Gnplaca  329 (441)
T PRK13360        250 LLIFDEVITGFGRLGAPFAAQYFGVTPDLLTCAKGLTNGAIPMGAVFVSSEIHDAFMQGPEAGIEFFHGYTYSGHPLACA  329 (441)
T ss_pred             EEEECCCCCCCCCCCCCCEECCCCCCCCEEEECCHHHCCCCCCCEEEECHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             57720131268623567100168987878997723217873432255249999743369755542113677788989999


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC-------HHHHHHHHHHCCEEEE
Q ss_conf             233455432012221011210000268899998867970755046400999872499-------8999999996898996
Q gi|254780432|r  284 LGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS-------PALLAAKFRDECLLTA  356 (392)
Q Consensus       284 aa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~-------~~~~~~~l~~~Gll~~  356 (392)
                      ||+++|++|+++++++|++++|++|+++|+++.+ ++. +.+|||+|||+++|++..       ...+..+++++|+++.
T Consensus       330 aa~a~L~~i~~e~l~~~~~~~g~~l~~~L~~l~~-~~~-v~~VRG~Gl~~giel~~~~~~~~~~~~~~~~~~~~~Gll~~  407 (441)
T PRK13360        330 AALATLDLYEREGLLTRAARLAPYWEDALHSLRD-APH-VIDIRNLGLVGGIELAPRDGKPGKRAYEVFLKCFEKGLMIR  407 (441)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC-CCC-EEEECCCCEEEEEEEECCCCCHHHHHHHHHHHHHHCCEEEE
T ss_conf             9999999999748899999999999999998624-998-68851554899999978888654899999999996994993


Q ss_pred             ECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             26898899558986889999999999999999852
Q gi|254780432|r  357 PSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       357 ~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +.+ |+|||.|||+||++|||+++++|+++|+|++
T Consensus       408 ~~g-n~irl~PPL~it~~eid~~~~~l~~aL~e~a  441 (441)
T PRK13360        408 YTG-DILALSPPLIIEEAQIDELFDIVAQALKETA  441 (441)
T ss_pred             CCC-CEEEEECCEECCHHHHHHHHHHHHHHHHHHC
T ss_conf             179-9899989920889999999999999999569


No 32 
>PRK09221 beta alanine--pyruvate transaminase; Provisional
Probab=100.00  E-value=0  Score=758.87  Aligned_cols=387  Identities=30%  Similarity=0.509  Sum_probs=347.9

Q ss_pred             CCCCEECCCCCC------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCH
Q ss_conf             843145155888------87489850103799679976464102267435787899999999999973145068-75781
Q gi|254780432|r    2 NKNDFLFNTYDQ------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQST   74 (392)
Q Consensus         2 ~~~~~~~~~~~~------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~   74 (392)
                      ++++|+||.|.+      .|++|+||+|+||||.|||+||||+||+|++++||+||+|++|+++|++++.+.+. .+.++
T Consensus        13 ~d~~~~whp~~~~~~~~~~P~vi~~a~G~~l~D~dG~~ylD~~sg~~~~~lGh~hp~i~~Ai~~Q~~~l~~~~~~~~~~~   92 (445)
T PRK09221         13 NDLDAHWMPFTANRQFKAAPRLLVSAEGMYYTDADGRKILDGTAGLWCCNAGHGRPEIVEAVARQAATLDYAPAFQMGHP   92 (445)
T ss_pred             CCHHHCCCCCCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCH
T ss_conf             62866388999962226799559970539899699899999672687411478979999999999865687245556888


Q ss_pred             HHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999986520101--3331235655540356777665432001347860023435465654321234553211347999
Q gi|254780432|r   75 QQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFG  152 (392)
Q Consensus        75 ~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~  152 (392)
                      ...+|+++|++..|  ++||+|+||||||||+|||+||+|+...|.++|++||++++||||+|++++|+++...+++.|+
T Consensus        93 ~~~~lae~L~~~~p~~l~~v~f~~SGsEAvE~AiKlAr~y~~~~g~~~r~~ii~~~~syHG~t~g~~s~~g~~~~~~~f~  172 (445)
T PRK09221         93 LAFELAERLAELAPGGLDHVFFTNSGSESVDTALKIALAYHRARGQGTRTRLIGRERGYHGVGFGGISVGGIVNNRKMFG  172 (445)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999999998488875879960878999999999999999971999752696203774799722000268854343567


Q ss_pred             CCCCCCCCCCCHH------------------HHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             8643332221002------------------68875410----1233222233322221124621012322110223457
Q gi|254780432|r  153 PKIEGFDQAKFCD------------------LQSLKNQI----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDID  210 (392)
Q Consensus       153 p~~~~~~~~~~~d------------------~~~l~~~~----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g  210 (392)
                      |..+++.++|+..                  .+.+++.+    +++|||||+|||||++|+++||++||++||++|++||
T Consensus       173 ~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~a~~le~~i~~~~~~~iAaviiEPiqg~gG~~~~~~~yl~~lr~lc~~~g  252 (445)
T PRK09221        173 GLLPGVDHLPHTLDLPENAFSKGLPEHGAELADELERLVALHDASNIAAVIVEPMAGSAGVLVPPKGYLQRLREICDKHG  252 (445)
T ss_pred             CCCCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             88999447168766654334567606789999999999985398766899977755778714188899999999987558


Q ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCC-CCCCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCH
Q ss_conf             2131011003444455531011124545302103444444-3443210001112222233-------2234532111100
Q gi|254780432|r  211 ALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGG-FPIGACLATNEVAACMNQG-------SHGSTYGGNVLAM  282 (392)
Q Consensus       211 ~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG-~P~sav~~~~~i~~~~~~~-------~~~~T~~gnpl~~  282 (392)
                      ++||+|||||||||||+||++|++||+|||+|+||+|+|| +|+||++++++|++.+.++       .|++||+|||++|
T Consensus       253 illI~DEVqtG~GRtG~~fa~e~~gv~PDiv~~gKgl~gG~~Plsav~~~~ei~d~~~~~~~~~~~~~hg~T~~gnpla~  332 (445)
T PRK09221        253 ILLIFDEVITGFGRLGAAFAAERFGVTPDLITFAKGLTNGAIPMGAVIASDEIYDAFMQGPEYAIEFFHGYTYSGHPVAC  332 (445)
T ss_pred             EEEEEECCCCCCCCCCCCCEEECCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             48998415317881357612405767998677634356787754899965789997603875553233466788898999


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC---H----HHHHHHHHHCCEEE
Q ss_conf             1233455432012221011210000268899998867970755046400999872499---8----99999999689899
Q gi|254780432|r  283 VLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS---P----ALLAAKFRDECLLT  355 (392)
Q Consensus       283 aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~---~----~~~~~~l~~~Gll~  355 (392)
                      +||+++|++|+++++++|++++|++|+++|++|++ +|. |.+|||+|+|+++|+...   +    ..+...++++|+++
T Consensus       333 aaa~a~L~~i~~~~l~~~~~~~g~~l~~~L~~L~~-~~~-v~dVRG~Glm~giel~~~~~~~~~~~~~~~~~~~~~Gll~  410 (445)
T PRK09221        333 AAGLATLDIYREEDLFERAAELAPYFEDAVHSLKG-LPH-VIDIRNYGLVAGIELAPRPGAPGKRGYEAFMKCFEKGLLV  410 (445)
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC-CCC-EEEEECCCEEEEEEEECCCCCHHHHHHHHHHHHHHCCEEE
T ss_conf             99999999998646999999999999999998626-997-5987504089999985788855578999999999699289


Q ss_pred             EECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             626898899558986889999999999999999852
Q gi|254780432|r  356 APSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       356 ~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      .+.+ |+|||+|||+||++|||+++++|+++|.+|+
T Consensus       411 ~~~g-~~lrl~PPL~it~~eid~~~~~l~~al~~va  445 (445)
T PRK09221        411 RYTG-DTIALSPPLIIEKAQIDELVDALGDALRAVA  445 (445)
T ss_pred             EECC-CEEEEECCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             6379-9799989934899999999999999999869


No 33 
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
Probab=100.00  E-value=0  Score=759.65  Aligned_cols=387  Identities=30%  Similarity=0.528  Sum_probs=348.5

Q ss_pred             CCCEECCCCCC-------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCH
Q ss_conf             43145155888-------874898501037996799764641022674357878999999999999731450687-5781
Q gi|254780432|r    3 KNDFLFNTYDQ-------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL-YQST   74 (392)
Q Consensus         3 ~~~~~~~~~~~-------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~-~~~~   74 (392)
                      +++|+||.|.+       .|++|+||+|+||||.|||+|||++||+|++++||+||+|++|+++|++++.|.... +.++
T Consensus        22 d~~~~whp~t~~~~~~~~~P~~i~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~Q~~~l~~~~~~~~~~~  101 (462)
T PRK06916         22 NKAYVWHPFTQMKDYLEEDPVIIERGEGRKLYDVNGNEYWDGVSSIWLNVHGHRVPELDEAIREQLNKIAHSTMLGLANV  101 (462)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCH
T ss_conf             88553588877442378999489973518899799999988463377403568969999999999866568567776778


Q ss_pred             HHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999986520101--3331235655540356777665432001347860023435465654321234553211347999
Q gi|254780432|r   75 QQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFG  152 (392)
Q Consensus        75 ~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~  152 (392)
                      ...+||++|++..|  .++|+|+||||||||+|||+||+|+..+|.|+|++||+|++||||+|++++|+++...++..|+
T Consensus       102 ~~~~LAe~L~~~~p~~~~~v~f~~SGseA~E~AiKlAr~y~~~~g~~~r~~ii~~~~syHG~T~ga~s~s~~~~~~~~~~  181 (462)
T PRK06916        102 PSILLAEKLIEVVPEGLKKVFYSDSGSSAVEIAIKMAFQYWQHKGKPKKQRFVTLKEAYHGDTIGAVSVGAIDLFHQVYS  181 (462)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             89999999998577554879954974999999999999999982888763799836885877520010467411357777


Q ss_pred             CCCCCCCCCCCHH-----------------HHHHHH---HCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             8643332221002-----------------688754---1012332222333-222211246210123221102234572
Q gi|254780432|r  153 PKIEGFDQAKFCD-----------------LQSLKN---QISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDA  211 (392)
Q Consensus       153 p~~~~~~~~~~~d-----------------~~~l~~---~~~~~iAavi~Ep-v~g~~G~~~~~~~~l~~l~~lc~~~g~  211 (392)
                      |.+....+.|++.                 ++.+++   ..+++|||||+|| +||++|+++||++||++||++|++||+
T Consensus       182 ~~~~~~~~~p~p~~~~~~~~~~~~~~~~~~~~~le~~i~~~~~~iAaviiEP~iqg~gG~~~~p~~yl~~lr~lc~~~gi  261 (462)
T PRK06916        182 SLLFEAIKMPYPYTYRSPYGNDKEEIVKKHLEEMEELLKEKHEEIAAIIVEPLMQGAGGMITMPKGYLKGLRNLCTKYNV  261 (462)
T ss_pred             CCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             87888467689975567678987899999999999999757997669999614457899657878999999999860597


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCCHH
Q ss_conf             1310110034444555310111245453021034444443-443210001112222-------23322345321111001
Q gi|254780432|r  212 LLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACM-------NQGSHGSTYGGNVLAMV  283 (392)
Q Consensus       212 llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~-------~~~~~~~T~~gnpl~~a  283 (392)
                      +||+|||||||||||+||++|++||+|||+|+||+|+||| |+|+|+++++|++.+       .+..|++||+|||++||
T Consensus       262 llI~DEV~TGfGRtG~~fa~e~~gv~PDiv~~gKgl~gG~~Pl~av~~~~~i~~~~~~~~~~~~~~~hg~T~~GnPla~A  341 (462)
T PRK06916        262 LFITDEVATGFGRTGKMFACEHENVTPDILTAGKGLTGGYLPIAITVTTDEIYNAFLGDYEEQKTFFHGHSYTGNPLGCA  341 (462)
T ss_pred             CEECCCCCCCCCCCCCCCHHHCCCCCCCHHHHCHHCCCCCCCEEEEEEHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             26725430278755671166427966883431211037877627997618988753166545666556777888879999


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------------HHHHHHHHH
Q ss_conf             2334554320122210112100002688999988679707550464009998724998-------------999999996
Q gi|254780432|r  284 LGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------------ALLAAKFRD  350 (392)
Q Consensus       284 aa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------------~~~~~~l~~  350 (392)
                      ||+++|++|+++++++|++++|++|.++|++|.+ +| .|.+|||+|||+++|++.++             ..++..+++
T Consensus       342 aa~a~L~~i~~e~l~~~v~~~g~~l~~~L~~l~~-~~-~v~dVRG~Gl~~gielv~~~~~~~~~~~~~~~~~~i~~~~~~  419 (462)
T PRK06916        342 VAIANLELYEKTNLIEQVARKTEYVATQLEDLFA-LK-HVGDIRQLGLMVGIELVKNKETKEPFPWTERVGVQVCKRSRE  419 (462)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC-CC-CEEEEECCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9999999999668899999999999999998626-99-858772477189999832665467785578999999999996


Q ss_pred             CCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             898996268988995589868899999999999999998529
Q gi|254780432|r  351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       351 ~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~~  392 (392)
                      +|+++.+.+ |+|||.|||+||++|||+++++|+++|.+|..
T Consensus       420 ~Gll~~~~g-n~i~~~PPL~it~~eid~~~~il~~al~ev~~  460 (462)
T PRK06916        420 LGMILRPLG-NTIVFMPPLASTIDELDEMLRILYKAISDVTE  460 (462)
T ss_pred             CCEEEEECC-CEEEEECCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             994997449-99999899348899999999999999999977


No 34 
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
Probab=100.00  E-value=0  Score=757.83  Aligned_cols=385  Identities=26%  Similarity=0.423  Sum_probs=346.9

Q ss_pred             CCCEECCCCCC------C-CEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCH
Q ss_conf             43145155888------8-7489850103799679976464102267435787899999999999973145068-75781
Q gi|254780432|r    3 KNDFLFNTYDQ------S-DIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQST   74 (392)
Q Consensus         3 ~~~~~~~~~~~------~-p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~   74 (392)
                      +++|+||.|.+      . |++|+||+|+||||.|||+||||.||+|++++||+||+|++|+++|++++.+.+. .+.++
T Consensus        17 d~~~~whp~~~~~~~~~~ppi~I~rgeG~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~Ql~~l~~~~~~~~~~~   96 (452)
T PRK06943         17 SLRAVWHPCTQMKHHERLPLIPVARGEGAWLYDRDGRRYLDAISSWWVNLFGHANPRINAALKDQLDTLEHAMLAGCTHE   96 (452)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEECCCCEEEECCCCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCH
T ss_conf             89652889888754367898489968028899798999998344389771357969999999999865747135776876


Q ss_pred             HHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999986520101--3331235655540356777665432001347860023435465654321234553211347999
Q gi|254780432|r   75 QQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFG  152 (392)
Q Consensus        75 ~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~  152 (392)
                      ...+|+++|++..|  +++|+|+||||||||+|||+||+|++.++.|+|++||+++++|||+|.+++++|+.+.++..|+
T Consensus        97 ~~~~lae~L~~~~p~~l~~v~f~~SGSEA~E~AiKlA~~~~~~rg~~~r~~ii~~~~syHG~T~ga~s~t~~~~~~~~~~  176 (452)
T PRK06943         97 PAIELAERLAALTGHTLGHAFFASDGASAVEIALKMSFHAWRNRGRGDKREFVCLANGYHGETIGALGVTDVALFKDAYD  176 (452)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCEEECCCCHHHCCCCC
T ss_conf             99999999997466655759960871899999999999999861899860587347886887630146268512033567


Q ss_pred             CCCCCCCCCCCH-----------------HHHHHHH---HCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             864333222100-----------------2688754---1012332222333-222211246210123221102234572
Q gi|254780432|r  153 PKIEGFDQAKFC-----------------DLQSLKN---QISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDA  211 (392)
Q Consensus       153 p~~~~~~~~~~~-----------------d~~~l~~---~~~~~iAavi~Ep-v~g~~G~~~~~~~~l~~l~~lc~~~g~  211 (392)
                      |..+.+..++++                 +++.+++   ...++|||||+|| +||++|+++||++||++||++|++||+
T Consensus       177 p~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~le~~~~~~~~~iAAvivEP~iqg~gG~~~~~~~yl~~lr~lc~~~gi  256 (452)
T PRK06943        177 PLIRHAHVVASPDARGARPGETAADVAARALADVRRLFAERAGKIAALIVEPLVQCAAGMAMHDPSYVRGLRALCDEYGV  256 (452)
T ss_pred             CCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCEEECCHHHHHHHHHHHHHCCC
T ss_conf             76777624589975567888877789999999999999856997789999575146796185889999999999864496


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCHHH
Q ss_conf             1310110034444555310111245453021034444443-443210001112222233------223453211110012
Q gi|254780432|r  212 LLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG------SHGSTYGGNVLAMVL  284 (392)
Q Consensus       212 llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~------~~~~T~~gnpl~~aa  284 (392)
                      |||+|||||||||||+||++|++||+|||+|+||+|+||| |+|+|+++++|++.+.+.      .|++||+|||++|||
T Consensus       257 LlI~DEV~tGfGRTG~~fa~e~~gv~PDiit~gKgl~gG~~Plsav~~~~ei~~~~~~~~~~~~~~h~~T~~GnplacAa  336 (452)
T PRK06943        257 HLIADEIAVGCGRTGTFFACEQAGVWPDFLCLSKGISGGYLPLSLVLSRDEIFDAFYDDDTTRGFLHSHSYTGNPLACRA  336 (452)
T ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHCCCCCCCEEEECHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             48713320288645177102346998829997652128986531243038899864379976786757788988899999


Q ss_pred             HHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------HHHHHHHHHCCEEEEE
Q ss_conf             334554320122210112100002688999988679707550464009998724998-------9999999968989962
Q gi|254780432|r  285 GEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------ALLAAKFRDECLLTAP  357 (392)
Q Consensus       285 a~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------~~~~~~l~~~Gll~~~  357 (392)
                      |+++|++++++++++|++++|++|+++|++|. +|| .|.+|||+|||+++|++.+.       +.+...++++|+++++
T Consensus       337 ala~L~~l~~e~l~~~~~~~g~~l~~~L~~l~-~~~-~V~dVRG~GL~~gvel~~~~~~~~~~~~~i~~~~~~~Gll~~~  414 (452)
T PRK06943        337 AVATLDLFARDDVLARNARKSALLRAALAPLA-AHP-QVRHLRQRGTIFAFDVALDGDAARTFSRRFFEHALERELLLRP  414 (452)
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH-CCC-CEEEEEECCEEEEEEECCCCCCCHHHHHHHHHHHHHCCEEEEE
T ss_conf             99999999865799999999999999999873-599-8888630758999996678764579999999999969928986


Q ss_pred             CCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             689889955898688999999999999999985
Q gi|254780432|r  358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       358 ~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      .+ |+|+++|||+||++|||+++++|+++|.++
T Consensus       415 ~g-~~i~l~PPL~it~~eid~~~~~L~~aL~~v  446 (452)
T PRK06943        415 IG-TTVYLMPPYVLDDEEIAWLAQRTRATLDAT  446 (452)
T ss_pred             CC-CEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             49-999997990388999999999999999999


No 35 
>PRK07323 consensus
Probab=100.00  E-value=0  Score=757.22  Aligned_cols=379  Identities=40%  Similarity=0.663  Sum_probs=344.8

Q ss_pred             CCCEECCCC-CCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHHH
Q ss_conf             431451558-888748985010379967997646410226743578789999999999997314506-875781899999
Q gi|254780432|r    3 KNDFLFNTY-DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEIFA   80 (392)
Q Consensus         3 ~~~~~~~~~-~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~la   80 (392)
                      +++++.++| .|+|++|+||+|+||||.|||+||||+||+|++++||+||+|++|+++|++++.+.+ ..|.++...+||
T Consensus        28 ~~~~~~~~~~~p~P~vi~r~~G~~l~D~dG~~ylD~~sg~~~~~lGh~~p~i~~Ai~~q~~~l~~~~~~~~~~~~~~~la  107 (443)
T PRK07323         28 DEAVLSPSYTRPYPFVPARGEGCMLEDVDGNVFLDFTAGIAVTTTGHAHPHVVRAVQEQAERFAHVCGTDFYYEPTTSLA  107 (443)
T ss_pred             HHHHCCCCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHCEECCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             98862878787888689973409899698899999250877443168989999999999975556554655778999999


Q ss_pred             HHHHHHCC----CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC
Q ss_conf             86520101----33312356555403567776654320013478600234354656543212345532-11347999864
Q gi|254780432|r   81 NHLIHSTF----ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK-LQYLEGFGPKI  155 (392)
Q Consensus        81 ~~L~~~~~----~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~-~~~~~~~~p~~  155 (392)
                      ++|++..+    ..||+|++|||||||+|||+||+|      |+|++||+|+++|||+|++++++|++ ..++++|+|..
T Consensus       108 e~L~~~~~~~~~~~rv~f~~SGsEAvE~AiklAr~~------tgr~~iis~~~~yHG~T~ga~s~tg~~~~~~~~~~p~~  181 (443)
T PRK07323        108 ERLVGHAPFPGEKWRVFFGNSGAESVEAAIKLARYH------TGRSHIIAFLGAFHGRTYGAMSLTGSKTVYRQGFGPLL  181 (443)
T ss_pred             HHHHHHCCCCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCEEEEECCCCCCCCCCHHHHCCCCCCCCCCCCCCC
T ss_conf             999984789766568998377468999999999984------69987999707878987642431288300013568889


Q ss_pred             CCCCCCCCHH-----------------HHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEE
Q ss_conf             3332221002-----------------68875410-----1233222233322221124621012322110223457213
Q gi|254780432|r  156 EGFDQAKFCD-----------------LQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALL  213 (392)
Q Consensus       156 ~~~~~~~~~d-----------------~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~ll  213 (392)
                      +++.++|+++                 ++.+++.+     .++|||||+|||||++|+++||++||+.+|++|++||++|
T Consensus       182 ~~~~~~p~p~~~~~~~~~~~~~~~~~~~~~le~~~~~~~~~~~iAAvi~EPiqg~gG~~~pp~~yl~~lr~lc~~~~ill  261 (443)
T PRK07323        182 PGVSHIPYPNPFRPPLGSTPEECGHAVLDHLESLFQTVLPAEEVAAIVVEPIQGEGGYIVPPDGFLPRLRAICDRHGILL  261 (443)
T ss_pred             CCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEE
T ss_conf             99067068763234346872678999999999999851789978999986877888985699899999999999849758


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             10110034444555310111245453021034444443443210001112222233223453211110012334554320
Q gi|254780432|r  214 IFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQ  293 (392)
Q Consensus       214 I~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~  293 (392)
                      |+|||||||||||+||++|++|++|||+|+||+||||||+|||++++++++ +..+.|++||+|||++||||+++|++++
T Consensus       262 I~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gKglg~G~Plsav~~~~~i~~-~~~g~h~~T~~gnpl~~aaa~a~L~iie  340 (443)
T PRK07323        262 VVDEVQAGMGRTGRLFAIEHWGVQPDIITLAKGIASGMPLGAILAREELMT-WPPGSHGTTFGGNPVAAAAAHATLDLLE  340 (443)
T ss_pred             ECCCCCCCCCCCCCCCHHHCCCCCCCEEEECHHHCCCCCEEEEEECHHHHC-CCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             867423278866643020146978888987134328873189998578613-6567765365897489999999999998


Q ss_pred             CCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH--------HHHHHHHHHCCEEEEECCCCEEEE
Q ss_conf             122210112100002688999988679707550464009998724998--------999999996898996268988995
Q gi|254780432|r  294 SDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP--------ALLAAKFRDECLLTAPSSDNVVRI  365 (392)
Q Consensus       294 ~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~--------~~~~~~l~~~Gll~~~~~~~~irl  365 (392)
                       +++++|++++|++|+++|++|.++|| +|.+|||+|||++||++.++        ..+.+.++++|+++.+.++++|||
T Consensus       341 -~~l~~~v~~~g~~l~~~L~~l~~~~p-~v~~vRG~GL~~giel~~~~~~~~~~~~~~i~~~~~~~Gll~~~~g~~~ir~  418 (443)
T PRK07323        341 -GGLMENAARMGEFLLAELRQLQDRFP-FLGDVRGRGLMIGLDFVDPDGNPDGDLRDRAVRLAFEKGLLLLGCGKAAIRI  418 (443)
T ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEECCCEEEEEEEECCCCCCCHHHHHHHHHHHHHCCEEEEECCCCEEEE
T ss_conf             -77999999999999999999886099-7998731563999999548888488999999999997997998369998999


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             5898688999999999999999985
Q gi|254780432|r  366 LPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       366 ~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +|||+||++|||+++++|+++|++|
T Consensus       419 ~PPL~is~~eid~~l~~l~~al~el  443 (443)
T PRK07323        419 CPPLVLTREEAATGLDILREVFREL  443 (443)
T ss_pred             ECCEECCHHHHHHHHHHHHHHHHHC
T ss_conf             7891088999999999999999849


No 36 
>PRK07480 putative aminotransferase; Validated
Probab=100.00  E-value=0  Score=757.05  Aligned_cols=386  Identities=28%  Similarity=0.444  Sum_probs=344.3

Q ss_pred             CCCEECCCCCC-------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCC--CC
Q ss_conf             43145155888-------8748985010379967997646410226743578789999999999997314506875--78
Q gi|254780432|r    3 KNDFLFNTYDQ-------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLY--QS   73 (392)
Q Consensus         3 ~~~~~~~~~~~-------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~--~~   73 (392)
                      +++|+||.|.+       .|++|+||+|+||||.|||+||||+||+|++||||+||+|++|+++|++++++.++.+  .+
T Consensus        17 d~~~~~hp~t~~~~~~~~~p~vi~ra~G~yl~D~dG~~ylD~~sg~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~   96 (459)
T PRK07480         17 DAAHHLHPFSDMKALNEKGSRVITRAEGVYLWDSEGNKILDGMAGLWCVNVGYGRKELADAAYRQMRELPYYNTFFKTTH   96 (459)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEECEECEEEECCCCEEEECCCCHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             77401389888321046898699945208899699999998762487451688999999999999975577025545578


Q ss_pred             HHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             189999986520101--333123565554035677766543200134786002343546565432123455321134799
Q gi|254780432|r   74 TQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGF  151 (392)
Q Consensus        74 ~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~  151 (392)
                      +...+||++|++..|  +++|+|++|||||||+|||+||+|+...|+|+|++||+|++||||+|++++|+++...++..+
T Consensus        97 ~~~~~lAe~L~~~~p~~l~~v~f~~SGsEA~E~AiKlAr~y~~~~g~~~r~~ii~~~~syHG~T~ga~s~sg~~~~~~~~  176 (459)
T PRK07480         97 PPVIELAAKLAEVAPAGFNHVFFTNSGSEANDTVLRMVRHYWALKGKPQKKVVISRKNGYHGSTVAGASLGGMKYMHEQG  176 (459)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHHCCCCCCCCCC
T ss_conf             89999999999848887587997087589999999999999997099987089994586466406666633884323456


Q ss_pred             CCCCCCCCCCCCHH-----------------HHHHHHH----CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             98643332221002-----------------6887541----01233222233322221124621012322110223457
Q gi|254780432|r  152 GPKIEGFDQAKFCD-----------------LQSLKNQ----ISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDID  210 (392)
Q Consensus       152 ~p~~~~~~~~~~~d-----------------~~~l~~~----~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g  210 (392)
                      ++..+++.++++++                 ++.+++.    .+++|||||+|||||++|+++||++||++||++|++||
T Consensus       177 ~~~~~~~~~v~~P~~~~~~~~~~~~~~~~~~~~~le~~i~e~~~~~iAavi~EPi~g~gG~~~~p~~yl~~lr~lc~~~g  256 (459)
T PRK07480        177 DLPIPGIVHIDQPYWFGEGGDMTPEEFGLAAARQLEAKILELGAENVAAFIGEPIQGAGGVIIPPSTYWPEIQRICRKYD  256 (459)
T ss_pred             CCCCCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             88888856647987433467898678789999999999985088765787625524668842288899999999886439


Q ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCHHHH
Q ss_conf             21310110034444555310111245453021034444443-44321000111222223----32234532111100123
Q gi|254780432|r  211 ALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQ----GSHGSTYGGNVLAMVLG  285 (392)
Q Consensus       211 ~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~----~~~~~T~~gnpl~~aaa  285 (392)
                      ++||+|||||||||||+||++|++||+|||+|+||+||||| |+|+|+++++|++.+..    ..|++||+|||++||||
T Consensus       257 iLlI~DEV~tGfGRTG~~fa~e~~gv~PDii~~gKglggG~~Pl~av~~~~~i~~~~~~~~~~~~hg~T~~Gnplacaaa  336 (459)
T PRK07480        257 ILLVADEVICGFGRTGEWFGHQHFGFEPDLMTIAKGLTSGYIPMGAVIVGDRVAEVLIEEGGEFNHGFTYSGHPVAAAVA  336 (459)
T ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCEEEEECHHHHHHHHCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             77999735328875545423567798886898752002898773699873899987611787542477899997999999


Q ss_pred             HHHHHHHHCCCCCCHHH-HHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCHH-------------HHHHHHHHC
Q ss_conf             34554320122210112-1000026889999886797075504640099987249989-------------999999968
Q gi|254780432|r  286 EKVLNIIQSDGFLENVI-NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA-------------LLAAKFRDE  351 (392)
Q Consensus       286 ~a~L~~l~~~~l~~~~~-~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~~-------------~~~~~l~~~  351 (392)
                      +++|++++++++++|++ ++|++|+++|++|+ +|| .+.+|||+|||++||++.++.             .+...++++
T Consensus       337 la~L~~i~~~~l~~~~~~~~g~~l~~~l~~L~-~~p-~i~~vRG~Glm~giel~~~~~~~~~~~~~~~~~~~~~~~~~~~  414 (459)
T PRK07480        337 LANLRILRDEGIVERVRTDTGPYLQKRLRELA-DHP-LVGEVRGVGLVGALELVKDKATRERFAAGGGVGTICRDHCFNN  414 (459)
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH-CCC-CEEEEEECCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             99999986162999999999999999999851-599-6877230552899997437443445663368999999999979


Q ss_pred             CEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             9899626898899558986889999999999999999852
Q gi|254780432|r  352 CLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       352 Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      |+++.+.+ |.|++.|||+||++|||+++++|+++|.++.
T Consensus       415 Gll~~~~g-n~l~l~PPL~it~~eid~~l~~l~~aL~~~~  453 (459)
T PRK07480        415 GLIMRAVG-DRMILSPPLVISRAEIDELVEKARKALDLTA  453 (459)
T ss_pred             CEEEEECC-CEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             94996169-9899978823889999999999999999999


No 37 
>PRK08360 4-aminobutyrate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=756.95  Aligned_cols=381  Identities=30%  Similarity=0.473  Sum_probs=341.3

Q ss_pred             CCEECCCCC--CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCC-CHHHHHHH
Q ss_conf             314515588--887489850103799679976464102267435787899999999999973145068757-81899999
Q gi|254780432|r    4 NDFLFNTYD--QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQ-STQQEIFA   80 (392)
Q Consensus         4 ~~~~~~~~~--~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~-~~~~~~la   80 (392)
                      .+|+.+.+.  -+|++|+||+|+||||.|||+||||.||+|+++|||+||+|++|+++|++++.+.+..+. +....+|+
T Consensus        11 ~~~~~~~~~~~~~Pivi~raeG~~l~D~dG~~yLD~~sg~~~~~lGH~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~~la   90 (443)
T PRK08360         11 SKVIAPANRVTYYPLVPVRAENAKVWDIEGKEYIDFLSDAAVQNVGHNNPRVVKAIKEQADKLIHASYIYAFPVEPLLLA   90 (443)
T ss_pred             HHHCCCCCCCCCCCCCEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             98528876776279817961449899697699888122578642437969999999999863687357755764899999


Q ss_pred             HHHHHHCCC--CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             865201013--331235655540356777665432001347860023435465654321234553211347999864333
Q gi|254780432|r   81 NHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGF  158 (392)
Q Consensus        81 ~~L~~~~~~--~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~  158 (392)
                      ++|++..|.  +|++|++|||||||+|||+||+|      |+|++||+++++|||+|++++|+|+.....+.+.+..+++
T Consensus        91 e~L~~~~p~~~~~v~f~~SGSEAvE~AlKlAr~~------tgr~~ii~~~~syHG~T~gals~tg~~~~~~~~~~~~~~~  164 (443)
T PRK08360         91 EKLAEIAPIDNPKVSFGLSGGDANDGAIKFARAY------TKRRKILSYMRSYYGSTYGAMSLTGLDFEVRAIVGELSDV  164 (443)
T ss_pred             HHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCC
T ss_conf             9999857998675997486788999999998876------2997387404665768601033137754545567899996


Q ss_pred             CCCCCHH-----------------HHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEEC
Q ss_conf             2221002-----------------68875410-----1233222233322221124621012322110223457213101
Q gi|254780432|r  159 DQAKFCD-----------------LQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFD  216 (392)
Q Consensus       159 ~~~~~~d-----------------~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~D  216 (392)
                      .++|+++                 ++.+++.+     .++|||||+|||||++|+++||++||++||++|++||++||+|
T Consensus       165 ~~vp~p~~~r~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~iAAviiEPvqG~gG~~~pp~~yl~~lr~lc~~~gillI~D  244 (443)
T PRK08360        165 HYIPYPNCYRCPFGKEPGSCKMECVEYLKEKFEGEVYAEGVAALFAEPIQGDSGMVVPPENYFKKVKKILDEHGILLVVD  244 (443)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             68179864357678885213699999999998620366875799986767888418688899768988777659079851


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCC
Q ss_conf             10034444555310111245453021034444443443210001112222233223453211110012334554320122
Q gi|254780432|r  217 EVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDG  296 (392)
Q Consensus       217 EV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~  296 (392)
                      ||||||||||+||++|++||+|||+|+||+|+||+|+||++++++|++.+.+..|++||+|||++||||+++|+++++++
T Consensus       245 EV~tGfGRtG~~fa~e~~gv~PDiv~~gKgl~~G~Pisav~~~~ei~~~~~~~~h~~T~~gnpl~caaa~a~L~~i~~~~  324 (443)
T PRK08360        245 EVQSGLGRTGKWFAIEHFGVEPDIITLGKPLGGGLPISATIGRAEIMDSLPPLSHAFTLSGNPTASRAALAVIEEIEEKD  324 (443)
T ss_pred             CCCCCCCCCCHHHHHHCCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             13038765440557645796986577634445788862311149898504887656687899799999999999998635


Q ss_pred             CCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC----------HHHHHHHHHHCCEEEEECCCCEEEEC
Q ss_conf             21011210000268899998867970755046400999872499----------89999999968989962689889955
Q gi|254780432|r  297 FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS----------PALLAAKFRDECLLTAPSSDNVVRIL  366 (392)
Q Consensus       297 l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~----------~~~~~~~l~~~Gll~~~~~~~~irl~  366 (392)
                      +++|++++|++|.++|++++++|| +|.+|||+|||+++|++.+          ...+..+++++|+++.+.++|+|||.
T Consensus       325 l~~~~~~~G~~l~~~L~~l~~~~p-~i~dVRG~Gl~~gie~v~d~~~~~~~~~~~~~i~~~~~~~Glli~~~~~~~i~~~  403 (443)
T PRK08360        325 LLKRAEKLGNYTKKRLEEMKEKHE-LIGDVRGLGLMIGVDLVKDRETKERAYEETKKVVWRAFELGLIVTFFQGNVLRIE  403 (443)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCC-CEEEECCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCEEEEE
T ss_conf             999999999999999999887189-8885203646999998127765544579999999999968938811699989997


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             8986889999999999999999852
Q gi|254780432|r  367 PPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       367 Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      |||+||++|||+++++|+++|.+|.
T Consensus       404 PPL~it~~eid~~~~~l~~al~ev~  428 (443)
T PRK08360        404 PPLTIEEEVLDEGLDILEEAIEDVE  428 (443)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9912899999999999999999998


No 38 
>PRK05769 4-aminobutyrate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=754.34  Aligned_cols=379  Identities=39%  Similarity=0.655  Sum_probs=345.8

Q ss_pred             CCCEECCCCC-CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHHH
Q ss_conf             4314515588-88748985010379967997646410226743578789999999999997314506-875781899999
Q gi|254780432|r    3 KNDFLFNTYD-QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEIFA   80 (392)
Q Consensus         3 ~~~~~~~~~~-~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~la   80 (392)
                      +++|++++|. |+|++|+||+|+|+||.|||+|||+++|+|+++|||+||+|++|+++|++++.|.+ ..+.++..++|+
T Consensus        25 ~~~~~~~~~~~p~P~~i~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Av~~Q~~~l~~~~~~~~~~~~~~ela  104 (442)
T PRK05769         25 DEKYLAQSTTRPYPLVIDRGEGVWVEDVDGNVYLDFNSGIAVTNVGHAHPKVVEAIKEQAEKFLHYSLTDFYYEPAVELA  104 (442)
T ss_pred             HHHHCCCCCCCCCCCEEEEEECCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             87646898787898059973539899698699999254477413448979999999999861767456776888999999


Q ss_pred             HHHHHHCCCC---CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC
Q ss_conf             8652010133---312356555403567776654320013478600234354656543212345532-113479998643
Q gi|254780432|r   81 NHLIHSTFAD---RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK-LQYLEGFGPKIE  156 (392)
Q Consensus        81 ~~L~~~~~~~---~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~-~~~~~~~~p~~~  156 (392)
                      ++|++..|.+   +++|++|||||||+|||+||.|      |+|++||+|++||||+|++++++|++ +.++..|+|..+
T Consensus       105 e~L~~~~p~~~~~~v~f~~sGSEAvE~AiklAr~~------tgr~~ii~~~~syHG~t~ga~s~t~~~~~~~~~~~p~~p  178 (442)
T PRK05769        105 ERLVEIAPGGFPKKVFFTNSGTESNEAAIKLARYY------TGRKYIIAFLGAFHGRTYGSMSLTASKPVQRRGFFPLMP  178 (442)
T ss_pred             HHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCEEEEECCCCCCCCHHHHHHCCCCHHHCCCCCCCCC
T ss_conf             99998578666757998186778999999998986------599869972486778863365320783011047789999


Q ss_pred             CCCCCCCHH------------------HHHHHHHC------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCE
Q ss_conf             332221002------------------68875410------123322223332222112462101232211022345721
Q gi|254780432|r  157 GFDQAKFCD------------------LQSLKNQI------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDAL  212 (392)
Q Consensus       157 ~~~~~~~~d------------------~~~l~~~~------~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~l  212 (392)
                      ++.++|+++                  ++.+++.+      +++|||||+|||||++|+++||++||+++|++|++||++
T Consensus       179 ~~~~~p~p~~~~~~~~~~~~~~~~~~~~~~le~~i~~~~~~~~~iAavi~EPv~g~gG~~~p~~~yl~~l~~lc~~~gil  258 (442)
T PRK05769        179 GVIHVPYPNPYRNPFGYENPEELGNAVLDFIEDYLFKTLVPPEEVAAIFFEPIQGEGGYVVPPKNFFKELRKLADKYGIL  258 (442)
T ss_pred             CCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             92780789734565577898999999999999999873589897899999897778897068989998999999874935


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             31011003444455531011124545302103444444344321000111222223322345321111001233455432
Q gi|254780432|r  213 LIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       213 lI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
                      ||+|||||||||||+||++|+||++|||+|+||+||||||+|+|++++++++ ..++.|++||+|||++||||+++|+++
T Consensus       259 lI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gK~lggG~Plsav~~~~~i~~-~~~g~h~~T~~g~pl~~aaa~a~L~~l  337 (442)
T PRK05769        259 LIVDEVQTGFGRTGKMFAIEHFGVEPDIITLAKAIAGGLPLGAVIGRAELMF-LPPGSHANTFGGNPVAAAAALATLELI  337 (442)
T ss_pred             EECCCCCCCCCCCCCCCHHHCCCCCCCEEEECCHHCCCCCEEEEEECHHHHC-CCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             8711101277755662131046778888997401038874089998067503-777871518998679999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH--------HHHHHHHHHCCEEEEECCCCEEE
Q ss_conf             0122210112100002688999988679707550464009998724998--------99999999689899626898899
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP--------ALLAAKFRDECLLTAPSSDNVVR  364 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~--------~~~~~~l~~~Gll~~~~~~~~ir  364 (392)
                      + +++++|++++|++|+++|+++.++|| .+.+|||.|||++||++.+.        ..+...++++|+++.+.++|+|+
T Consensus       338 e-e~l~~~v~~~G~~l~~~L~~l~~~~p-~v~~vRG~Gl~~giel~~~~~~~~~~~~~~~~~~~~~~Gvl~~~~g~~~i~  415 (442)
T PRK05769        338 E-EGLLENAARLGEYLLKRLTELKEEYE-FIGDVRGLGLMIGVELVKDRKEPDPKLRDKVLREAFKRGLLLLGAGKSAIR  415 (442)
T ss_pred             H-HHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEECCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHCCEEEEECCCCEEE
T ss_conf             8-88999999999999999999986299-867603434599999815777879999999999999699599317999799


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             55898688999999999999999985
Q gi|254780432|r  365 ILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       365 l~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      |+|||+||++|||+++++|++++.+|
T Consensus       416 ~~PpL~it~~eid~~~~~l~~al~ev  441 (442)
T PRK05769        416 IIPPLVITEEEADTGLEILEEAIKEV  441 (442)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             97994699999999999999999986


No 39 
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
Probab=100.00  E-value=0  Score=752.24  Aligned_cols=384  Identities=33%  Similarity=0.543  Sum_probs=348.0

Q ss_pred             CCCEECCCCC-----CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHH
Q ss_conf             4314515588-----88748985010379967997646410226743578789999999999997314506-87578189
Q gi|254780432|r    3 KNDFLFNTYD-----QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQ   76 (392)
Q Consensus         3 ~~~~~~~~~~-----~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~   76 (392)
                      |++|+||+|.     +.|++|+||+|+||||.|||+||||++|+|++++||+||+|++|+++|++++.++. ..+.++..
T Consensus         8 d~~~~~~~~~~~~~~~~Pi~i~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~q~~~l~~~~~~~~~~~~~   87 (421)
T PRK05964          8 DLSHVWHPYTQMKTHPPPIPIVRAEGAYLYLADGRELIDAISSWWVATHGHNHPHIDAAIREQLDRLDHVMFAGFTHEPA   87 (421)
T ss_pred             HHHHCCCCCCCCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHH
T ss_conf             87222589878878999857995353889979999999936068740268998999999999997578754687575899


Q ss_pred             HHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             999986520101--333123565554035677766543200134786002343546565432123455321134799986
Q gi|254780432|r   77 EIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPK  154 (392)
Q Consensus        77 ~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~  154 (392)
                      ++||++|++..|  +++|+|+||||||||+|||+||+|+...| ++|++||+|+++|||+|++++|+++...++.++.|.
T Consensus        88 ~~lA~~L~~~~p~~~~~v~f~~SGsEA~e~AiKlA~~y~~~~g-~~r~~ii~~~~~yHG~T~~a~s~~~~~~~~~~~~~~  166 (421)
T PRK05964         88 ERLAKRLVALTPGGLDHVFFSDSGSVAVEVALKMALQYWRNRG-EPRSRFLSLRGGYHGDTLGTMSVGMHGLFNATYGPL  166 (421)
T ss_pred             HHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCC-CCCEEEEEECCCCCCCCEEEEECCCCCCCCCCCCCC
T ss_conf             9999999984787758799947813699999999999998639-975189997388689851343235753345788888


Q ss_pred             CCCCCCCCCHH------HHHHHHHC---CCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCC
Q ss_conf             43332221002------68875410---12332222333-2222112462101232211022345721310110034444
Q gi|254780432|r  155 IEGFDQAKFCD------LQSLKNQI---SNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGR  224 (392)
Q Consensus       155 ~~~~~~~~~~d------~~~l~~~~---~~~iAavi~Ep-v~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GR  224 (392)
                      .+.+...++++      ++.+++.+   .++|||||+|| +||+||+++||++||+++|++|++||++||+|||||||||
T Consensus       167 ~~~~~~~~~p~~~~~~~~~~le~~~~~~~~~iAAvi~EP~iqg~GG~~~~p~~y~~~lr~lc~~~gillI~DEV~tGfGR  246 (421)
T PRK05964        167 LFQVLALPVPRDYEQAYLDALEALLEKHAGEIAAVIVEPLVQGAGGMLFYDPRYLAELRRICDRHGVLLIFDEIATGFGR  246 (421)
T ss_pred             CCCCEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEECCCCCCCCCC
T ss_conf             88876558998633889999999997479977899997884678997678889999998871006804651211026875


Q ss_pred             CCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             555310111245453021034444443-44321000111222223------32234532111100123345543201222
Q gi|254780432|r  225 TGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQ------GSHGSTYGGNVLAMVLGEKVLNIIQSDGF  297 (392)
Q Consensus       225 tG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~------~~~~~T~~gnpl~~aaa~a~L~~l~~~~l  297 (392)
                      ||+||++|++|++|||+|+||+|+||| |+|||+++++|++.+..      ..|++||+|||++||||+++|++++++++
T Consensus       247 tG~~fa~e~~gv~PDivt~gKgl~gG~~Pisav~~~~~i~~~~~~~~~~~~~~h~~T~~gnpla~aaa~a~L~~i~~~~l  326 (421)
T PRK05964        247 TGTLFACEQAGVSPDIMCLSKGLTGGYLPLAATLCTAEIFDAFYSDDRAKAFMHSPSYTANPLACAAANASLDLFEDEPV  326 (421)
T ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCHH
T ss_conf             67887543002589878872203578762489998589997631678776400378888896999999999999964519


Q ss_pred             CCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-----HHHHHHHHHCCEEEEECCCCEEEECCCCCCC
Q ss_conf             10112100002688999988679707550464009998724998-----9999999968989962689889955898688
Q gi|254780432|r  298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-----ALLAAKFRDECLLTAPSSDNVVRILPPLTIT  372 (392)
Q Consensus       298 ~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-----~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it  372 (392)
                      ++|++++|++|+++|+++++ +| .|.+|||+|||+++|+..++     ..+..+++++|+++.+.+ |+|||+|||+||
T Consensus       327 ~~~~~~~g~~l~~~L~~l~~-~~-~I~dvRG~GL~~~ie~~~~~~~~~~~~i~~~~~~~Glli~~~g-n~ir~~PpL~it  403 (421)
T PRK05964        327 LERVAALSAGLTEGLEPFRD-LP-RVADVRVLGAIGAVELDRPDDGRIGPALTAAFLDRGVLLRPLG-NTIYLMPPYIIT  403 (421)
T ss_pred             HHHHHHHHHHHHHHHHHHCC-CC-CEEEEEECCEEEEEEEECCCCHHHHHHHHHHHHHCCCEEEECC-CEEEEECCCCCC
T ss_conf             99999999999999997435-99-7676410462999997257867999999999997890999669-999997893689


Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999985
Q gi|254780432|r  373 AEEIHEGLERIERTAIKL  390 (392)
Q Consensus       373 ~~eid~~i~~l~~al~~L  390 (392)
                      ++|||+++++|++++.||
T Consensus       404 ~~eid~~~~~l~~al~ev  421 (421)
T PRK05964        404 PEELARITDAIVEVADEL  421 (421)
T ss_pred             HHHHHHHHHHHHHHHHHC
T ss_conf             999999999999999629


No 40 
>PRK08117 4-aminobutyrate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=752.21  Aligned_cols=382  Identities=39%  Similarity=0.648  Sum_probs=347.3

Q ss_pred             CCCEECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHH
Q ss_conf             43145155888-87489850103799679976464102267435787899999999999973145068-75781899999
Q gi|254780432|r    3 KNDFLFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFA   80 (392)
Q Consensus         3 ~~~~~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la   80 (392)
                      +++|++++|.+ .|++|+||+|+||||.|||+||||+||+|+++|||+||+|++|+++|++++.+.+. .+.++...+|+
T Consensus        11 ~~~~~~~~~~~~~P~~i~~g~G~~l~D~dG~~yiD~~~g~~~~~lGh~~p~i~~Av~~q~~~~~~~~~~~~~~~~~~~la   90 (429)
T PRK08117         11 IKRVLAPALAKDHPLPVEKGEGCYYYGVDGKEYLDFTSGIAVLNVGHNHPKVVQAIKEQADRLVHGGSGVIYYESILKLA   90 (429)
T ss_pred             HHHHCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             98651765787899218985769999699799999650877534258969999999999863477677754776999999


Q ss_pred             HHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC
Q ss_conf             86520101--333123565554035677766543200134786002343546565432123455321-134799986433
Q gi|254780432|r   81 NHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFGPKIEG  157 (392)
Q Consensus        81 ~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~p~~~~  157 (392)
                      ++|++..|  +++++|++|||||||+|||+||+|      |+|++||+|+++|||+|++++++|++. .++..+.|..++
T Consensus        91 e~L~~~~p~~~~~v~f~~sGsEAve~AiklAr~~------tgr~~ii~~~~~yHG~t~~a~s~t~~~~~~~~~~~~~~~~  164 (429)
T PRK08117         91 EELAEITPGGLDMFFFSNSGAEAIEGALKLAKHV------TKRQGIISFTGAFHGRTLGALSVTTSSSKYRKRYQPLLPS  164 (429)
T ss_pred             HHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCEEEEEECCCCCCCCCEEEECCCCCCCCCCCCCCCCC
T ss_conf             9999848788788999487468999999999986------3898599984577888660455316753234577899998


Q ss_pred             CCCCCCHH-----------------HHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEE
Q ss_conf             32221002-----------------68875410-----123322223332222112462101232211022345721310
Q gi|254780432|r  158 FDQAKFCD-----------------LQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIF  215 (392)
Q Consensus       158 ~~~~~~~d-----------------~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~  215 (392)
                      +.++|++.                 ++.+++.+     +++|||||+|||||++|+++||++||+++|++|++||++||+
T Consensus       165 ~~~~p~p~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~iAAviiEPi~g~gG~~~~~~~fl~~lr~lc~~~gillI~  244 (429)
T PRK08117        165 VYHAPYPYCFRCPIGRDPESCSLECLRDLESLFKRQIAPEEVAAIIIEPVLGEGGYIVPPKEFLQKVREICDEHGILLIF  244 (429)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHCCCEEEC
T ss_conf             36637886325656788056689999999999986248887899999646678893738889999999998763917973


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             11003444455531011124545302103444444344321000111222223322345321111001233455432012
Q gi|254780432|r  216 DEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD  295 (392)
Q Consensus       216 DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~  295 (392)
                      |||||||||||+||++|++||+|||+|+||+||||||+|||++++++++.+.++.|++||+|||++||||+++|++++++
T Consensus       245 DEV~tGfGRtG~~fa~~~~gv~PDiv~~gK~lggG~Plsav~~~~~i~~~~~~~~~~~T~~gnp~~~aaa~a~L~~~~~~  324 (429)
T PRK08117        245 DEVQSGFGRTGKWFAAETFGVVPDIMTVAKGIASGFPLSAVVASKELMDQWPLGAHGTTFGGNPVACAAALATLEVIKEE  324 (429)
T ss_pred             CCCCCCCCCCCCCCHHHCCCCCCCEEEEEECCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             43110777667732654049899878871014478986422147999706688886858998989999999999999755


Q ss_pred             CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--------HHHHHHHHHHCCEEEEECC--CCEEEE
Q ss_conf             221011210000268899998867970755046400999872499--------8999999996898996268--988995
Q gi|254780432|r  296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--------PALLAAKFRDECLLTAPSS--DNVVRI  365 (392)
Q Consensus       296 ~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--------~~~~~~~l~~~Gll~~~~~--~~~irl  365 (392)
                      ++++|++++|++|+++|+++.++|| +|.+|||+|||+++|++.+        ...+.+.++++|+++...+  +|+|+|
T Consensus       325 ~l~~~v~~~g~~l~~~L~~l~~~~p-~v~~VRG~Gl~~giel~~~~~~~~~~~~~~i~~~~~~~Gll~~~~g~~~n~i~~  403 (429)
T PRK08117        325 KLLENANNMGAYALERLEKLKEKYP-VIGDVRGIGLMIGIEFVDETGEPDGDAVEKILDKCLENGLLLYGCGNDGNVLRF  403 (429)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEECCCEEEEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCEEEE
T ss_conf             6999999999999999999997199-878852266799999964888946999999999999699589844799998999


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             58986889999999999999999852
Q gi|254780432|r  366 LPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       366 ~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      .|||+||++|||+++++|+++|.|++
T Consensus       404 ~PPL~is~~eid~~~~~l~~al~e~a  429 (429)
T PRK08117        404 IPPLTVTKEEIDQGLSILDKGLGEYA  429 (429)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             79977999999999999999999769


No 41 
>PRK07036 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=753.19  Aligned_cols=387  Identities=26%  Similarity=0.441  Sum_probs=346.1

Q ss_pred             CCCEECCCCCC-------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC--CCCC
Q ss_conf             43145155888-------87489850103799679976464102267435787899999999999973145068--7578
Q gi|254780432|r    3 KNDFLFNTYDQ-------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN--LYQS   73 (392)
Q Consensus         3 ~~~~~~~~~~~-------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~--~~~~   73 (392)
                      +++|+||+|.+       .|++|+||+|+|+||.|||+||||+||+|+++|||+||+|++|+++|++++.+.++  .+.+
T Consensus        15 d~~~~whp~~~~~~~~~~~Pivi~~g~G~~l~D~dG~~ylD~~sg~~~~~lGh~~p~v~~Ai~~Q~~~l~~~~~~~~~~~   94 (466)
T PRK07036         15 DKRHLIHPWHDFSSLGREGSLVIVEAEGIYVTDADGRRYLDGIGGMWCVNIGYGREEMADAIADQARRLPYYTPFGDMTN   94 (466)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEEEEECEEEECCCCEEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             98544488888100277899689964226899699999999653478502178979999999999976786067643268


Q ss_pred             HHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             189999986520101--333123565554035677766543200134786002343546565432123455321134799
Q gi|254780432|r   74 TQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGF  151 (392)
Q Consensus        74 ~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~  151 (392)
                      +...+|+++|++..|  ++||+|+||||||||+|||+||+|+...|.++|++||+|+++|||+|.+++++|+++.++..|
T Consensus        95 ~~~~~lae~L~~~~p~~~~~v~f~~SGsEA~E~AlKlAr~~~~~~g~~~r~~ii~~~~syHG~T~~a~s~sg~~~~~~~~  174 (466)
T PRK07036         95 APAAELAAKLAELAPGDLNHVFLTTGGSTAVDSALRFVHYYFNCRGRPAKKHIITRGDAYHGSTYLTASLTGKAADRTEF  174 (466)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHECCCCCCCCCCC
T ss_conf             99999999999748877587998377388999999999999875088876089834897689656562205884456787


Q ss_pred             CCCCCCCCCCCCH---------------H--HHHHHH----HCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             9864333222100---------------2--688754----101233222233322221124621012322110223457
Q gi|254780432|r  152 GPKIEGFDQAKFC---------------D--LQSLKN----QISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDID  210 (392)
Q Consensus       152 ~p~~~~~~~~~~~---------------d--~~~l~~----~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g  210 (392)
                      .|..+.+.+++++               +  ++.+++    ..+++|||||+|||||++|+++||++||++||++|++||
T Consensus       175 ~~~~~~v~~~~~p~~~~~p~~~~~~~~~~~~~~~~e~~i~~~~~~~iAa~i~EPi~G~gG~~~pp~~yl~~lr~lc~~~g  254 (466)
T PRK07036        175 DYASDLVHHLSSPNPYRRPAGMSEAAFCDFLVDEFEDKILELGADNIAAFIAEPILGSGGVIVPPPGYHARMREICRRYD  254 (466)
T ss_pred             CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCEECCCHHHHHHHHHHHHHCC
T ss_conf             78887504325776555776652367899999999999986188866899856621668713088899999999986379


Q ss_pred             CEEEECCCCCCCCCCCCCCCCC-CCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCC
Q ss_conf             2131011003444455531011-1245453021034444443-44321000111222223-------3223453211110
Q gi|254780432|r  211 ALLIFDEVQTGYGRTGKLFAYE-WANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQ-------GSHGSTYGGNVLA  281 (392)
Q Consensus       211 ~llI~DEV~tG~GRtG~~f~~e-~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~-------~~~~~T~~gnpl~  281 (392)
                      ++||+|||||||||||+||++| ++||+|||+|+||+|+||| |+|||+++++|++.+..       ..|++||+|||++
T Consensus       255 illI~DEV~tG~GRtG~~fa~~~~~gv~PDiv~~gKgl~gG~~Pl~av~~~~~i~~~~~~~~~~~~~~~hg~T~~gnpla  334 (466)
T PRK07036        255 ILYISDEVVTGFGRLGHFFASEAVFGIQPDIITVAKGLTSGYQPLGAVIISERLVDVISGPNAKGGVFTHGFTYSGHPVA  334 (466)
T ss_pred             EEEEEECCCCCCCCCCCCHHHHHHHCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHHCCCCCCCCEEECCCCCCCCHHH
T ss_conf             07997456428886755204358638898779871335688776489998599998750467888455036788899899


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------------HHHHHHH
Q ss_conf             012334554320122210112100002688999988679707550464009998724998-------------9999999
Q gi|254780432|r  282 MVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------------ALLAAKF  348 (392)
Q Consensus       282 ~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------------~~~~~~l  348 (392)
                      ||||+++|++++++++++|++++|++|+++|++|+ +|| .|.+|||+|||++||++.++             ..+...+
T Consensus       335 ~Aaa~a~L~~l~~e~l~~~~~~~G~~l~~~L~~L~-~~p-~v~dVRG~GLm~gie~v~d~~~~~~~~~~~~~~~~i~~~~  412 (466)
T PRK07036        335 CAAALKNIEIMEREGLCEHVREVGPYFEERLASLR-ELP-LVGDVRGDHLMACVECVADKGSKALLPEDIAIGQRIDRHC  412 (466)
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH-CCC-CEEEEEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999998626699999999999999999751-599-7788863238999997026654445771179999999999


Q ss_pred             HHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             96898996268988995589868899999999999999998529
Q gi|254780432|r  349 RDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       349 ~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~~  392 (392)
                      +++|+++.+.+ |.++|.|||+||++|||+++++|+++|.++++
T Consensus       413 ~~~Gll~~~~g-~~~~l~PPL~it~~eid~~l~~l~~al~ev~~  455 (466)
T PRK07036        413 QERGLLVRPLE-HLCVLSPPLIITRAQIDEIVAILRAAIEETAD  455 (466)
T ss_pred             HHCCEEEEECC-CEEEEECCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             96994999669-88999899768999999999999999999999


No 42 
>PRK06058 4-aminobutyrate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=751.65  Aligned_cols=379  Identities=34%  Similarity=0.528  Sum_probs=340.1

Q ss_pred             CEECCCCC-CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCHHHHHHHHH
Q ss_conf             14515588-8874898501037996799764641022674357878999999999999731450687-578189999986
Q gi|254780432|r    5 DFLFNTYD-QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL-YQSTQQEIFANH   82 (392)
Q Consensus         5 ~~~~~~~~-~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~-~~~~~~~~la~~   82 (392)
                      +++.+++. ++|++|+||+|+||||.|||+||||.+|+|+++|||+||+|.+|+++|+++++|+... ..++...+|+++
T Consensus        28 ~~~~~~~~~~~Pv~i~ra~G~~l~D~dG~~ylD~~sg~~~~~lGh~~p~v~~Ai~~Q~~~l~h~~~~~~~~~~~~~lae~  107 (446)
T PRK06058         28 AAVARGVGSTLPVYVARAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPAVVDAVRAQVARFTHTCFMVTPYEGYVAVAEQ  107 (446)
T ss_pred             HHCCCCCCCCCCCEEEEEECCEEEECCCCEEEEECCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             75589989999927997031989969969887803347751217898999999999997435722466654789999999


Q ss_pred             HHHHCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC
Q ss_conf             5201013---33123565554035677766543200134786002343546565432123455321-1347999864333
Q gi|254780432|r   83 LIHSTFA---DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFGPKIEGF  158 (392)
Q Consensus        83 L~~~~~~---~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~p~~~~~  158 (392)
                      |++..|.   ++++|+||||||||+|||+||+|      |+|++||+|+++|||+|.+++++|+.. .++.+|+|..+++
T Consensus       108 L~~~~p~~~~~~~~~~~SGSEAvE~AiKlAR~~------tgr~~iis~~~~YHG~t~~~~~~t~~~~~~~~~~~p~~p~~  181 (446)
T PRK06058        108 LNRLTPGDHEKRSALFNSGAEAVENAVKIARSY------TGKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPEV  181 (446)
T ss_pred             HHHHCCCCCCCEEEECCCCHHHHHHHHHHHHHH------CCCCEEEEECCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCC
T ss_conf             998578766626772488668999999999975------69987999769868898730211278866434678899984


Q ss_pred             CCCCC----HH------------------HHHHHHHC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEE
Q ss_conf             22210----02------------------68875410-123322223332222112462101232211022345721310
Q gi|254780432|r  159 DQAKF----CD------------------LQSLKNQI-SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIF  215 (392)
Q Consensus       159 ~~~~~----~d------------------~~~l~~~~-~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~  215 (392)
                      .++|+    .+                  ++.+++.+ +++|||||+|||||++|+++||++||++||++|++||++||+
T Consensus       182 ~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~iAavi~EPiqg~gG~~~p~~~yl~~lr~lc~~~gillI~  261 (446)
T PRK06058        182 YRAPLSYPYRDGLLDKELATDGEEAAARAITVIDKQIGADNLAAVIIEPIQGEGGFIVPAEGFLPALLDWCRENGVVFIA  261 (446)
T ss_pred             EECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEC
T ss_conf             56688877666333556222389999999999997438997799997277688898679889999999999874925870


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             11003444455531011124545302103444444344321000111222223322345321111001233455432012
Q gi|254780432|r  216 DEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD  295 (392)
Q Consensus       216 DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~  295 (392)
                      |||||||||||+||++|++||+|||+|+||+|+||+|+|||++++++++.+.++.|++||+|||++||||+++|++++++
T Consensus       262 DEV~TGfGRtG~~fa~e~~gv~PDivt~gKgl~gG~Plsav~~~~ei~~~~~~~~~g~T~~Gnpla~aaala~L~~i~~e  341 (446)
T PRK06058        262 DEVQTGFARTGAMFACEHEGIVPDLITTAKGIAGGLPLSAVTGRAEIMDAPHVGGLGGTYGGNPVACAAALAAIETIESD  341 (446)
T ss_pred             CCCEECCCCCCCCHHHHHCCCCCCEEEECHHCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             43120677556604565358899854422101378885100046988606767876778898989999999999999865


Q ss_pred             CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC---------HHHHHHHHHHCCEEEEECC--CCEEE
Q ss_conf             221011210000268899998867970755046400999872499---------8999999996898996268--98899
Q gi|254780432|r  296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS---------PALLAAKFRDECLLTAPSS--DNVVR  364 (392)
Q Consensus       296 ~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~---------~~~~~~~l~~~Gll~~~~~--~~~ir  364 (392)
                      ++++|++++|++|+++|++++++|| +|.+|||+|||+++|++.+         ...+..+++++|+++.+.+  +|+||
T Consensus       342 ~l~~~v~~~g~~l~~~L~~l~~~~~-~i~dvRG~GLm~gielv~~~~~~~~~~~~~~v~~~~~~~Gll~~~~g~~g~~lr  420 (446)
T PRK06058        342 DLVARARQIERLVTDRLGALQAEDD-RIGDVRGRGAMIAIELVKSGTTEPDAELTKALAAAAHAAGVIVLTCGTYGNVIR  420 (446)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEECCEEEEEEEEECCCCCCCHHHHHHHHHHHHHCCCEEECCCCCCCEEE
T ss_conf             6999999998999999999986099-788776454699999930888895989999999999978988962588999899


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             55898688999999999999999985
Q gi|254780432|r  365 ILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       365 l~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      |.|||+||++|||+++++|+++|.+|
T Consensus       421 l~PPL~it~~eid~~l~il~~al~ev  446 (446)
T PRK06058        421 LLPPLVISDELLSEGLDVLEAALADL  446 (446)
T ss_pred             EECCEECCHHHHHHHHHHHHHHHHHC
T ss_conf             97994578999999999999999749


No 43 
>PRK06917 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=748.34  Aligned_cols=387  Identities=30%  Similarity=0.478  Sum_probs=343.9

Q ss_pred             CCEE-CCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHHHH
Q ss_conf             3145-1558888748985010379967997646410226743578789999999999997314506-8757818999998
Q gi|254780432|r    4 NDFL-FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEIFAN   81 (392)
Q Consensus         4 ~~~~-~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~la~   81 (392)
                      ++|+ .++|.+.+++|+||+|+||||.|||+||||.+|+|+++|||+||+|.+|+++|++++.++. ..+.++..++|++
T Consensus         2 ~~~~~~~~~~~p~Pvi~rg~G~~l~D~dG~~ylD~~sg~~~~~lGh~~p~i~~ai~~q~~~~~~~~~~~~~~~~~~~la~   81 (447)
T PRK06917          2 RDYLIKPLLGQPYPMISHGKGVYLYDQNGNKYFDGSSGAVTAGIGHGVKEIADVIKEQAEEVSFVYRSQFTSEPAEKLAK   81 (447)
T ss_pred             CCEECCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHH
T ss_conf             85003787899882699637799997997999983235898982899799999999998538873666424589999999


Q ss_pred             HHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             6520101--33312356555403567776654320013478600234354656543212345532113479998643332
Q gi|254780432|r   82 HLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFD  159 (392)
Q Consensus        82 ~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~  159 (392)
                      +|++..|  .++++|+||||||||+|||+||+|+..++.|+|++||+|+++|||+|.+++|+|+.+.+++.|.|..+++.
T Consensus        82 ~l~~~~p~~~~~~~f~~SGsEAvE~AiKlA~~y~~~r~~t~r~~Iis~~~syHG~T~ga~s~sg~~~~~~~~~~~~~~~~  161 (447)
T PRK06917         82 KLSDLSPGDLNWSFFVNSGSEANETAMKIAIQHWQERGIQGKHKILSRWMSYHGITMGALSMSGHPLRRQRFVSILEDYP  161 (447)
T ss_pred             HHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             99985788878799628789999999999999999838999848999505514666603662388211478788788977


Q ss_pred             CCCCHH-----------------HHHHHHHC----CCCCCCCCCCCCCCC-CCCCCCCHHHHHHHHCCCCCCCCEEEECC
Q ss_conf             221002-----------------68875410----123322223332222-11246210123221102234572131011
Q gi|254780432|r  160 QAKFCD-----------------LQSLKNQI----SNDTAAILIEPIQGE-GGVRKVPEEFLQQLRKICDDIDALLIFDE  217 (392)
Q Consensus       160 ~~~~~d-----------------~~~l~~~~----~~~iAavi~Epv~g~-~G~~~~~~~~l~~l~~lc~~~g~llI~DE  217 (392)
                      .++.++                 ++.+++.+    +++|||||+|||||+ ||.++||++||++||++|++||++||+||
T Consensus       162 ~~~~p~~~r~~~~~~~~~~~~~~~~~le~~i~~~~~~~iAAvi~EPi~g~~Gg~~~p~~~yl~~lr~lc~~~gillI~DE  241 (447)
T PRK06917        162 TISAPYCYRCPVQKVYPTCQLACATELERSIERIGAEHIAAFIAEPIIGAAGGAVVPPKGYYKVIKDICSHYDILFIADE  241 (447)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEECCCCCEECCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             44898655777776540358999999999999738877469997130305797164687899999999652695289741


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             0034444555310111245453021034444443-4432100011122222332----2345321111001233455432
Q gi|254780432|r  218 VQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS----HGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       218 V~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~~----~~~T~~gnpl~~aaa~a~L~~l  292 (392)
                      |||||||||+||++|++||+|||+|+||+|+||| |+|+++++++|++.+.++.    |++||+|||++||||+++|+++
T Consensus       242 V~tGfGRtG~~fa~e~~gv~PDii~~gK~l~gG~~Pl~av~~~~~i~~~~~~g~~~~~~g~Tf~gnpla~aaa~a~L~~l  321 (447)
T PRK06917        242 VMTGLGRTGAWFAMEHWGVEPDIMTLGKGLGAGYTPMAATVVSDRVMEPILRGSRSVMSGHTLSANPLSAATALAVIEYM  321 (447)
T ss_pred             CEECCCCCCCCCHHHHCCCCCCEEEECHHHCCCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             10078756874315335989778977401118987738998818988654058876201778989999999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-------------HHHHHHHHHCCEEEEEC-
Q ss_conf             0122210112100002688999988679707550464009998724998-------------99999999689899626-
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-------------ALLAAKFRDECLLTAPS-  358 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-------------~~~~~~l~~~Gll~~~~-  358 (392)
                      +++++++|++++|++|+++|+++.++| +++.+|||+|||++||++.+.             ..+...++++||++.+. 
T Consensus       322 ~~~~l~~~~~~~G~~l~~~L~~l~~~~-~~i~dVRG~GLm~giel~~d~~~~~~~~~~~~~a~~i~~~~~~~Gll~~~~~  400 (447)
T PRK06917        322 EKHNLPEKTAEKGEYLIKGLQEVQQQS-TIIGDVRGKGLLIGVEFVADQKTKKPFPQPFSKASELISVAAKNGLLLYPAV  400 (447)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECC
T ss_conf             864599999999999999999998639-9778765156169999842665567787248999999999997898898744


Q ss_pred             ------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             ------898899558986889999999999999999852
Q gi|254780432|r  359 ------SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       359 ------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                            .+|+|||.|||+||++|||+++++|++++.++.
T Consensus       401 ~~~~g~~~~~lrl~PPL~it~~eid~~i~~l~~al~ev~  439 (447)
T PRK06917        401 SGQAGKEGSALLIAPPMTTTYSELDELLSIFAKSVEEMM  439 (447)
T ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             567789999899979922789999999999999999999


No 44 
>PRK06918 4-aminobutyrate aminotransferase; Reviewed
Probab=100.00  E-value=0  Score=747.78  Aligned_cols=379  Identities=33%  Similarity=0.559  Sum_probs=343.1

Q ss_pred             CEECCCC-CCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHHHHH
Q ss_conf             1451558-888748985010379967997646410226743578789999999999997314506-87578189999986
Q gi|254780432|r    5 DFLFNTY-DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEIFANH   82 (392)
Q Consensus         5 ~~~~~~~-~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~la~~   82 (392)
                      +|..+++ .++|++|+||+|+||||.|||+||||++|+|+.++||+||+|++|+++|++++.|.. ..+.++...+|+++
T Consensus        27 ~~~~~~~~~~~P~vi~ra~G~~l~D~dG~~yLD~~~g~~~~~lGh~~p~v~~Ai~~Q~~~l~~~~~~~~~~~~~~~lae~  106 (454)
T PRK06918         27 NIVPKGVSNGIPTFVQSANGALVTDVDGNQYIDFAGAIGTINVGHCHPKVKEALHKQVDQYIHTGFNVMMYEPYIELAEK  106 (454)
T ss_pred             HHCCCCCCCCCCCEEEEEECCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             76799889999817997061989979979999915069865526897999999999986466767775547699999999


Q ss_pred             HHHHCC--CC-CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC
Q ss_conf             520101--33-3123565554035677766543200134786002343546565432123455321-1347999864333
Q gi|254780432|r   83 LIHSTF--AD-RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFGPKIEGF  158 (392)
Q Consensus        83 L~~~~~--~~-~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~p~~~~~  158 (392)
                      |++..|  .+ +|+|++|||||||+|||+||+|      |+|++||+|+++|||+|.+++|+|++. .++.+|+|..+++
T Consensus       107 L~~~~p~~~~~~v~f~~SGsEAvE~AlKlAr~~------t~r~~ii~~~~~yHG~T~~a~s~t~~~~~~~~~~~p~~p~~  180 (454)
T PRK06918        107 LAALAPGSFDKQVLFLNSGAEAVENAVKIARKY------TKRQGIIAFSKGFHGRTLMTMTMTSKVKPYKFGFGPFAPEV  180 (454)
T ss_pred             HHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHH------CCCCCEEEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             998477454746998278517999999999987------28875676338717862445653079854224678889983


Q ss_pred             CCCCCHH-----------------HHHHHHH-----CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEEC
Q ss_conf             2221002-----------------6887541-----01233222233322221124621012322110223457213101
Q gi|254780432|r  159 DQAKFCD-----------------LQSLKNQ-----ISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFD  216 (392)
Q Consensus       159 ~~~~~~d-----------------~~~l~~~-----~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~D  216 (392)
                      .++|+++                 ++.+++.     .+++|||||+|||||++|+++||++||++||++|++||++||+|
T Consensus       181 ~~~p~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iAAvi~EPiqg~gG~~~p~~~yl~~lr~lc~~~gillI~D  260 (454)
T PRK06918        181 YKAPFPYEYRRPEGLTEEQYDDFIIEEFKNFFISEVAPETIAAVVMEPVQGEGGFIVPSKKFVQEVRNICSEHGILFVAD  260 (454)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             66578642357789976677899999999999862488866899996887888986689899999999885649168720


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCC
Q ss_conf             10034444555310111245453021034444443443210001112222233223453211110012334554320122
Q gi|254780432|r  217 EVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDG  296 (392)
Q Consensus       217 EV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~  296 (392)
                      ||||||||||+||++|++|++|||+|+||+||||+|+|||++++++++.+.++.+++||+|||++||||+++|++|++++
T Consensus       261 EV~tGfGRtG~~fa~e~~gv~PDiv~~gK~lg~G~Plsav~~~~~i~~~~~~~~~~~Tf~gnpla~aaa~a~L~~i~~e~  340 (454)
T PRK06918        261 EIQTGFSRTGKYFAIDHYDVVPDLITVSKSLGAGVPISGVIGRKEIMNEAAPGELGGTYAGSPLGCAAALAVLDIIEKEN  340 (454)
T ss_pred             ECCCCCCCCCCCCHHHCCCCCCEEEEECCHHHCCCCCCCEEECHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             11248761357402222798985999772655899872265218876046886715617989899999999999998668


Q ss_pred             CCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC----------HHHHHHHHHHCCEEEEECC--CCEEE
Q ss_conf             21011210000268899998867970755046400999872499----------8999999996898996268--98899
Q gi|254780432|r  297 FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS----------PALLAAKFRDECLLTAPSS--DNVVR  364 (392)
Q Consensus       297 l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~----------~~~~~~~l~~~Gll~~~~~--~~~ir  364 (392)
                      +++|++++|++|+++|++++++|| .+.+|||+|||+++|++.+          ...+.+.++++|+++.+.+  +|+||
T Consensus       341 l~~~~~~~G~~l~~~L~~l~~~~p-~v~~vRG~Gl~~gvelv~d~~~~~p~~~~~~~i~~~~~~~Gll~~~~g~~~~vlr  419 (454)
T PRK06918        341 LNDRAIELGKVVMNRFEEMKNKYN-CIGDVRGLGAMCAFELVQDRKTKEPDKTLTANLCAEANKRGLLLLSAGTYGNVIR  419 (454)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCC-CEEEEECCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCEEE
T ss_conf             999999999999999999986299-8688822647999999506766897799999999999968959984688999899


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             55898688999999999999999985
Q gi|254780432|r  365 ILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       365 l~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      |.|||+||++|||+++++|+++|+++
T Consensus       420 ~~PPL~it~~eid~~l~~l~~al~a~  445 (454)
T PRK06918        420 VLMPLVITDEQLEEGLTIIEESLQAC  445 (454)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             97882289999999999999999999


No 45 
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism]
Probab=100.00  E-value=0  Score=750.51  Aligned_cols=386  Identities=33%  Similarity=0.539  Sum_probs=346.9

Q ss_pred             CCCEECCCCCC------CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHH
Q ss_conf             43145155888------87489850103799679976464102267435787899999999999973145068-757818
Q gi|254780432|r    3 KNDFLFNTYDQ------SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQ   75 (392)
Q Consensus         3 ~~~~~~~~~~~------~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~   75 (392)
                      +.+|+||.|.+      .|.+|+||+|+|+||.|||+|||.+||+||+|+||+||+|.+|+++|++++.|++. .+.+.+
T Consensus         9 d~~~~whP~t~~~~~~~~~~~i~~aeG~yl~d~~G~r~lDg~sg~W~~~~Gh~~~~i~~Ai~~Q~~~l~~~~~~~~t~~P   88 (449)
T COG0161           9 DLSHLWHPFTQMRDPLAEPRVIVRAEGVYLTDIDGRRYLDGMSGLWCVNHGHGRPEIAEAIKKQLDKLPHVMFGGFTHEP   88 (449)
T ss_pred             HHHHEECCCCCCCCCCCCCEEEEECCEEEEEECCCCEEEECCCHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHCCCCCCH
T ss_conf             46424365445665555561466364369997899899752107788634769779999999999857740114557836


Q ss_pred             HHHHHHHHHHHCC---CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC
Q ss_conf             9999986520101---333123565554035677766543200134786002343546565432123455321-134799
Q gi|254780432|r   76 QEIFANHLIHSTF---ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGF  151 (392)
Q Consensus        76 ~~~la~~L~~~~~---~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~  151 (392)
                      ..+||++|++..|   +++|||++|||||||.|+|||++||..+|+++|++||+++++|||.|++++|++|.. .++..|
T Consensus        89 a~~LA~~L~~~aP~~~l~~vFf~~sGSeAvEtAlKma~qY~~~~G~p~r~~~Isr~~gYHG~T~ga~Sv~g~~~~~~~~~  168 (449)
T COG0161          89 AIELAEKLAELAPEGGLDHVFFTDSGSEAVETALKMALQYWRARGQPQRKKFISRRNGYHGDTLGAMSVGGPVALRHAFY  168 (449)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHEECCCCHHHHHHHC
T ss_conf             99999999986798775679980896189999999999999965997531899952674766530013568545554301


Q ss_pred             CCCCCCCCCCCCHH-----------------HHHHHHHC----CCCCCCCCCCCCCCC-CCCCCCCHHHHHHHHCCCCCC
Q ss_conf             98643332221002-----------------68875410----123322223332222-112462101232211022345
Q gi|254780432|r  152 GPKIEGFDQAKFCD-----------------LQSLKNQI----SNDTAAILIEPIQGE-GGVRKVPEEFLQQLRKICDDI  209 (392)
Q Consensus       152 ~p~~~~~~~~~~~d-----------------~~~l~~~~----~~~iAavi~Epv~g~-~G~~~~~~~~l~~l~~lc~~~  209 (392)
                      .+.++.+.+++.++                 +++|++.+    +++|||||+|||++. ||+++||++||+++|++|++|
T Consensus       169 ~~ll~~~~~~~~P~~y~~~~~~~~~~~~~~~a~~le~~i~~~g~~~IAAfI~EPv~g~agG~~~pp~~Yl~~vr~iC~ky  248 (449)
T COG0161         169 DPLLPEVLHLPAPYAYRRGFFGEGDEEFAEAADELEALILEHGPETIAAFIVEPVVGGAGGMLVPPPGYLKRVREICDKY  248 (449)
T ss_pred             CCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             44455762268996434577777748899999999999986095528999955200566775418768999999999983


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCHH
Q ss_conf             721310110034444555310111245453021034444443-443210001112222233-----22345321111001
Q gi|254780432|r  210 DALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG-----SHGSTYGGNVLAMV  283 (392)
Q Consensus       210 g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~-----~~~~T~~gnpl~~a  283 (392)
                      |||||+|||.|||||||+|||+|++||+|||+|+||+|+||| |+||++++++|++.+..+     .||+||+|||++||
T Consensus       249 ~ILlI~DEV~tGFGRTG~~FA~e~~gi~PDi~~~aKGLT~GY~Pl~a~l~~~~I~~~~~~~~~~~f~HG~TYsghPlacA  328 (449)
T COG0161         249 GILLIADEVATGFGRTGKMFACEHAGIVPDILCLAKGLTGGYLPLSAVLTSDRIYEAFSDGDAGAFMHGHTYSGNPLACA  328 (449)
T ss_pred             CCEEEECCCEECCCCCCHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCHHHHH
T ss_conf             94799301100788575155665259997846551310126501076750599999986466870144786644899999


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCHH-----------HHHHHHHHCC
Q ss_conf             23345543201222101121000026889999886797075504640099987249989-----------9999999689
Q gi|254780432|r  284 LGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA-----------LLAAKFRDEC  352 (392)
Q Consensus       284 aa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~~-----------~~~~~l~~~G  352 (392)
                      ||+++|++++++++++|+++++.+|.++|+++...+| .|.||||+|+|.+||++.+..           .+.+.++++|
T Consensus       329 aAla~L~i~e~e~l~~~~~~~~~~l~~~L~~~l~~~p-~VgdVR~~Gli~~iElv~d~~t~~~f~~~~~~~~~~~~~e~G  407 (449)
T COG0161         329 AALANLDILEEEDLLERVAEIGAYLQAGLQAALADHP-LVGDVRGLGLIGAIELVADKATKTPFEARVGARVRAAALERG  407 (449)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCC-CEEEEECCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             9998899998567999999999999999987513699-278722265599999841566666404569999999999789


Q ss_pred             EEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             89962689889955898688999999999999999985
Q gi|254780432|r  353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       353 ll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      ++++|.+ ++|.|+|||+||++|||++++++.+++.+.
T Consensus       408 l~iRp~g-~~i~~~PPliit~~eid~l~~~l~~al~~~  444 (449)
T COG0161         408 LLIRPLG-DVIYLMPPLIITREEIDELVDALREALDET  444 (449)
T ss_pred             EEEEECC-CEEEECCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             3895559-889973883489999999999999999998


No 46 
>PRK08088 4-aminobutyrate aminotransferase; Validated
Probab=100.00  E-value=0  Score=748.17  Aligned_cols=382  Identities=34%  Similarity=0.534  Sum_probs=341.3

Q ss_pred             CCCEECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHH
Q ss_conf             43145155888-87489850103799679976464102267435787899999999999973145068-75781899999
Q gi|254780432|r    3 KNDFLFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFA   80 (392)
Q Consensus         3 ~~~~~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la   80 (392)
                      ++++++++|.+ +|++|+||+|+||||.|||+||||.||+|+++|||+||+|++|+++|+++++|+.. .+.++...+|+
T Consensus        12 ~~~~~~~~~~~~~Pi~i~ra~G~~l~D~dG~~YLD~~~g~~~~~lGH~hp~i~~Av~~q~~~l~~~~~~~~~~~~~~~la   91 (426)
T PRK08088         12 RSAAVPRGVGQIHPIFADRAENCTVWDVEGREYIDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYEPYLELC   91 (426)
T ss_pred             HHHHCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             99755898898999339973529899699899999151688651089969999999999864788567755667999999


Q ss_pred             HHHHHHCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             865201013---331235655540356777665432001347860023435465654321234553211-3479998643
Q gi|254780432|r   81 NHLIHSTFA---DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQ-YLEGFGPKIE  156 (392)
Q Consensus        81 ~~L~~~~~~---~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~-~~~~~~p~~~  156 (392)
                      ++|++..|.   ++++|++|||||||+|||+||.|      |+|++||+|+++|||+|.+++++|++.. +..++++.+.
T Consensus        92 e~l~~~~p~~~~~~v~f~~sGsEAve~AiklAR~~------tgr~~ii~~~~syHG~t~~a~s~tg~~~~~~~~~~~~~~  165 (426)
T PRK08088         92 EKMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAA------TKRSGVIAFTGAYHGRTHYTLALTGKVNPYSAGMGLMPG  165 (426)
T ss_pred             HHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHHH------HCCCCEEEECCCCCCCCCCHHHHCCCCCCCCCCCCCCCC
T ss_conf             99998577555655885497699999999998776------436663663577489852125424887776677889998


Q ss_pred             CCCCCCC----------HHHHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCC
Q ss_conf             3322210----------0268875410-----123322223332222112462101232211022345721310110034
Q gi|254780432|r  157 GFDQAKF----------CDLQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTG  221 (392)
Q Consensus       157 ~~~~~~~----------~d~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG  221 (392)
                      ++.+.++          ++++.+++.+     +++|||||+|||||++|+++||++||+++|++|++||++||+||||||
T Consensus       166 ~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~iAAvi~EPi~g~gG~~~~~~~yl~~lr~lc~~~g~llI~DEV~tG  245 (426)
T PRK08088        166 HVYRALYPCPLHGVSEDDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADEVQTG  245 (426)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHCCCEEECCCCCCC
T ss_conf             74026688623578816799999999974478776789997775677886638879999999999876905876330228


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHH
Q ss_conf             44455531011124545302103444444344321000111222223322345321111001233455432012221011
Q gi|254780432|r  222 YGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV  301 (392)
Q Consensus       222 ~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~  301 (392)
                      |||||+||++|++|++|||+|+||+|+||||+|||++++++++.+.++.|++||+|||++||||+++|++|+++++++|+
T Consensus       246 fGRtG~~fa~~~~gv~PDii~~gK~l~gG~Plsav~~~~~i~~~~~~~~~~~T~~gnpla~Aaa~a~L~~l~~e~l~~~~  325 (426)
T PRK08088        246 AGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAGNPIACAAALAVLEVFEEENLLQRA  325 (426)
T ss_pred             CCCCCCHHHHHHCCCCCCEEEHHHHHCCCCCCCCEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHH
T ss_conf             77667413566419897620121440388875000003999953368887888898989999999999999865899999


Q ss_pred             HHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEECC--CCEEEECCCC
Q ss_conf             2100002688999988679707550464009998724998----------999999996898996268--9889955898
Q gi|254780432|r  302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLLTAPSS--DNVVRILPPL  369 (392)
Q Consensus       302 ~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~Gll~~~~~--~~~irl~Ppl  369 (392)
                      +++|++|+++|+++.++|| .|.+|||+|||+++|++.+.          ..+..+++++|+++.+.+  +|+|||.|||
T Consensus       326 ~~~G~~l~~~L~~l~~~~p-~i~~VRG~GLm~gvelv~~~~~~~p~~~~~~~i~~~~~~~Gll~~~~g~~gnvir~~PPL  404 (426)
T PRK08088        326 NALGERLKDGLLAIAEKHP-EIGDVRGLGAMIAIELFEDGDHSKPAAKLTAQIVARARDKGLILLSCGTYYNVLRILVPL  404 (426)
T ss_pred             HHHHHHHHHHHHHHHHHCC-CEEEEEECCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCEEEEECCE
T ss_conf             9999999999999986099-889999445599999860687678789999999999996899998338999989997893


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             6889999999999999999852
Q gi|254780432|r  370 TITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       370 ~it~~eid~~i~~l~~al~~L~  391 (392)
                      +||++|||+++++|+++|.|..
T Consensus       405 ~it~~eid~~~~~l~~al~ea~  426 (426)
T PRK08088        405 TIEDAQIRQGLEIIAQCFDEAK  426 (426)
T ss_pred             ECCHHHHHHHHHHHHHHHHHHC
T ss_conf             4789999999999999999539


No 47 
>PRK06777 4-aminobutyrate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=747.20  Aligned_cols=374  Identities=34%  Similarity=0.538  Sum_probs=337.1

Q ss_pred             CCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHHHHHHH
Q ss_conf             155888-87489850103799679976464102267435787899999999999973145068-7578189999986520
Q gi|254780432|r    8 FNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFANHLIH   85 (392)
Q Consensus         8 ~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la~~L~~   85 (392)
                      -+.|.+ .|++++||+|+||||.|||+||||+||+|++++||+||+|++|+++|++++.|+.. .+.++...+|+++|++
T Consensus        15 ~~~~~~~~~~~~~rg~G~yl~D~dG~~ylD~~sg~~~~~lGh~~p~i~~Ai~~Ql~~l~~~~~~~~~~~~~~~lae~l~~   94 (421)
T PRK06777         15 PRGIGVMCDFYAVRAENATLWDEEGREYIDFAAGIAVLNTGHRHPKVMAAVRQQLDQFTHTAYQIVPYASYVTLAERINS   94 (421)
T ss_pred             CCCCCCCCCEEEEECCCCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             89878899879996724989969879998935338752024798999999999986135745545566699999999997


Q ss_pred             HCC---CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             101---33312356555403567776654320013478600234354656543212345532-11347999864333222
Q gi|254780432|r   86 STF---ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK-LQYLEGFGPKIEGFDQA  161 (392)
Q Consensus        86 ~~~---~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~-~~~~~~~~p~~~~~~~~  161 (392)
                      ..|   .+|++|++|||||||+|||+||+|      |+|++||+|+++|||+|++++++|++ ..++.+++|.+..+.+.
T Consensus        95 ~~p~~g~~~v~f~~SGSEAve~AiKlAr~~------tgr~~ii~~~~syHG~t~~a~s~tg~~~~~~~~~~p~p~~~~~~  168 (421)
T PRK06777         95 LAPISGNSKTAFFTTGAEAVENAVKIARAA------TGRPGVIAFSGAFHGRTLLTMALTGKVAPYKVGFGPFPGSIFHA  168 (421)
T ss_pred             HCCCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCCEEEECCCCCCCCHHHEECCCCCCCCCCCCCCCCCCEEEC
T ss_conf             477667644999678278999999999986------39996377578769963433001588775446778999860223


Q ss_pred             CCHH----------HHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC
Q ss_conf             1002----------68875410-----12332222333222211246210123221102234572131011003444455
Q gi|254780432|r  162 KFCD----------LQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTG  226 (392)
Q Consensus       162 ~~~d----------~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG  226 (392)
                      ++++          ++.+++.+     +++|||||+|||||++|+++||++||+++|++|++||++||+|||||||||||
T Consensus       169 ~~p~~~~~~~~~~~~~~l~~~~~~~~~~~~iAAvi~EPiqg~gG~~~~p~~yl~~lr~lc~~~gillI~DEV~tGfGRtG  248 (421)
T PRK06777        169 LYPNELYGVSVEEAISSVERLFRCDISPTQVAAILLEPIQGEGGFNIAPPEFVSALRTLCDEHGILLIADEVQTGFARTG  248 (421)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCEECCHHHHHHHHHHHHHCCCEEEECCCEECCCCCC
T ss_conf             68972246568999999999997505888589999835437888640999999999999998397797112110677567


Q ss_pred             CCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCC
Q ss_conf             53101112454530210344444434432100011122222332234532111100123345543201222101121000
Q gi|254780432|r  227 KLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK  306 (392)
Q Consensus       227 ~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~  306 (392)
                      +||++|+|||+|||+|+||+|+||+|+||++++++|++.+.++.|++||+|||++||||+++|++++++++++|++++|+
T Consensus       249 ~~fa~e~~gv~PDiv~~gKgl~gG~P~~av~~~~~i~~~~~~~~~~~Tf~G~pl~caaa~a~L~~i~~~~l~~~~~~~g~  328 (421)
T PRK06777        249 KLFAMEYYDTKVDLITMAKSLGGGMPISAVTGRADVMDAPLPGGLGGTYAGNPLAVAAALAVLDVIAEEKLCERALILGA  328 (421)
T ss_pred             CCCHHHCCCCCCCEEEECCCCCCCCCEEEEEECHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHH
T ss_conf             84343158777978874400258765078986278752578876378899898999999999999986359999999999


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC---------HHHHHHHHHHCCEEEEECC--CCEEEECCCCCCCHHH
Q ss_conf             0268899998867970755046400999872499---------8999999996898996268--9889955898688999
Q gi|254780432|r  307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS---------PALLAAKFRDECLLTAPSS--DNVVRILPPLTITAEE  375 (392)
Q Consensus       307 ~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~---------~~~~~~~l~~~Gll~~~~~--~~~irl~Ppl~it~~e  375 (392)
                      +|.++|+++..+|| .|.+|||+|||+++|+..+         ...+..+++++|+++.+.+  +|+|||.|||+||++|
T Consensus       329 ~l~~~L~~l~~~~p-~v~dVRG~GL~~gie~~d~~~~~~~~~~~~~i~~~~~~~Glll~~~g~~~nvir~~PPL~it~~e  407 (421)
T PRK06777        329 KLVEVLEKAQMSNA-AIVGIRARGSMVAVEFNDPVTGKPSPELTRAYQRQALEEGLLLLSCGVHGNVIRFLYPLTIPDKQ  407 (421)
T ss_pred             HHHHHHHHHHHHCC-CEEEEECCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCEEEEECCCCCCHHH
T ss_conf             99999999885589-88986236489999971687789589999999999997898898458999989997995478999


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999999
Q gi|254780432|r  376 IHEGLERIERTAI  388 (392)
Q Consensus       376 id~~i~~l~~al~  388 (392)
                      ||+++++|+++|.
T Consensus       408 id~~~~il~~aL~  420 (421)
T PRK06777        408 FKKAMNILTRLLA  420 (421)
T ss_pred             HHHHHHHHHHHHC
T ss_conf             9999999999974


No 48 
>PRK07894 consensus
Probab=100.00  E-value=0  Score=748.12  Aligned_cols=385  Identities=31%  Similarity=0.454  Sum_probs=339.3

Q ss_pred             CCCEECCCCCC------CCEEEEEECCCEE---EECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCC
Q ss_conf             43145155888------8748985010379---9679976464102267435787899999999999973145068-757
Q gi|254780432|r    3 KNDFLFNTYDQ------SDIRFEKGKGAWL---FSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQ   72 (392)
Q Consensus         3 ~~~~~~~~~~~------~p~~i~~a~G~~i---~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~   72 (392)
                      |++|+||.|.+      .|++|+||+|+|+   ||.|||+|||+.||+|++|+||+||+|++|+++|++++.|+.. .+.
T Consensus        13 D~~~~whp~~~~~~~~~~P~~i~~a~G~~l~~v~D~dG~~ylD~~sg~~~~~lGh~hp~i~~Ai~~Q~~~l~~~~~~~~~   92 (430)
T PRK07894         13 DAAHLWHPYSTIGAEAVPPVVAVAASGAWLTLIRDGGPIEVLDAMSSWWTAIHGHGHPVLDAALTRQLATMNHVMFGGLT   92 (430)
T ss_pred             HHHHCCCCCCCCCCCCCCCEEEEEEEECEECCEECCCCCEEEECCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             99543798888532589986899866176732088999998873067985403769899999999999757784568757


Q ss_pred             CHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC
Q ss_conf             8189999986520101--3331235655540356777665432001347860023435465654321234553211-347
Q gi|254780432|r   73 STQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQ-YLE  149 (392)
Q Consensus        73 ~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~-~~~  149 (392)
                      ++...+|+++|++..|  ++||||+||||||||+|||+||+|+..+|.|+|++||++++||||+|++++|+++... .+.
T Consensus        93 ~~~~~~lae~L~~~~p~~l~~vff~~sGSeAvE~AiKlAr~y~~~~g~~~r~~ii~~~~sYHG~T~ga~s~t~~~~~~~~  172 (430)
T PRK07894         93 HEPAARLAQLLVDITPAGLDTVFFSDSGSVSVEVAVKMALQYWRSRGRPGKHRLMTWRGGYHGDTFTPMSVCDPDGGMHS  172 (430)
T ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCEEEEEECCCCCCCC
T ss_conf             68999999999984888879799727818899999999999999718877507999717404777114775338777666


Q ss_pred             CCCCCCCCCCC---CC-------CHHHHHHHHHCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC
Q ss_conf             99986433322---21-------0026887541012332222333-2222112462101232211022345721310110
Q gi|254780432|r  150 GFGPKIEGFDQ---AK-------FCDLQSLKNQISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV  218 (392)
Q Consensus       150 ~~~p~~~~~~~---~~-------~~d~~~l~~~~~~~iAavi~Ep-v~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV  218 (392)
                      .+.+..+....   .|       ..+++.+.+...++|||||+|| +||+||+++||++||++||++|++||+|||+|||
T Consensus       173 ~~~~~~~~~~~~~~~p~~~~~~~~~~l~~~l~~~~~~iAaii~EP~iqg~GG~~~p~~~yl~~lr~lc~~~gillI~DEV  252 (430)
T PRK07894        173 LWTDVLARQVFAPQVPRDYDPAYSAAFEAQLAQHADELAAVIVEPVVQGAGGMRFHDPRYLRDLRDICDRHDVLLIFDEI  252 (430)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCC
T ss_conf             66788877666899974326788999999998469986699997874388981028999999999987512762650213


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             034444555310111245453021034444443-443210001112222233-----22345321111001233455432
Q gi|254780432|r  219 QTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG-----SHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       219 ~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~-----~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
                      ||||||||+||++|++|++|||+|+||+||||| |+||++++++|++.+..+     .|++||+|||++||||+++|+++
T Consensus       253 ~tGfGRTG~~fa~e~~gv~PDii~~aKgl~gGy~Pl~avl~~~~i~~~~~~~~~~~~~Hg~Ty~GnplacAaala~L~~i  332 (430)
T PRK07894        253 ATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLTLAATLCTADVAHTISAGEAGALMHGPTFMANPLACAVSVASVELL  332 (430)
T ss_pred             CCCCCCCCCCCHHHCCCCCCEEEEECCHHHCCCCCCEEEEEHHHHHHHCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             11787356763543189886399977354489976201224298997456788886123789888989999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEEEECCCCC
Q ss_conf             012221011210000268899998867970755046400999872499--899999999689899626898899558986
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVVRILPPLT  370 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~  370 (392)
                      +++++++|++++|++|+++|+++. ++| .|.+|||+|+|+++|+..+  .....+.++++|+++++. +|+|+|+|||+
T Consensus       333 ~~e~l~~~~~~~g~~l~~~L~~l~-~~p-~V~dVRg~Gl~~~vel~~~~~~~~~~~~a~~~Gvl~r~~-~n~i~l~PPL~  409 (430)
T PRK07894        333 LGQDWRTRVAEIEAGLTAGLAPAR-ALP-GVTDVRVLGAIGVIELDRPVDLAVATPAALDHGVWLRPF-RNLVYAMPPYI  409 (430)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHC-CCC-CEEEECCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEEC-CCEEEEECCCC
T ss_conf             856799999999999999999745-799-769894668099999678456899999999799389854-99999979946


Q ss_pred             CCHHHHHHHHHHHHHHHHHH
Q ss_conf             88999999999999999985
Q gi|254780432|r  371 ITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       371 it~~eid~~i~~l~~al~~L  390 (392)
                      ||++|||+++++|++++++|
T Consensus       410 it~~eid~~~~~l~eal~~l  429 (430)
T PRK07894        410 CTPAEIAQITSAMVEVARAL  429 (430)
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999999999960


No 49 
>PRK07483 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=745.71  Aligned_cols=385  Identities=31%  Similarity=0.548  Sum_probs=342.6

Q ss_pred             CEECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHHHH
Q ss_conf             145155888-87489850103799679976464102267435787899999999999973145068-7578189999986
Q gi|254780432|r    5 DFLFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFANH   82 (392)
Q Consensus         5 ~~~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la~~   82 (392)
                      +|.|+.+.+ .|++|+||+|+||||.|||+||||+||+|+++|||+||+|++|+++|++++.+.+. .+.++..++|+++
T Consensus         2 ~~~~~~~~~~~~Pviv~a~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~~Lae~   81 (443)
T PRK07483          2 THVFHRSPRATLPVAVAGDGIYIIDSTGKRYLDASGGAAVSCLGHSHPRVIAAIKAQIDRLAYAHTSFFTTEPAEALADR   81 (443)
T ss_pred             CCCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             97778888899997896555989979979999835188977447997999999999983368744575577899999999


Q ss_pred             HHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             520101--333123565554035677766543200134786002343546565432123455321134799986433322
Q gi|254780432|r   83 LIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQ  160 (392)
Q Consensus        83 L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~  160 (392)
                      |++..|  .++++|+||||||||+|||+||+|+..++.|+|++||+|+++|||+|.++++++++.+++++|.|..+++.+
T Consensus        82 L~~~~p~~~~~v~f~~sGsEAve~AiklAr~y~~~~g~~~r~~ii~~~~~yHG~t~gals~sg~~~~~~~~~p~~~~~~~  161 (443)
T PRK07483         82 LVAAAPAGLEHVYFVSGGSEAVEAALKLARQYFVEKGQPQRRHFIARRQSYHGNTLGALAIGGNAWRREPFAPLLIEAHH  161 (443)
T ss_pred             HHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCHHHCCCCCCCCCCCCCCCCCCEE
T ss_conf             99857888587999686688999999999999987189987289998378878850011014761015888888888444


Q ss_pred             CC----CHH--------------HHHHHHH----CCCCCCCCCCCCCCCC-CCCCCCCHHHHHHHHCCCCCCCCEEEECC
Q ss_conf             21----002--------------6887541----0123322223332222-11246210123221102234572131011
Q gi|254780432|r  161 AK----FCD--------------LQSLKNQ----ISNDTAAILIEPIQGE-GGVRKVPEEFLQQLRKICDDIDALLIFDE  217 (392)
Q Consensus       161 ~~----~~d--------------~~~l~~~----~~~~iAavi~Epv~g~-~G~~~~~~~~l~~l~~lc~~~g~llI~DE  217 (392)
                      ++    +.+              ++.++..    .+++|||||+|||||+ +|+++||++||++||++|++||++||+||
T Consensus       162 ~~p~~~~~~~~~~~~~~~~~~~~~~~le~~i~~~~~~~iAavi~EPi~g~~gG~~~p~~~fl~~lr~lc~~~gillI~DE  241 (443)
T PRK07483        162 VSPCYAYRDQRAGETDEAYGQRLADELEAKILELGPDTVAAFVAETVVGATAGAVPPVPGYFKRIREVCDRYGVLLILDE  241 (443)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHCCEEEEEEC
T ss_conf             06887544567888878999999999999998608886789998343047588544888999999999986695899961


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             0034444555310111245453021034444443-443210001112222233----22345321111001233455432
Q gi|254780432|r  218 VQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG----SHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       218 V~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~----~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
                      |||||||||+||++|++||+|||+|+||+||||| |+||++++++|++.+.++    .|++||+|||++||||+++|++|
T Consensus       242 V~tGfGRtG~~fa~e~~gv~PDiv~~gKgl~gG~~Pl~a~~~~~~i~~~~~~~~~~~~hg~T~~gnpla~aaa~a~L~~i  321 (443)
T PRK07483        242 VMCGMGRTGTLFACEEDGVAPDLLTIAKGLGAGYQPIGAVLASDRIYDAIADGSGFFQHGHTYLGHATACAAALAVQRVI  321 (443)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             52278854377530004558981013332248877327997568999754368753345888889989999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--------H-----HHHHHHHHHCCEEEEEC-
Q ss_conf             012221011210000268899998867970755046400999872499--------8-----99999999689899626-
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--------P-----ALLAAKFRDECLLTAPS-  358 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--------~-----~~~~~~l~~~Gll~~~~-  358 (392)
                      +++++++|++++|++|+++|+++.++||. |.+|||+|||+++|++.+        +     ..+...++++||++++. 
T Consensus       322 ~~~~l~~~~~~~g~~l~~~L~~l~~~~p~-I~dVRG~GLm~gielv~~~~~~~~~d~~~~~~~~i~~~~~~~Gll~~~~g  400 (443)
T PRK07483        322 AEDGLLANVRARGEQLRARLRERLGQHPH-VGDIRGRGLFVGVELVADRATKAPFDPALKLHARIKREAMARGLMVYPMG  400 (443)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHCCCC-EEEEECCEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             86469999999999999999999864997-78854041489999732676567777568999999999997895898777


Q ss_pred             ------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             ------89889955898688999999999999999985
Q gi|254780432|r  359 ------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       359 ------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                            .+|+|+|+|||+||++|||+++++|+++|.++
T Consensus       401 ~~~~g~~~~~i~l~PPL~it~~eid~~i~~l~~aL~~v  438 (443)
T PRK07483        401 GTIDGVRGDHVLLAPPFIITAQQIDEIVERLGDAIDAA  438 (443)
T ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             76457769989998996289999999999999999999


No 50 
>PRK06082 4-aminobutyrate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=747.16  Aligned_cols=380  Identities=26%  Similarity=0.476  Sum_probs=346.2

Q ss_pred             CCCEECCCCCCCCE--EEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH
Q ss_conf             43145155888874--8985010379967997646410226743578789999999999997314506875781899999
Q gi|254780432|r    3 KNDFLFNTYDQSDI--RFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFA   80 (392)
Q Consensus         3 ~~~~~~~~~~~~p~--~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la   80 (392)
                      |++|.+|.|.+.|.  +|+||+|+||||.|||+|||| +|.+++++||+||+|++|+++|++++.+++..|.++...+||
T Consensus        42 ~~~~~~h~~~~~p~~~~i~raeG~yl~D~dG~~YLD~-~G~~v~~lGh~hp~v~~Ai~~Q~~~l~~~~~~~~~~~~~~lA  120 (460)
T PRK06082         42 DSEVFLHQAMSTPCLDTLEAAEGIYIQDASGKKYMDF-HGNNVHQLGYGHPHVIKKVTEQIAKLPFSPRRFTNETAIECA  120 (460)
T ss_pred             HHHHHHHHCCCCCCCCEEEECCCCEEEECCCCEEEEE-CCHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH
T ss_conf             5787787517987787146052698997988999983-478768567799999999999997588876552688999999


Q ss_pred             HHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             86520101--3331235655540356777665432001347860023435465654321234553211347999864333
Q gi|254780432|r   81 NHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGF  158 (392)
Q Consensus        81 ~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~  158 (392)
                      ++|++..|  ++||+|+||||||||+|||+||+|      |+|++||+++++|||+|++++|+++.+.++++++|.++++
T Consensus       121 ~~L~~~~p~~l~~v~f~~SGSEAvE~AiKlAr~~------tgr~kiIs~~~syHG~T~~als~~g~~~~r~~~~pl~~g~  194 (460)
T PRK06082        121 EKLTEICGGELNRVLFAPGGTSVIGMALKLARHI------TGNYKVVSLWDSFHGASLDAISVGGEACFRQGMGPLMAGV  194 (460)
T ss_pred             HHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHH------HCCCEEEEECCCCCCCCHHHHHCCCCHHHCCCCCCCCCCC
T ss_conf             9999857877697984396589999999999885------2886489960786776266655049543336888989997


Q ss_pred             CCCCCHH----------------HHHHHHHC--CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCC
Q ss_conf             2221002----------------68875410--12332222333222211246210123221102234572131011003
Q gi|254780432|r  159 DQAKFCD----------------LQSLKNQI--SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQT  220 (392)
Q Consensus       159 ~~~~~~d----------------~~~l~~~~--~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~t  220 (392)
                      .++|+++                .+.++..+  .++|||||+||||++ |+..||++||++||++|++||+|||+|||||
T Consensus       195 ~~vp~p~~~~~~~~~~~~~~~~~~~~le~~ie~~g~iAA~i~EPi~~~-g~~~P~~~yl~~lr~lc~~~giLlI~DEVqt  273 (460)
T PRK06082        195 ERIPPAVSYRGAFPRADGSDVHYADYLEYVIEKEGGIGAFIAEAVRNT-DVQVPSKAYWKRIREICDKHNVLLIIDDIPN  273 (460)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC-CCCCCCHHHHHHHHHHHHHCCCEEECCCCCC
T ss_conf             547986323666676431128999999998605797899996166678-8806898999999999997298576033202


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             4444555310111245453021034444443-443210001112222233223453211110012334554320122210
Q gi|254780432|r  221 GYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE  299 (392)
Q Consensus       221 G~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~  299 (392)
                      ||||||+||++|++||+|||+|+||+||||| |+|||++++++++......+++||+|||++||||+++|++|+++++++
T Consensus       274 GfGRTG~~fa~e~~gv~PDIv~~gKglggG~~Pisav~~~~~~~~~~~~~~g~~T~~gnPl~cAaAlA~L~iie~e~l~~  353 (460)
T PRK06082        274 GMGRSGEWFTHQAFDIEPDILCIGKGLGGGLVPIAAMITKDKYNTAAQISLGHYTHEKSPIGCAAALATMEAIEQEGLLD  353 (460)
T ss_pred             CCCCCCCHHHHHCCCCCCCEEEECHHHHCCCCCEEEEEEHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHH
T ss_conf             88754434466317999828998816438977638998748855201577654367898799999999999997257889


Q ss_pred             HHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC----------HHHHHHHHHHCCEEEEECCCCEEEECCCC
Q ss_conf             11210000268899998867970755046400999872499----------89999999968989962689889955898
Q gi|254780432|r  300 NVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS----------PALLAAKFRDECLLTAPSSDNVVRILPPL  369 (392)
Q Consensus       300 ~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~----------~~~~~~~l~~~Gll~~~~~~~~irl~Ppl  369 (392)
                      |++++|++|+++|+++.++|| +|.+|||+|||++||++.+          ...+..+++++||++.+..+|+|||+|||
T Consensus       354 ~a~~~G~~l~~~L~~L~~~~p-~VgdVRG~GLm~giElv~d~~tk~~~~~~a~~v~~~~~~~Gl~~~~~~gnvirl~PPL  432 (460)
T PRK06082        354 KVKADSQFMREKLLEMKAKYP-VIGDVRGIGLLWGIELVTDHETKTRAYDEAEAVLYQCLNNGLSFKVSQGNVIQLSPPL  432 (460)
T ss_pred             HHHHHHHHHHHHHHHHHHCCC-CEEEECCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEECCCCCEEEEECCC
T ss_conf             999999999999999986299-7885233654999997417765656679999999999968917910899989997991


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             6889999999999999999852
Q gi|254780432|r  370 TITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       370 ~it~~eid~~i~~l~~al~~L~  391 (392)
                      +||++|||+++++|+++|.++.
T Consensus       433 ~It~~eid~~l~~l~~al~ev~  454 (460)
T PRK06082        433 IISREQLTEALAIFEEAIAKVC  454 (460)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHH
T ss_conf             1899999999999999999999


No 51 
>PRK05639 4-aminobutyrate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=745.53  Aligned_cols=380  Identities=32%  Similarity=0.528  Sum_probs=339.7

Q ss_pred             CCEECC--CCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCC-CHHHHHHH
Q ss_conf             314515--588887489850103799679976464102267435787899999999999973145068757-81899999
Q gi|254780432|r    4 NDFLFN--TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQ-STQQEIFA   80 (392)
Q Consensus         4 ~~~~~~--~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~-~~~~~~la   80 (392)
                      .+|+.+  +|.++|++|+||+|+||||.|||+||||+||+|+++|||+||+|++|+++|++++.|....+. ++...+|+
T Consensus        23 ~~~~~~~~~~~~~Piv~~rg~G~~l~D~dG~~ylD~~~g~~~~~lGH~~p~i~~Ai~~Q~~~l~~~~~~~~~~~~~~~la  102 (457)
T PRK05639         23 KRVLSTGIGVKLFPLVPKRGFGPFIEDVDGNVFIDFLAGAAAASTGYSHPKLVKAVKEQVELIQHSMIGYTHSERAIRVA  102 (457)
T ss_pred             HHHCCCCCCCCCCCCEEEEEEECEEEECCCCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             86459988787568569972409899699698888054188667617969999999999864447657774887999999


Q ss_pred             HHHHHHCCC--CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             865201013--331235655540356777665432001347860023435465654321234553-21134799986433
Q gi|254780432|r   81 NHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGG-KLQYLEGFGPKIEG  157 (392)
Q Consensus        81 ~~L~~~~~~--~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~-~~~~~~~~~p~~~~  157 (392)
                      ++|++..|.  ++++|++|||||||+|||+||.+      |+|++||+|+++|||+|++++|+++ ...++++|+|..++
T Consensus       103 e~L~~~~P~~~~~v~f~~sGSEAvE~AiKlAr~~------t~r~~Iis~~~~yHG~T~ga~s~~~~~~~~~~~~~~~~~~  176 (457)
T PRK05639        103 EKLVKISPIKNSKVIFGLSGSDAVDMAIKVSKFS------TRRPWILAFIGAYHGQTLGATSVASFQVSQKRGYSPLMPN  176 (457)
T ss_pred             HHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHC------CCCCEEEEEECCCCCCCCCHHCCCCCCCCCCCCCCCCCCC
T ss_conf             9999758988775998186589999999998642------5988699993577986514000146875445688888998


Q ss_pred             CCCCCCHH---------------------HHHHHHHC------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             32221002---------------------68875410------1233222233322221124621012322110223457
Q gi|254780432|r  158 FDQAKFCD---------------------LQSLKNQI------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDID  210 (392)
Q Consensus       158 ~~~~~~~d---------------------~~~l~~~~------~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g  210 (392)
                      +.++|+++                     ++.+++.+      +++|||||+|||||++|+++||++||++||++|++||
T Consensus       177 ~~~~p~p~~~r~~~~~~~~~~~~~~~~~~~~~le~~i~~~~~~~~~iAavi~EPiqg~gG~~~~~~~yl~~lr~lc~~~g  256 (457)
T PRK05639        177 VFWLPYPNPYRNIWGINGYEEPNELINRVLDYLENYVFSHVVPPDEVAALFAEPIQGDAGIVVPPENFFKELKKLLNELG  256 (457)
T ss_pred             CEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             47817986334533567633789999999999999998614688978999982766887986289899889999997639


Q ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             21310110034444555310111245453021034444443443210001112222233223453211110012334554
Q gi|254780432|r  211 ALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLN  290 (392)
Q Consensus       211 ~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~  290 (392)
                      ++||+|||||||||||+||++|++|++|||+|+||+|+||+|+|+|++++++++. .++.+++||+|||++||||+++|+
T Consensus       257 illI~DEV~tGfGRtG~~fa~e~~gv~PDii~~gKgl~~G~plsav~~~~~i~~~-~~g~~~~T~~gnpla~Aaa~a~L~  335 (457)
T PRK05639        257 ILLVMDEVQTGIGRTGKWFASEWFSVKPDMIIFGKGVASGMGLSGVIGRKEIMDI-TSGSALLTPAANPVISAAAEATLE  335 (457)
T ss_pred             CEEEEECCCCCCCCCCCHHHHHCCCCCCCEEEECCHHCCCCCCEEEEECHHHHHH-HCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             8687310322776256545664379999999977221079870799984887754-057655578865299999999999


Q ss_pred             HHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH--------HHHHHHHHHCCEEEEECC--C
Q ss_conf             320122210112100002688999988679707550464009998724998--------999999996898996268--9
Q gi|254780432|r  291 IIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP--------ALLAAKFRDECLLTAPSS--D  360 (392)
Q Consensus       291 ~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~--------~~~~~~l~~~Gll~~~~~--~  360 (392)
                      +++++++++|++++|++|.++|++|+++| ++|.+|||+|||+++|++.+.        ..+..+++++|+++.+.+  +
T Consensus       336 ~i~~~~l~~~a~~~g~~l~~~L~~L~~~~-~~v~dVRG~GL~~giel~~~~~~~~~~~~~~v~~~~~~~Gll~~~~g~~~  414 (457)
T PRK05639        336 IIEEENLLKNALEVGNFIMKRLEEMKEVF-EIIGDVRGKGLMIGVEIVKENGRPDPEMTGKICWRAFELGLILPSYGMFG  414 (457)
T ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHHC-CCEEEECCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCEEECCCCCC
T ss_conf             99965599999999999999999988638-97565503780999999437899899999999999996796881589999


Q ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             8899558986889999999999999999852
Q gi|254780432|r  361 NVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       361 ~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      |+|||.|||+||++|||+++++|+++|.+..
T Consensus       415 nvirl~PPL~it~~eid~~~~il~~al~ea~  445 (457)
T PRK05639        415 NVIRITPPLVLTKEVAEKGLEIIERAIKDAL  445 (457)
T ss_pred             CEEEEECCEECCHHHHHHHHHHHHHHHHHHH
T ss_conf             9899978931689999999999999999997


No 52 
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
Probab=100.00  E-value=0  Score=744.12  Aligned_cols=387  Identities=27%  Similarity=0.457  Sum_probs=339.6

Q ss_pred             CCCEECCCCCC----CCE-EEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHH
Q ss_conf             43145155888----874-8985010379967997646410226743578789999999999997314506-87578189
Q gi|254780432|r    3 KNDFLFNTYDQ----SDI-RFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQ   76 (392)
Q Consensus         3 ~~~~~~~~~~~----~p~-~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~   76 (392)
                      +++|+||+|.+    .|+ +|+||+|+|+||.|||+||||.+|+|++++||+||+|++|+++|++++.++. ..+.++..
T Consensus        10 d~~~~~h~~~~~~~~~p~~~i~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~ql~~l~~~~~~~~~~~~~   89 (429)
T PRK06173         10 DRQHIWHPYSSVTDPIPLYPVERADGVMITLKDGRRLIDGMSSWWAALHGYNHPRLNAAATNQLSKMSHIMFGGFTHEPA   89 (429)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEECCCCEEEECCCCEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHH
T ss_conf             99657888766678899701684621789979999999856328853237998999999999997577855677577799


Q ss_pred             HHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC
Q ss_conf             999986520101--33312356555403567776654320013478600234354656543212345532113-479998
Q gi|254780432|r   77 EIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQY-LEGFGP  153 (392)
Q Consensus        77 ~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~-~~~~~p  153 (392)
                      .+|+++|++..|  ++||+|+||||||||+|||+||+|+..++.|+|++|++|++||||+|.+++|+++.... +..+.+
T Consensus        90 ~~lae~L~~~~p~~l~~v~f~~SGsEAvE~AiKlA~~y~~~~g~~~r~~ii~~~~~yHG~T~~a~s~~~~~~~~~~~~~~  169 (429)
T PRK06173         90 VELAQLLLEILPPELNKIFFADSGSVAVEVAMKMALQYQQAKGEVQRTKFATIRSGYHGDTWHAMSVCDPVTGMHGLFNS  169 (429)
T ss_pred             HHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHCCCCCCCCCCCCCC
T ss_conf             99999999847977587997186599999999999999997289876526750588588757677605764466666678


Q ss_pred             CCCC-----CCCCC------CHHHHHHHH---HCCCCCCCCCCCCC-CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC
Q ss_conf             6433-----32221------002688754---10123322223332-222112462101232211022345721310110
Q gi|254780432|r  154 KIEG-----FDQAK------FCDLQSLKN---QISNDTAAILIEPI-QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV  218 (392)
Q Consensus       154 ~~~~-----~~~~~------~~d~~~l~~---~~~~~iAavi~Epv-~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV  218 (392)
                      ..+.     ....+      ..+++.+++   ...++|||||+||+ ||+||+++||++||++||++|++||++||+|||
T Consensus       170 ~~p~~~~~p~~~~~~~~~~~~~~~~~l~~~~~~~~~~iAavi~EPi~qg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV  249 (429)
T PRK06173        170 SLPVQYFLPQPSVKFGEAWRDEAIEPLQDLLEQHGDEIAALILEPVVQGAGGMYFYSPTYLVKARELCDQYGVLLIFDEI  249 (429)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             89865346899876565422779999999998558863699998644678986678999999999875124855773013


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             034444555310111245453021034444443-443210001112222233-----22345321111001233455432
Q gi|254780432|r  219 QTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG-----SHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       219 ~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~-----~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
                      ||||||||+||++|++||+|||+|+||+||||| |+|+++++++|++.+.++     .|++||+|||++||||+++|+++
T Consensus       250 ~tGfGRtG~~fa~e~~gv~PDivt~gKglggG~~P~~avi~~~~i~~~~~~g~~~~f~hg~T~~Gnpla~Aaa~a~L~~i  329 (429)
T PRK06173        250 ATGFGRTGKLFALEHAGVVPDIMCIGKALTGGYLTLSATITTEEIAQTICSGEAKCFMHGPTFMANPLACAIAAESIRLL  329 (429)
T ss_pred             CCCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             20687366844532368999789855445688776178987689996424687666352789986899999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEEEECCCCC
Q ss_conf             012221011210000268899998867970755046400999872499--899999999689899626898899558986
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVVRILPPLT  370 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~  370 (392)
                      +++++++|++++|++|+++|++++ ++| .|.+|||+|+|+++|+..+  ...+.++++++|+++.+.+ |+|||.|||+
T Consensus       330 ~~~~l~~~~~~~g~~l~~~L~~~~-~~~-~v~dVRG~Gl~~~iel~~~~~~~~l~~~~~~~Gll~~~~g-~~l~l~PPL~  406 (429)
T PRK06173        330 LESPWQQNIQRIERQLRQELSPAA-EFD-YVAEVRVLGAIGVVEMKSPVDMATLQPRFVEHGIWVRPFG-KLVYLMPPFI  406 (429)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHC-CCC-CEEEECCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEECC-CEEEEECCCC
T ss_conf             864699999999999999999631-699-6687423572999994684569999999996995898349-9899958936


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899999999999999998529
Q gi|254780432|r  371 ITAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       371 it~~eid~~i~~l~~al~~L~~  392 (392)
                      ||++|||+++++|+++|.|..|
T Consensus       407 it~~ei~~~~~~l~~aL~e~~~  428 (429)
T PRK06173        407 ISQDELTQLTSGLLRVLTQEYN  428 (429)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHC
T ss_conf             8999999999999999999854


No 53 
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=741.99  Aligned_cols=380  Identities=30%  Similarity=0.513  Sum_probs=338.0

Q ss_pred             CCCEECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHH
Q ss_conf             43145155888-874898501037996799764641022674357878999999999999731450-6875781899999
Q gi|254780432|r    3 KNDFLFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV-SNLYQSTQQEIFA   80 (392)
Q Consensus         3 ~~~~~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~-~~~~~~~~~~~la   80 (392)
                      +.++.+++|.+ +|++|+||+|+||||.|||+||||+||+|++++||+||+|++|+++|+++..+. ...+.++...+|+
T Consensus        23 ~~~~~~~~~~~~~P~~i~rg~G~~l~D~dG~~yLD~~sg~~~~~lGH~~p~v~~Ai~~ql~~~~~~~~~~~~~~~~~~la  102 (454)
T PRK06931         23 EMESNVRSYPRKLPLAIAKAQGCWVTDVEGNEYLDCLAGAGTLALGHNHPAVMQSIQDVLDSGLPLHTLDLTTPLKDAFS  102 (454)
T ss_pred             HHCCHHCCCCCCCCCEEEEEECCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCEECCCCCHHHHHHH
T ss_conf             74112215798999508983648899798899989163177554617959999999999862887112776867999999


Q ss_pred             HHHHHHCCC--CCC---CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             865201013--331---235655540356777665432001347860023435465654321234553211347999864
Q gi|254780432|r   81 NHLIHSTFA--DRV---FFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKI  155 (392)
Q Consensus        81 ~~L~~~~~~--~~v---~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~  155 (392)
                      ++|++..|.  +++   ||++|||||||+|||+||+|      |+|++||+|++||||+|.+++|+|+++.+++.+.|..
T Consensus       103 e~L~~~~p~~~~~~~~~F~~~SGSEAvE~AlKlAr~~------tgR~~iis~~~sYHG~T~gals~tg~~~~~~~~~~l~  176 (454)
T PRK06931        103 EELLSFLPGEKDEYCLQFTGPSGADAVEAAIKLAKTY------TGRSNVISFSGGYHGMTHGALSLTGNLSAKNAVNGLM  176 (454)
T ss_pred             HHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHH------CCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCCCCC
T ss_conf             9999847765672489973897489999999998760------6998199980688997433531107965222568889


Q ss_pred             CCCCCCCCHHH-------------HHH-------HHH---CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCE
Q ss_conf             33322210026-------------887-------541---0123322223332222112462101232211022345721
Q gi|254780432|r  156 EGFDQAKFCDL-------------QSL-------KNQ---ISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDAL  212 (392)
Q Consensus       156 ~~~~~~~~~d~-------------~~l-------~~~---~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~l  212 (392)
                      +++.++|+++.             +++       .+.   ..+++||||+|||||+||+++||++||++||++|++||++
T Consensus       177 p~~~~~p~p~~~r~p~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~AAviiEPiqg~gG~~~~p~~yl~~lr~lc~~~gil  256 (454)
T PRK06931        177 PGVQFMPYPHEYRCPLGIGGEAGVKALTYYFENFIEDVESGVVKPAAVILEAIQGEGGVVPAPVSWLQKIREVTQKHGIL  256 (454)
T ss_pred             CCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCEE
T ss_conf             99668079752357667762336999999999999999706887259999476688897618889988999875116818


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             31011003444455531011124545302103444444344321000111222223322345321111001233455432
Q gi|254780432|r  213 LIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       213 lI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
                      ||+|||||||||||+||++|++|++|||+|+||+||||+|+++++.+++ ++.+.++.|++||+|||++||||+++|+++
T Consensus       257 lI~DEV~tGfGRTG~~fa~e~~gv~PDIi~~gKglggG~P~a~~~~~~~-~~~~~~~~h~~T~~Gnpla~Aaala~L~~i  335 (454)
T PRK06931        257 LIVDEVQAGFARSGKMFAFEHAGIEPDIVVMSKAVGGGLPLAVLGIKKE-FDAWQPAGHTGTFRGNQLAMATGLATLKIL  335 (454)
T ss_pred             EEECCCCCCCCCCCCCCHHCCCCCCCCEEEEHHHHCCCCCEEEEEEHHH-HCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             9950344377867784121025889896002153248885489987555-524678886645689847889999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------------HHHHHHHHHCCEEEE
Q ss_conf             0122210112100002688999988679707550464009998724998----------------999999996898996
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------------ALLAAKFRDECLLTA  356 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------------~~~~~~l~~~Gll~~  356 (392)
                      +++++++|++++|++|+++|+++.++|| +|.+|||+|||++||++.+.                ..+.+.++++|+++.
T Consensus       336 ~~e~l~~~~~~~G~~l~~~L~~l~~~~p-~V~dVRG~GL~~giElv~~~~~~~~~~~~~~~~~~~~~i~~~~~~~Gll~~  414 (454)
T PRK06931        336 RDENLAQNAQERGEWLTAALRELSKEYP-CIGNVRGRGLMIGIEIVDERKPADATGSYPADGELAAAIQKACFNNKLLLE  414 (454)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHCCC-CEEEECCCCEEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             8624999999999999999999987099-888631374489999800676432235566668999999999997896895


Q ss_pred             EC--CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             26--89889955898688999999999999999985
Q gi|254780432|r  357 PS--SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       357 ~~--~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +.  .+|+|||+|||+||++|||+++++|+++|.++
T Consensus       415 ~~g~~~nvlr~~PPL~it~~eid~~l~~l~~al~e~  450 (454)
T PRK06931        415 RGGRNGNVVRLLCPLNITQAECEEFIKRFKQAVAEA  450 (454)
T ss_pred             ECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             468999989997990168999999999999999999


No 54 
>PRK06149 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=745.22  Aligned_cols=369  Identities=27%  Similarity=0.469  Sum_probs=324.6

Q ss_pred             CCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC--C
Q ss_conf             88887489850103799679976464102267435787899999999999973145068757818999998652010--1
Q gi|254780432|r   11 YDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHST--F   88 (392)
Q Consensus        11 ~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~--~   88 (392)
                      ||.-|+.|+||+|+|+||.+||+|||+.+|.  ..+||+||+|++|+++|++++ ++++.|.++...+|||+|++..  +
T Consensus       564 ~Y~~Pi~ivRGeg~~L~D~~Gr~YLD~~~~V--~~vGH~hP~v~~A~~~Q~~~L-~~~s~~~~~~~~elAerL~~~~P~~  640 (972)
T PRK06149        564 YYAAPPQIERGWRNYLIDMQGRSYLDMVNNV--TVLGHGHPRMAAAAARQWSLL-NTNSRFHYAAVAEFSERLAALAPDG  640 (972)
T ss_pred             CCCCCCEEEECCCCEEECCCCCEEEEECCCC--CCCCCCCHHHHHHHHHHHHHH-CCCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             3689971686040279968998887704772--445678999999999999974-5176636515999999999857656


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC--------
Q ss_conf             333123565554035677766543200134786002343546565432123455321134-79998643332--------
Q gi|254780432|r   89 ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYL-EGFGPKIEGFD--------  159 (392)
Q Consensus        89 ~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~-~~~~p~~~~~~--------  159 (392)
                      +++|||+||||||||+||||||+|      |||++||+++++|||+|.+++++|+....+ +.+...+..+.        
T Consensus       641 l~~vfF~nSGsEAnE~AlKlAr~~------tGr~~iI~~~~ayHG~T~ga~a~s~~~~~~~~~~~~~p~~v~~~~~P~~y  714 (972)
T PRK06149        641 LDTVFLVNSGSEANDLAIRLAWAA------SGGRDVLSVLEAYHGWTVATDAVSTSIADNPQALTTRPDWVHPVESPNTF  714 (972)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHHH------HCCCCEEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCCEEEECCCCCC
T ss_conf             266985077499999999999996------28997799968708826788986334345766767899843660687445


Q ss_pred             CCCC----------HHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC
Q ss_conf             2210----------0268875410---12332222333222211246210123221102234572131011003444455
Q gi|254780432|r  160 QAKF----------CDLQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTG  226 (392)
Q Consensus       160 ~~~~----------~d~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG  226 (392)
                      ..+|          .+++...+.+   .+++||||+|||||+||.+++|++||++++++|++||+++|+|||||||||||
T Consensus       715 r~~~~~~~~~~~~~~~~~~~i~~l~~~~~~~Aa~I~EPI~G~gG~i~~P~gyl~~v~~~c~~~g~LlI~DEVQtG~GRtG  794 (972)
T PRK06149        715 RGKFRGADSAADYLRDVVAQLEDLDARGRQLAGFICEPVYGNAGGISLPDGYLRQVYAAVRARGGVCIADEVQVGYGRLG  794 (972)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC
T ss_conf             67778864078999999999999971589668999957647778737987999999999997497899613221778576


Q ss_pred             CCC-CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHH
Q ss_conf             531-0111245453021034444443443210001112222-23322345321111001233455432012221011210
Q gi|254780432|r  227 KLF-AYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACM-NQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI  304 (392)
Q Consensus       227 ~~f-~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~-~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~  304 (392)
                      +|| ++|++|++|||+|+||+||||||+|||+++++|++.+ .++.|++||+|||++||||+++|++|++++|++|++++
T Consensus       795 ~~Fwa~e~~gv~PDIvt~aKglg~G~PlgAvv~~~eia~~f~~~g~~~sTfgGnPlacAaalavL~vi~~e~L~~na~~~  874 (972)
T PRK06149        795 HYFWGFEQQGVVPDIITMAKGMGNGHPLGAVITRREIAEALEAEGYFFSSTGGSPVSCAIGMAVLDVMREEKLQENARRV  874 (972)
T ss_pred             CCCCHHHHCCCCCCEEEECCCCCCCCCCEEEEECHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             63004454299987798645555886647889749999765268860058998989999999999999873699999999


Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEECC--CCEEEECCCCCCC
Q ss_conf             0002688999988679707550464009998724998----------999999996898996268--9889955898688
Q gi|254780432|r  305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLLTAPSS--DNVVRILPPLTIT  372 (392)
Q Consensus       305 g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~Gll~~~~~--~~~irl~Ppl~it  372 (392)
                      |++|+++|++|+++|| +|.+|||+|||+|+|++.++          ..++.+++++||++.+.|  +|+||+.|||+||
T Consensus       875 G~~l~~~L~~L~~~~p-~IgdVRG~GLm~GiElV~d~~t~~Pa~~~~~~i~~~~~e~Gil~~~~G~~~nVlki~PPL~i~  953 (972)
T PRK06149        875 GDHLKARLEALVDRHP-LAGAVHGMGLYLGVELVRDRQTLEPATEETAAICDRLLELGVIMQPTGDHLNILKIKPPLCTD  953 (972)
T ss_pred             HHHHHHHHHHHHHHCC-CEEEEECCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCEEEECCCCCCCEEEECCCCCCC
T ss_conf             9999999999986199-489862267289999701667689888999999999997895894278988879980894676


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999998
Q gi|254780432|r  373 AEEIHEGLERIERTAIK  389 (392)
Q Consensus       373 ~~eid~~i~~l~~al~~  389 (392)
                      ++++|+++++|+++|.|
T Consensus       954 ~e~~D~~l~~l~~vL~E  970 (972)
T PRK06149        954 RESADFFVDMLDRVLTE  970 (972)
T ss_pred             HHHHHHHHHHHHHHHHC
T ss_conf             99999999999999855


No 55 
>PRK09044 consensus
Probab=100.00  E-value=0  Score=742.98  Aligned_cols=385  Identities=29%  Similarity=0.448  Sum_probs=341.2

Q ss_pred             CCCCEECCCCC-----CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHH
Q ss_conf             84314515588-----887489850103799679976464102267435787899999999999973145068-757818
Q gi|254780432|r    2 NKNDFLFNTYD-----QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQ   75 (392)
Q Consensus         2 ~~~~~~~~~~~-----~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~   75 (392)
                      .+++|+||.|.     |.|++|+||+|+|+||.|||+||||.||+|+++|||+||+|++|+++|+++++|+.. .+.++.
T Consensus         7 ~d~~~~w~~~~~~~~~~~P~~i~r~~G~~l~D~dG~~ylD~~sg~~~~~lGh~~p~v~~Ai~~Q~~~l~~~~~~~~~~~~   86 (418)
T PRK09044          7 AGLPHIWLPYAQMKTAPPPLPVVRTEGSRLYLADGRELVDGVASWWTACHGYNHPHIAEAVREQLDRMPHVMFGGLAHEP   86 (418)
T ss_pred             HHHHHCCCCCCCCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHH
T ss_conf             10865088988988899985689836598997999999890227796522689899999999999758883458746779


Q ss_pred             HHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             9999986520101--333123565554035677766543200134786002343546565432123455321-1347999
Q gi|254780432|r   76 QEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFG  152 (392)
Q Consensus        76 ~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~  152 (392)
                      ..+|+++|++..|  ++|++|+||||||||+|||+||+|+..++.|+|++||+|+++|||+|++++|+++.. .++..|.
T Consensus        87 ~~~la~~L~~~~p~~l~~v~f~~SGsEAvE~AiKlA~~y~~~r~~tgr~~ii~~~~~yHG~T~ga~s~~~~~~~~~~~~~  166 (418)
T PRK09044         87 AYRLASRLAAILPGDLERVFFSDSGSVAVEVAMKMAVQYWLNRGERGRTKFLAFRGGYHGDTLATMAVCDPEEGMHSLFA  166 (418)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHCCCCCCCCCCCCCC
T ss_conf             99999999985788758698628678999999999999998624567762899618777866666211577557667778


Q ss_pred             CCCCCCCCCCC----HH---HHHHHHHCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCC
Q ss_conf             86433322210----02---6887541012332222333-2222112462101232211022345721310110034444
Q gi|254780432|r  153 PKIEGFDQAKF----CD---LQSLKNQISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGR  224 (392)
Q Consensus       153 p~~~~~~~~~~----~d---~~~l~~~~~~~iAavi~Ep-v~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GR  224 (392)
                      +..+.....++    .+   ++.+.+...++|||||+|| |||++|+++||++||++||++|++||+|||+|||||||||
T Consensus       167 ~~~p~~~~~~~p~~~~~~~~l~~~~~~~~~~iAavi~EP~iqg~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~tG~GR  246 (418)
T PRK09044        167 GVLPEQVIADLPRDAASEAALDALLERHGGEIAAILVEPLVQGAGGMLFHDPEVLRRLRRLADRHGLLLIFDEIFTGFGR  246 (418)
T ss_pred             CCCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCC
T ss_conf             98997614579998678999999997579977899994663578987489889999999999874986772122036876


Q ss_pred             CCCCCCCCCCCCCCCEEECCCCCCCC-CCCCCCCCCCCCCCCCC---C---CCCCCCCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             55531011124545302103444444-34432100011122222---3---32234532111100123345543201222
Q gi|254780432|r  225 TGKLFAYEWANVKPDIMTIAKGMGGG-FPIGACLATNEVAACMN---Q---GSHGSTYGGNVLAMVLGEKVLNIIQSDGF  297 (392)
Q Consensus       225 tG~~f~~e~~gi~PDi~~~gK~l~gG-~P~sav~~~~~i~~~~~---~---~~~~~T~~gnpl~~aaa~a~L~~l~~~~l  297 (392)
                      ||+||++|++||+|||+|+||+|+|| +|+||+++++++++.+.   +   ..|++||+|||++||||+++|++++++++
T Consensus       247 tG~~fa~~~~gv~PDivt~gKgl~gG~~Plsav~~~~~i~~~~~~~~~~~~~~hg~T~~gnpl~cAaala~L~~i~~~~l  326 (418)
T PRK09044        247 TGTMFAFEQAGVVPDIVTLSKALTGGTLPLAATVASRRVFEAFWSDDPGHALMHGPTYMGNPLACAAANASLDLFEDEPR  326 (418)
T ss_pred             CCCCCHHHHCCCCCCEEEECHHCCCCCCCCEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCH
T ss_conf             67853233259588724302001488776102355399999750379875502178888998999999999999973479


Q ss_pred             CCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHH
Q ss_conf             1011210000268899998867970755046400999872499--89999999968989962689889955898688999
Q gi|254780432|r  298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEE  375 (392)
Q Consensus       298 ~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~e  375 (392)
                      .+|++++|++|.++|+++.+ +| .|.+|||+|+|+++|+..+  ...+.++|+++|+++.+.+ |+|||.|||+||++|
T Consensus       327 ~~~~~~~g~~l~~~L~~~~~-~~-~v~~VRG~Glm~~iel~~~~~~~~~~~~~~~~Gv~v~~~g-n~irl~PpL~it~~e  403 (418)
T PRK09044        327 LEQVAAIEAQLRAGLEPCRD-LP-GVVDVRVLGAIGVVELERIPPLDDLRARFVDRGVWIRPFR-NIVYLTPAFTIAEDD  403 (418)
T ss_pred             HHHHHHHHHHHHHHHHHHCC-CC-CEEEEEECCEEEEEEECCCCCHHHHHHHHHHCCCEEEECC-CEEEEECCCCCCHHH
T ss_conf             99999999999999997536-99-7798800557999993685769999999997897797459-999997995789999


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999998
Q gi|254780432|r  376 IHEGLERIERTAIK  389 (392)
Q Consensus       376 id~~i~~l~~al~~  389 (392)
                      ||+++++|++++.|
T Consensus       404 id~~~~~l~~~l~E  417 (418)
T PRK09044        404 LARLTAAIRQVVAE  417 (418)
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             99999999999857


No 56 
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated
Probab=100.00  E-value=0  Score=740.20  Aligned_cols=380  Identities=31%  Similarity=0.547  Sum_probs=338.6

Q ss_pred             CEECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHHHH
Q ss_conf             145155888-87489850103799679976464102267435787899999999999973145068-7578189999986
Q gi|254780432|r    5 DFLFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFANH   82 (392)
Q Consensus         5 ~~~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la~~   82 (392)
                      +.-+++|.+ +|++|+||+|+||||.|||+|||++||+|++|+||+||+|.+|+++|+++....+. .+.++...+++++
T Consensus        11 ~s~~~~y~~~~Pivi~ra~G~~l~D~dG~~ylD~~sg~~~~~lGH~~p~I~~Ai~~ql~~~~~~h~~~~~~~~~~~l~e~   90 (426)
T PRK09264         11 ESEVRSYCRSFPVVFDKAKGSWLYDEDGKEYIDFFAGAGALNYGHNNPVLKQALIDYLQRDGITHGLDMHTEAKREFLET   90 (426)
T ss_pred             CCCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             43304578899934998453989989989999837059853005897999999999998548600134212899999999


Q ss_pred             HHHH----CCCC-CCCCCC-CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             5201----0133-312356-555403567776654320013478600234354656543212345532113479998643
Q gi|254780432|r   83 LIHS----TFAD-RVFFTN-SGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIE  156 (392)
Q Consensus        83 L~~~----~~~~-~v~f~~-SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~  156 (392)
                      |.+.    .+++ +|+|++ |||||||+|||+||+|      |||++||+|+++|||+|++++|+|+++.++.++++..+
T Consensus        91 l~~~il~p~~l~~~v~F~~~SGSEAvE~AiKlAR~~------tgr~~Iis~~~~YHG~T~gals~tg~~~~~~~~~~~~~  164 (426)
T PRK09264         91 FERLILKPRGLDYKVQFTGPTGTNAVEAALKLARKV------TGRTNIISFTNGFHGMTLGALAVTGNAHKRGGAGVPLN  164 (426)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHH------CCCCEEEEEECCCCCCCCEEEEECCCCCCCCCCCCCCC
T ss_conf             999735755798048955898227999999999983------49985999837757874145550378434577889978


Q ss_pred             CCCCCCCH--------HHHHHHHHCC------CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCC
Q ss_conf             33222100--------2688754101------233222233322221124621012322110223457213101100344
Q gi|254780432|r  157 GFDQAKFC--------DLQSLKNQIS------NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGY  222 (392)
Q Consensus       157 ~~~~~~~~--------d~~~l~~~~~------~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~  222 (392)
                      ++.++||+        +++.+++.+.      +++||||+|||||+||+++||++||+.||++|++||+|||+|||||||
T Consensus       165 ~~~~~P~~~~~~~~~~~~~~~e~~l~~~~~g~d~iAAviiEPiqg~gG~~~~p~~yl~~lr~lc~~~giLlI~DEV~tGf  244 (426)
T PRK09264        165 HVTFMPYDGYFGGDVDTLAYLEKLLEDSSSGVDLPAAVIVETVQGEGGLNVASAEWLQRLEKLCRKHDILLIVDDIQAGC  244 (426)
T ss_pred             CCEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEECCCCC
T ss_conf             81772788866787016999999987623788861699987866888982499899999999998707506733201077


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH-HCCCCCCH
Q ss_conf             4455531011124545302103444444-344321000111222223322345321111001233455432-01222101
Q gi|254780432|r  223 GRTGKLFAYEWANVKPDIMTIAKGMGGG-FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNII-QSDGFLEN  300 (392)
Q Consensus       223 GRtG~~f~~e~~gi~PDi~~~gK~l~gG-~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l-~~~~l~~~  300 (392)
                      ||||+||++|++||+|||+|+||+|+|| +|+|+|++++++ +.+.++.|++||+|||++|+||+++|+++ +++++.++
T Consensus       245 GRTG~~fa~e~~gv~PDiv~~gKglsGgg~P~sav~~~~e~-d~~~~g~h~~Tf~Gnp~a~aaa~a~L~~~~~~~~l~~~  323 (426)
T PRK09264        245 GRTGTFFSFEEAGIKPDIVTLSKSISGYGLPMALVLIKPEL-DQWKPGEHNGTFRGNNLAFVTATAALETYWSDDAFEKE  323 (426)
T ss_pred             CCCCCCCCCCCCCCCCCEEEECHHHCCCCCCEEEEEECHHH-CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCHHHHH
T ss_conf             86778302104799987798864336897104999973444-04677544667788829999999999999871479999


Q ss_pred             HHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECC--CCEEEECCCCCCCHHHH
Q ss_conf             1210000268899998867970755046400999872499--8999999996898996268--98899558986889999
Q gi|254780432|r  301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSS--DNVVRILPPLTITAEEI  376 (392)
Q Consensus       301 ~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~--~~~irl~Ppl~it~~ei  376 (392)
                      ++++|++|.++|++++++||+++.+|||+|||+++|++.+  ...+.+.++++||++...+  +|+|||.|||+||++||
T Consensus       324 v~~~g~~l~~~L~~l~~~~~~~v~dvRG~Glm~giel~~~~~~~~i~~~~~~~Gll~~~~g~~~~vir~~PPL~it~~ei  403 (426)
T PRK09264        324 VKRKGELVRERLEEIAAEYPGLGLSVRGRGMMQGIDFGDGELAGKICRRAFENGLIIETSGPNDEVVKLLPPLTIDEEEL  403 (426)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEEEEECCHHHHHHHHHHHHHCCCEEEECCCCCCEEEEECCEECCHHHH
T ss_conf             99999999999999997689962788860289999937768899999999978988964489998899979920889999


Q ss_pred             HHHHHHHHHHHHHHC
Q ss_conf             999999999999852
Q gi|254780432|r  377 HEGLERIERTAIKLS  391 (392)
Q Consensus       377 d~~i~~l~~al~~L~  391 (392)
                      |+++++|++++.+|.
T Consensus       404 d~~~~~l~~al~~vl  418 (426)
T PRK09264        404 EEGLDILEEAVAEVL  418 (426)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 57 
>PRK08555 consensus
Probab=100.00  E-value=0  Score=740.30  Aligned_cols=378  Identities=36%  Similarity=0.639  Sum_probs=341.5

Q ss_pred             CCEECCC---CCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHH
Q ss_conf             3145155---8888748985010379967997646410226743578789999999999997314506-87578189999
Q gi|254780432|r    4 NDFLFNT---YDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEIF   79 (392)
Q Consensus         4 ~~~~~~~---~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~l   79 (392)
                      ++|..++   ++++|++|+||+|+||||.|||+|||+++|+|+++|||+||+|++|+++|+++++|++ ..+.++...+|
T Consensus        21 ~~~~~~~~~~~~~~P~~i~ra~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~ql~~l~~~~~~~~~~~~~~~l  100 (443)
T PRK08555         21 HKYLATTTQDPESLPLVIERGEGVYVYDVDGNVYLDFSSGIGVNNLGHSHPRVIEAVEEQLHKLWHAAGTDFYNEYQVEL  100 (443)
T ss_pred             HHHCCCCCCCCCCCCCEEEEEECCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHH
T ss_conf             86538866778887817998465999979889999905327642124897999999999986176746564368899999


Q ss_pred             HHHHHHHCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             9865201013---33123565554035677766543200134786002343546565432123455321-1347999864
Q gi|254780432|r   80 ANHLIHSTFA---DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFGPKI  155 (392)
Q Consensus        80 a~~L~~~~~~---~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~p~~  155 (392)
                      +++|++..|.   .+|+|+||||||||+|||+||+|      |+|++||+|++||||+|++++|+|+.. .++..++|..
T Consensus       101 ae~L~~~~p~~~~~~v~f~~SGSEAvE~AiklAr~~------tgr~~ii~~~~~yHG~t~g~~s~t~~~~~~~~~~~p~~  174 (443)
T PRK08555        101 AKKLVEIAPGDFEKKVFFSNSGTEANEAALKIAKWY------TGRKMFIAFIGAFHGRTQGSLSLTASKPVQRSGFFPTM  174 (443)
T ss_pred             HHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHHHH------CCCCEEEEEECCCCCCCCCCEEEECCCCHHCCCCCCCC
T ss_conf             999998577565655998087788999999998873------79988999958707897211687258501104778999


Q ss_pred             CCCCCCCCHH---------------------HHHHHHHC------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCC
Q ss_conf             3332221002---------------------68875410------12332222333222211246210123221102234
Q gi|254780432|r  156 EGFDQAKFCD---------------------LQSLKNQI------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDD  208 (392)
Q Consensus       156 ~~~~~~~~~d---------------------~~~l~~~~------~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~  208 (392)
                      +++.++|+++                     ++.+++.+      +++|||||+|||||+||+++||++||++||++|++
T Consensus       175 ~~~~~vp~p~~~r~p~~~~~~~~~~~~~~~~~~~ie~~i~~~~~~~~~iAavi~EPi~g~gG~~~pp~~yl~~l~~lc~~  254 (443)
T PRK08555        175 PGVEHVPYPNPYRNPWGIDGYENPDELVNRVIDYIEEYLFEHYVPPEEVAGIFFEPIQGEGGYVVPPKNFFKELKKLADK  254 (443)
T ss_pred             CCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99368168862246445666569999999999999999986257989889999958768889875887887899999997


Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             57213101100344445553101112454530210344444434432100011122222332234532111100123345
Q gi|254780432|r  209 IDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKV  288 (392)
Q Consensus       209 ~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~  288 (392)
                      ||++||+|||||||||||+||++|++|++|||+|+||+||||+|+|||++++++ +...++.|++||+|||++||||+++
T Consensus       255 ~gillI~DEV~tGfGRtG~~fa~e~~gv~PDiv~~gKgl~~G~Pl~av~~~~e~-~~~~~~~h~~T~~gnpla~aaa~a~  333 (443)
T PRK08555        255 YGILLIDDEVQMGLGRTGKMFAIEHFGVEPDIITLAKALGGGIPIGATIFRADL-DFKKPGLHSNTFGGNALASAAGLAV  333 (443)
T ss_pred             CCCEEECCCCCCCCCCCCCCCEECCCCCCCCEEEECCCCCCCCCEEEEEEHHHH-CCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             494696354412787024741231688899889977424488750899982453-5577777376888548999999999


Q ss_pred             HHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEEC
Q ss_conf             54320122210112100002688999988679707550464009998724998----------99999999689899626
Q gi|254780432|r  289 LNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLLTAPS  358 (392)
Q Consensus       289 L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~Gll~~~~  358 (392)
                      |++++ +++++|++++|++|+++|++|+++|+ .|.+|||.|||+++|++.+.          ..+...++++|+++.+.
T Consensus       334 L~~i~-e~l~~~~~~~g~~l~~~L~~l~~~~~-~v~dvRG~Gl~~gielv~~~~~~~~~~~~~~~i~~~~~~~Gll~~~~  411 (443)
T PRK08555        334 IEEIK-EGLLENVQKLGKYFRERLEELKEKYE-IIGDVRGLGLAWAIEFVKDRKTKEPNPKLRDRVVVEAFKRGLILLGC  411 (443)
T ss_pred             HHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCC-CEEEECCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCEEEEEC
T ss_conf             99999-77999999999999999999886199-77872326679999982377656779899999999999789099737


Q ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             89889955898688999999999999999985
Q gi|254780432|r  359 SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       359 ~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      ++|+|||+|||+||++|||+++++|+++|.+|
T Consensus       412 g~n~ir~~PPL~it~~eid~~~~~l~~al~~V  443 (443)
T PRK08555        412 GKSAIRLIPPLIISEEEAKIGLEILEEAIKVV  443 (443)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             99989997794388999999999999999639


No 58 
>PRK06062 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=739.95  Aligned_cols=380  Identities=29%  Similarity=0.508  Sum_probs=336.6

Q ss_pred             CCCEECCCCCC----CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHH
Q ss_conf             43145155888----87489850103799679976464102267435787899999999999973145068757818999
Q gi|254780432|r    3 KNDFLFNTYDQ----SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI   78 (392)
Q Consensus         3 ~~~~~~~~~~~----~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~   78 (392)
                      |++|+||.|.+    .|++|+||+|+||||.|||+||||++|+|+++|||+||+|++|+++|++++.++++.+.++...+
T Consensus         3 d~~~~~hp~~~~~~~~P~~i~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~q~~~~~~~~~~~~~~~~~~   82 (434)
T PRK06062          3 DRAHVFHSWSAQGKINPLVIAAAEGSYVWDYEGNRYLDFSSQLVNTNIGHQHPKVVAAIQEQAARLCTVAPAHANDARSE   82 (434)
T ss_pred             CHHHCCCCCCCCCCCCCCEEEEEECCEEEECCCCEEEEECHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHH
T ss_conf             43126788888899899379981338899797899998606178676568979999999999975476467524599999


Q ss_pred             HHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9986520101--33312356555403567776654320013478600234354656543212345532113479998643
Q gi|254780432|r   79 FANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIE  156 (392)
Q Consensus        79 la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~  156 (392)
                      ++++|++..|  +++++|+||||||||+|||+||.|      |+|++||+++++|||+|.+++++|+++.++... +..+
T Consensus        83 la~~l~~~~p~~~~~v~f~~SGsEAve~AlklAr~~------tgr~~ii~~~~~yHG~t~~a~s~tg~~~~~~~~-~~~~  155 (434)
T PRK06062         83 AARLIAERAPGDLSKVFFTNGGADANEHAVRMARLH------TGRPKVLSAYRSYHGGTGTAINLTGDPRRWPND-TGNA  155 (434)
T ss_pred             HHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHH------CCCCCEEEEECCCCCCCCCEEEEECCCCCCCCC-CCCC
T ss_conf             999999747777587998378438999999999985------299837664046678865207840682014688-8889


Q ss_pred             CCCC--------CCCH----------HHHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEE
Q ss_conf             3322--------2100----------268875410----12332222333222211246210123221102234572131
Q gi|254780432|r  157 GFDQ--------AKFC----------DLQSLKNQI----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLI  214 (392)
Q Consensus       157 ~~~~--------~~~~----------d~~~l~~~~----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI  214 (392)
                      ++.+        .+++          .++.+++.+    +++|||||+|||||++|+++||++||+++|++|++||++||
T Consensus       156 ~~~~~~~p~~~~~~~~~~~~~~~~~~~l~~l~~~i~~~~~~~iAAvivEPiqg~gG~~~~~~~yl~~lr~lc~~~gillI  235 (434)
T PRK06062        156 GVVHFFGPFLYRSSFHATTEEEECERALAHLERVIALEGPSTIAAIVLESVPGTAGIMVPPPGYLAGVRELCDRHGIVFI  235 (434)
T ss_pred             CCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
T ss_conf             95341588766766778886899999999999999851999779999478678899866876787689999998595067


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             0110034444555310111245453021034444443-44321000111222223--32234532111100123345543
Q gi|254780432|r  215 FDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQ--GSHGSTYGGNVLAMVLGEKVLNI  291 (392)
Q Consensus       215 ~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~--~~~~~T~~gnpl~~aaa~a~L~~  291 (392)
                      +|||||||||||+||++|++||+|||+|+||+||||| |+|||+++++|++.+..  ..+++||+|||++||||+++|++
T Consensus       236 ~DEV~TG~GRtG~~fa~e~~gv~PDiv~~gK~l~gG~~Plsav~~~~~i~~~~~~~~~~~g~T~~Gnpla~Aaa~a~L~~  315 (434)
T PRK06062        236 ADEVMAGFGRTGKWFAIEHFDVVPDLITFAKGVNSGYVPLGGVAISEAIADTFADRPYPGGLTYSGHPLACAAAVATINA  315 (434)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHEEHHHHCCCCCCEEEEEECHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             46432278766664210058979762101033148877617887459999874226756787888987999999999999


Q ss_pred             HHCCCCCCHHHHHCCH-HHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------------HHHHHHHHHCCEE
Q ss_conf             2012221011210000-2688999988679707550464009998724998----------------9999999968989
Q gi|254780432|r  292 IQSDGFLENVINIAKI-LFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------------ALLAAKFRDECLL  354 (392)
Q Consensus       292 l~~~~l~~~~~~~g~~-l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------------~~~~~~l~~~Gll  354 (392)
                      ++++++++|++++|++ |+++|++++++|| .|.+|||+|||++||++.++                ..+...++++|++
T Consensus       316 i~~~~l~~~~~~~G~~~l~~~L~~l~~~~p-~v~~VRG~GL~~gielv~~~~~~~~~~~~~~~~~~~~~v~~~~~~~Gll  394 (434)
T PRK06062        316 MEEEGIVENAARIGAEVLGPGLRELAERHP-SVGEVRGLGVFWALELVADRETREPLVPYGAASAAMAAVVAACKERGLL  394 (434)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEECCEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             973589999999999999999999986589-8688861662699998226443555554433279999999999979927


Q ss_pred             EEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             9626898899558986889999999999999999852
Q gi|254780432|r  355 TAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       355 ~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +.+. +|+|||.|||+||++|||+++++|+++|.++.
T Consensus       395 ~~~~-gn~irl~PpL~it~~eid~~l~~l~~al~~~~  430 (434)
T PRK06062        395 PFVN-GNRIHVVPPCTVTEDEVREGLAILDAALAVAD  430 (434)
T ss_pred             EEEC-CCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             8335-99899978923889999999999999999876


No 59 
>PRK08466 consensus
Probab=100.00  E-value=0  Score=738.14  Aligned_cols=385  Identities=26%  Similarity=0.491  Sum_probs=343.6

Q ss_pred             CCCEECCCCCC------CC-EEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCH
Q ss_conf             43145155888------87-48985010379967997646410226743578789999999999997314506-875781
Q gi|254780432|r    3 KNDFLFNTYDQ------SD-IRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQST   74 (392)
Q Consensus         3 ~~~~~~~~~~~------~p-~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~   74 (392)
                      +++|+||+|.+      .| ++|+||+|+||||.|||+|||+.+|+|+++|||+||+|.+|+++|++++.++. ..+.++
T Consensus        10 d~~~~~h~~~~~~~~~~~p~i~i~rg~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~Q~~~l~~~~~~~~~~~   89 (430)
T PRK08466         10 DLEHIWHPCTQMKDHETLPLIPIKKAKGVYLYDFDGNAYIDCISSWWVNLFGHCNPYINEAIKKQIDELEHVILAGFTHE   89 (430)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEECCCCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCH
T ss_conf             88341788888521256898689957348899899899999243779761147979999999999965777345775877


Q ss_pred             HHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999986520101--3331235655540356777665432001347860023435465654321234553211347999
Q gi|254780432|r   75 QQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFG  152 (392)
Q Consensus        75 ~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~  152 (392)
                      ...+|+++|++..|  +++|+|+||||||||+|||+||+|+...+. +|++||+|++||||+|++++++++...++++|.
T Consensus        90 ~~~~lae~L~~~~p~~l~~v~f~~sGseA~E~AiKlAr~y~~~~g~-~k~~iis~~~~yHG~T~ga~s~~~~~~~~~~~~  168 (430)
T PRK08466         90 PIIKLSERLCELTPRGLNKCFYADNGSSAIEVALKMSFHYHKNKGK-KKSLFLSLSNSYHGETLGALSVGDVALYKDTYK  168 (430)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCC-CCCEEEEECCCCCCCCHHHHCCCCCCCCCCCCC
T ss_conf             9999999999857887787998377199999999999999752268-975899964752688521102578400246778


Q ss_pred             CCCCCCCCCCC--------HHHHHHHHHC---CCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCC
Q ss_conf             86433322210--------0268875410---12332222333-222211246210123221102234572131011003
Q gi|254780432|r  153 PKIEGFDQAKF--------CDLQSLKNQI---SNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQT  220 (392)
Q Consensus       153 p~~~~~~~~~~--------~d~~~l~~~~---~~~iAavi~Ep-v~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~t  220 (392)
                      |......+.|+        ++++.+++.+   .++|||||+|| +||+||+++||++||++||++|++||++||+|||||
T Consensus       169 p~~~~~~~~p~p~~~~~~~~~~~~l~~~l~~~~~~iAAvI~EPiiqg~gg~~~~~~~yl~~lr~lc~~~gillI~DEV~t  248 (430)
T PRK08466        169 PLLLECLQTPVPKDDEAYQEALEALKRILEKHAEEICAFILEPLVQCAGNMHMYSAEYLKEAIKLCHKYNIHIIFDEIAV  248 (430)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEC
T ss_conf             87768611589997166788899999999858997779999787667799768988999999999853596688731011


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             4444555310111245453021034444443-4432100011122222-------3322345321111001233455432
Q gi|254780432|r  221 GYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMN-------QGSHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       221 G~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~-------~~~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
                      ||||||+||++|++||+|||+|+||+|+||| |+||++++++|++.+.       ...|++||+|||++||||+++|+++
T Consensus       249 GfGRtG~~fa~~~~gv~PDiv~~gK~l~gG~~Pisav~~~~ei~~~~~~~~~~~~~~~h~~T~~Gnpla~aaala~L~~l  328 (430)
T PRK08466        249 GFGRTGTMFALEQCGISPDFLCLSKGITGGYLPLSVVLTSDEIYNAFYAPYEENKAFLHSHSYTGNALACAAANATLDIF  328 (430)
T ss_pred             CCCCCCCCHHHHHCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHHHCCCCCCCCEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             78766762055416999988986841017887749999858999875056555666012657888979999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH------HHHHHHHHHCCEEEEECCCCEEEEC
Q ss_conf             0122210112100002688999988679707550464009998724998------9999999968989962689889955
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP------ALLAAKFRDECLLTAPSSDNVVRIL  366 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~------~~~~~~l~~~Gll~~~~~~~~irl~  366 (392)
                      +++++++|++++|++|+++|+++. ++| .|.+|||.|+|+++|+...+      ..+...++++|+++.+.+ |+|+|.
T Consensus       329 ~~~~l~~~~~~~g~~l~~~L~~l~-~~~-~v~~vRg~Gl~~~iel~~~~~~~~~~~~i~~~~l~~Gll~~~~g-~~l~~~  405 (430)
T PRK08466        329 EDENVIEKNQILSEFIQKELSRLE-KLD-FVGNLRQCGMVFAFELLGTDTKERVGLFVFQKALKKGLLLRPLG-NTIYFM  405 (430)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHH-CCC-CEEEEEECCEEEEEEEECCCCCHHHHHHHHHHHHHCCEEEECCC-CEEEEE
T ss_conf             968888999999999999999862-499-75788412538999984588503799999999997893891149-999997


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             8986889999999999999999852
Q gi|254780432|r  367 PPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       367 Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      |||+||++|||+++++|+++|++|.
T Consensus       406 PpL~it~eeid~~~~~l~~al~elk  430 (430)
T PRK08466        406 PPYIITKEEIKKVIEVLEEIIKELK  430 (430)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             9858899999999999999999739


No 60 
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=741.06  Aligned_cols=377  Identities=28%  Similarity=0.515  Sum_probs=336.3

Q ss_pred             EECCCC-CCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHH
Q ss_conf             451558-88874898501037996799764641022674357878999999999999731450-6875781899999865
Q gi|254780432|r    6 FLFNTY-DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV-SNLYQSTQQEIFANHL   83 (392)
Q Consensus         6 ~~~~~~-~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~-~~~~~~~~~~~la~~L   83 (392)
                      .-.+.| .++|++|+||+|+|+||.|||+||||.||+|++++||+||+|++|+++|+++..+. +..+.++...+++++|
T Consensus        36 ~~~~~~~~~~P~~i~ra~G~~l~D~dG~~yLD~~sg~~~~~lGh~~p~i~~Ai~~ql~~~~~~~~~~~~~~~~~~la~~L  115 (464)
T PRK06938         36 SNARSYPRRIPLALKRARGIYVEDVEGRQFIDCLAGAGTLALGHNHPVVIEAIQQVLADELPLHTLDLTTPVKDQFVQDL  115 (464)
T ss_pred             HHHHCCCCCCCCCEEEEECCEEEECCCCEEEEECHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECCCCCHHHHHHHHHH
T ss_conf             12422588899627983648899798899999164088656707959999999999860898126785868999999999


Q ss_pred             HHHCCC-----CCCCC-CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             201013-----33123-565554035677766543200134786002343546565432123455321134799986433
Q gi|254780432|r   84 IHSTFA-----DRVFF-TNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEG  157 (392)
Q Consensus        84 ~~~~~~-----~~v~f-~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~  157 (392)
                      +...+.     .+++| .+|||||||+|||+||++      |+|++||+|+++|||+|.+++|+|++..++++++|..++
T Consensus       116 ~~~~p~~~~~~~~v~f~~~SGSEAvE~AiKlAR~~------tgr~~Iis~~~~YHG~T~gals~tg~~~~~~~~~~~~~~  189 (464)
T PRK06938        116 FGSLPEAFAKEAKIQFCGPTGTDAVEAALKLVKTA------TGRSTVLSFQGGYHGMSQGALSLMGNLGPKKPLGALLPG  189 (464)
T ss_pred             HHHCCHHHHCCCEEEEECCCCHHHHHHHHHHHHHC------CCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             99620555304408984798089999999998646------798859998347889706556541787555567888999


Q ss_pred             CCCCCCH-----------------HHHHHHHHCC------CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEE
Q ss_conf             3222100-----------------2688754101------2332222333222211246210123221102234572131
Q gi|254780432|r  158 FDQAKFC-----------------DLQSLKNQIS------NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLI  214 (392)
Q Consensus       158 ~~~~~~~-----------------d~~~l~~~~~------~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI  214 (392)
                      +.++|++                 +++.+++.+.      +++||||+|||||+||+++||++||++||++|++||++||
T Consensus       190 ~~~~p~p~~~r~p~~~~~~~~~~~~~~~le~~i~~~~~g~~~iAAvi~EpIqg~gGvi~~p~~yl~~lr~lc~~~giLlI  269 (464)
T PRK06938        190 VQFLPYPYDYRCPFGLGGEAGVRANLHYLENLLDDPESGVQLPAAVILEVVQGEGGVIPADDEWLRGLRRITEEAGIPLI  269 (464)
T ss_pred             CEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             67816886446766776156788889999999740540688248999888568779864998999999999866791598


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             01100344445553101112454530210344444434432100011122222332234532111100123345543201
Q gi|254780432|r  215 FDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS  294 (392)
Q Consensus       215 ~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~  294 (392)
                      +|||||||||||+||++|++||+|||+|+||+||||+|+|+|++++++ +.+.++.|++||+|||++||||+++|+++++
T Consensus       270 ~DEVqtGfGRTG~~fa~e~~gv~PDiit~gKglgGg~Plsavi~~~~i-~~~~~g~h~~T~~gnpla~AaalavL~iie~  348 (464)
T PRK06938        270 VDEIQSGFGRTGKMFAFEHAGIIPDVVVLSKAIGGSLPLAVVVYREWL-DTWQPGAHAGTFRGNQMAMAAGSATLRYIKE  348 (464)
T ss_pred             CCCCCCCCCCCCCCHHHHHCCCCCCEEEECHHCCCCCCEEEEEECHHH-HHCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             642012677436840643236888879863000487734999982776-5047887487289998999999999999986


Q ss_pred             CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC----------------HHHHHHHHHHCCEEEEEC
Q ss_conf             2221011210000268899998867970755046400999872499----------------899999999689899626
Q gi|254780432|r  295 DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS----------------PALLAAKFRDECLLTAPS  358 (392)
Q Consensus       295 ~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~----------------~~~~~~~l~~~Gll~~~~  358 (392)
                      +++++|++++|++|+++|+++..+|| .|.+|||+|||++||++.+                ...+.+.++++||++.+.
T Consensus       349 e~l~~~a~~~G~~l~~~L~~l~~~~p-~V~dVRG~GLm~giElv~~~~~~d~~~~~p~~~~~~~~v~~~~l~~Gll~~~~  427 (464)
T PRK06938        349 HRLAEHAAAMGERLLEHLRQLQRDYP-QLGDVRGRGLMLGVEIVDPQGEPDALGHPPANGELASRIQRECLRRGLILELG  427 (464)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEECCCEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             44999999999999999999985399-87976416069999984166664433356555899999999999789289646


Q ss_pred             C--CCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8--9889955898688999999999999999985
Q gi|254780432|r  359 S--DNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       359 ~--~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +  +|+|||.|||+||++|||+++++|+++|.++
T Consensus       428 g~~g~virl~PPL~it~eeid~~~~~l~~al~~a  461 (464)
T PRK06938        428 GRHGSVVRFLPPLIITAEQIDEVAEIFAEAVYAA  461 (464)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             8899989997991288999999999999999998


No 61 
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
Probab=100.00  E-value=0  Score=739.62  Aligned_cols=383  Identities=27%  Similarity=0.413  Sum_probs=339.2

Q ss_pred             CCCEECCCCCC---CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHH
Q ss_conf             43145155888---8748985010379967997646410226743578789999999999997314506-8757818999
Q gi|254780432|r    3 KNDFLFNTYDQ---SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEI   78 (392)
Q Consensus         3 ~~~~~~~~~~~---~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~   78 (392)
                      +++|+||+|.+   .|.+|+||+|+||||.|||+||||+||+|++++||+||+|++|+++|++++.|+. ..+.++...+
T Consensus        10 d~~~~~hp~~~~~~~p~vi~r~~G~~l~D~dG~~ylD~~~g~~~~~lGH~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~~   89 (423)
T PRK05630         10 DHRNIWHPYAAPGVRNRLVTKTDGVFLTLEDGSTVIDAMSSWWSAIHGHGHPRLKAAAQKQIDTMSHVMFGGLTHEPAIK   89 (423)
T ss_pred             HHHHCCCCCCCCCCCCCEEEEEECCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHH
T ss_conf             88543789999999984499530488996998999984436887615369999999999998657673467757689999


Q ss_pred             HHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC
Q ss_conf             9986520101--33312356555403567776654320013478600234354656543212345532113479-99864
Q gi|254780432|r   79 FANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEG-FGPKI  155 (392)
Q Consensus        79 la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~-~~p~~  155 (392)
                      |+++|++..|  +++|+|+||||||||+|||+||+|+..+|.++|++||+|+++|||+|++++|+++....... +.+..
T Consensus        90 lae~L~~~~p~~~~~v~f~~SGsEAvE~AiKlAr~~~~~~g~~~r~~Ii~~~~~yHG~T~ga~s~t~~~~~~~~~~~~~~  169 (423)
T PRK05630         90 LTHKLLNLTGNPFDHVFYSDSGSVSVEVAIKMALQASKGQGHPERTKLLTWRSGYHGDTFTAMSVCDPENGMHSLWKGTL  169 (423)
T ss_pred             HHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHEECCCCCCCCCCCCCCC
T ss_conf             99999875447768899628728999999999999987438987634765558507766645411067666555557889


Q ss_pred             CCCCC--------CCCHH----HHHHHHHCCCCCCCCCCCCC-CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCC
Q ss_conf             33322--------21002----68875410123322223332-2221124621012322110223457213101100344
Q gi|254780432|r  156 EGFDQ--------AKFCD----LQSLKNQISNDTAAILIEPI-QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGY  222 (392)
Q Consensus       156 ~~~~~--------~~~~d----~~~l~~~~~~~iAavi~Epv-~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~  222 (392)
                      +....        ....+    ++.++..++++|||||+||| ||+||+++||++||++||++|++||++||+|||||||
T Consensus       170 ~~~~~~p~p~~~~~~~~~~~~~l~~l~~~~~~~iAAii~EPi~qg~gG~~~p~~~yl~~lr~lc~~~gillI~DEV~TGf  249 (423)
T PRK05630        170 PEQIFAPAPPVRGSSPQAISEYLDSMELLIDETVSAIIIEPIVQGAGGMRFHDVALIEGVATLCKKHDRFLIVDEIATGF  249 (423)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEECCCCEECC
T ss_conf             87645689986788878999999999874388725999974677779956798799999998733068058636432058


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             44555310111245453021034444443-443210001112222233------22345321111001233455432012
Q gi|254780432|r  223 GRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG------SHGSTYGGNVLAMVLGEKVLNIIQSD  295 (392)
Q Consensus       223 GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~------~~~~T~~gnpl~~aaa~a~L~~l~~~  295 (392)
                      ||||+||++|++||+|||+|+||+|+||| |+|||+++++|++.+...      .|++||+|||++||||+++|++|+++
T Consensus       250 GRtG~~fa~e~~gV~PDivt~gK~l~gG~~Pl~av~~~~~i~~~~~~~~~~~~~~hg~T~~GnPl~~Aaa~a~l~~i~~~  329 (423)
T PRK05630        250 GRTGELFATLSNGVQPDIMCVGKALTGGFMSFAATLCTDKVAQLISTPNGGGALMHGPTFMANPLACAVSHASLEIIETG  329 (423)
T ss_pred             CCCCCCHHHHHCCCCCCEEEECCHHHCCCCCEEEEEECHHHHHHHCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             74565202765699776898762432886762799763899975427678876505479997889999999999999847


Q ss_pred             CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCH
Q ss_conf             221011210000268899998867970755046400999872499--899999999689899626898899558986889
Q gi|254780432|r  296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVVRILPPLTITA  373 (392)
Q Consensus       296 ~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~  373 (392)
                      ++++|++++|++|+++|++|+ ++| .|.+|||+|+|+++|+..+  .....+.++++|+++.+.+ |+||++|||+||+
T Consensus       330 ~l~~~~~~~g~~l~~~L~~L~-~~p-~V~dVRG~Glm~~vel~~~~~~~~~~~~~~~~Gl~~~~~g-~~l~i~PPL~it~  406 (423)
T PRK05630        330 MWQKQVKRIEAELIAGLSPLR-HLP-GVADVRVLGAIGVIEMEQNVNVEEATQAALDHGVWIRPFG-RLLYVMPPYITTS  406 (423)
T ss_pred             CHHHHHHHHHHHHHHHHHHHC-CCC-CEEEEEECCEEEEEEECCCCCHHHHHHHHHHCCCEEEECC-CEEEEECCCCCCH
T ss_conf             899999999999999999870-699-6787730554999995686569999999996994798539-9999938936899


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999999
Q gi|254780432|r  374 EEIHEGLERIERTAI  388 (392)
Q Consensus       374 ~eid~~i~~l~~al~  388 (392)
                      +||++++++|+++|+
T Consensus       407 eei~~~~~~l~~alk  421 (423)
T PRK05630        407 EQCAQICTALHAAVK  421 (423)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             999999999999977


No 62 
>PRK09792 PLP-dependent GABA aminotransferase; Provisional
Probab=100.00  E-value=0  Score=738.37  Aligned_cols=376  Identities=31%  Similarity=0.514  Sum_probs=340.5

Q ss_pred             ECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHHHHHH
Q ss_conf             5155888-87489850103799679976464102267435787899999999999973145068-757818999998652
Q gi|254780432|r    7 LFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFANHLI   84 (392)
Q Consensus         7 ~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la~~L~   84 (392)
                      ..+.++. .|++++||+|+||||.|||+||||+||+|++++||+||+|.+|+++|++++.++.. .+.++...+|+++|.
T Consensus        14 ~~~~~~~~~~~~~e~a~G~~l~D~dG~~yLD~~sg~~~~~lGh~~p~v~~Ai~~Q~~~~~~~~~~~~~~~~~~~Lae~l~   93 (421)
T PRK09792         14 TPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTLAEKIN   93 (421)
T ss_pred             CCCCCCCCCCEEEEECCCCEEEECCCCEEEEECCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             77765899987999770498996999999892634885100689899999999999744675555446569999999999


Q ss_pred             HHCC---CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC
Q ss_conf             0101---33312356555403567776654320013478600234354656543212345532-1134799986433322
Q gi|254780432|r   85 HSTF---ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK-LQYLEGFGPKIEGFDQ  160 (392)
Q Consensus        85 ~~~~---~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~-~~~~~~~~p~~~~~~~  160 (392)
                      ...|   .++++|++|||||||+|||+||+|      |||++||+|+++|||+|.+++|+|++ ..++.+|+|.+.++.+
T Consensus        94 ~~~p~~~~~~v~f~~SGsEAvE~AiKlAr~~------tgr~~ii~~~~sYHG~T~ga~s~tg~~~~~~~~~~p~~~~~~~  167 (421)
T PRK09792         94 ALAPVSGQAKTAFFTTGAEAVENAVKIARAH------TGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYH  167 (421)
T ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHHHH------CCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCEEE
T ss_conf             8477678755998578357999999998875------2998599981785885230354328976433567889997378


Q ss_pred             CCCH----------HHHHHHHHC-----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             2100----------268875410-----1233222233322221124621012322110223457213101100344445
Q gi|254780432|r  161 AKFC----------DLQSLKNQI-----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRT  225 (392)
Q Consensus       161 ~~~~----------d~~~l~~~~-----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRt  225 (392)
                      +|++          +++.+++.+     +++|||||+|||||++|+++||++||++||++|++||++||+||||||||||
T Consensus       168 ~p~p~~~~~~~~~~~~d~~~~~~~~~~~~~~iAAvi~EPiqg~gG~~~~p~~yl~~lr~lc~~~gillI~DEV~tGfGRt  247 (421)
T PRK09792        168 VPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFART  247 (421)
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCEECCCCC
T ss_conf             07884224666233699999997644566745899965645778823089899999999998739679720221068636


Q ss_pred             CCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHC
Q ss_conf             55310111245453021034444443443210001112222233223453211110012334554320122210112100
Q gi|254780432|r  226 GKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA  305 (392)
Q Consensus       226 G~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g  305 (392)
                      |+||++|++|++|||+|+||+|+||+|+||+++++++++.+.++.|++||+|||++||||+++|++++++++++|++++|
T Consensus       248 G~~fa~e~~gv~PDii~~gK~l~gG~P~~av~~~~~v~~~~~~~~~~~Tf~Gnpl~~aaa~a~L~ii~~e~l~~~v~~~g  327 (421)
T PRK09792        248 GKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERANQLG  327 (421)
T ss_pred             CCCHHHHHHCCCCCEEEECCCCCCCCCEEEEEECHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             65226575099986876432234887718999728886467877647879989899999999999998658999999999


Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC---------HHHHHHHHHHCCEEEEECC--CCEEEECCCCCCCHH
Q ss_conf             00268899998867970755046400999872499---------8999999996898996268--988995589868899
Q gi|254780432|r  306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS---------PALLAAKFRDECLLTAPSS--DNVVRILPPLTITAE  374 (392)
Q Consensus       306 ~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~---------~~~~~~~l~~~Gll~~~~~--~~~irl~Ppl~it~~  374 (392)
                      ++|+++|+++.++|| .|.+|||+|||+++|+..+         ...+.+.++++|+++.+.+  +|+|||.|||+||++
T Consensus       328 ~~l~~~L~~~~~~~p-~v~~VRG~Glm~gvel~d~~~~~p~~~~~~~i~~~~~~~Gll~~~~g~~g~~i~~~PPL~it~~  406 (421)
T PRK09792        328 QRLKNTLIDAKESVP-AIAAVRGLGSMIAAEFNDPQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDA  406 (421)
T ss_pred             HHHHHHHHHHHHCCC-CEEEEEECEEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCEEEEECCEECCHH
T ss_conf             999999999975699-8898541418999997578778832999999999999779789944899898999799238899


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999998
Q gi|254780432|r  375 EIHEGLERIERTAIK  389 (392)
Q Consensus       375 eid~~i~~l~~al~~  389 (392)
                      |||+++++|+++|.+
T Consensus       407 eid~~~~il~~aL~e  421 (421)
T PRK09792        407 QFDAAMKILQDALSD  421 (421)
T ss_pred             HHHHHHHHHHHHHCC
T ss_conf             999999999999639


No 63 
>PRK12403 putative aminotransferase; Provisional
Probab=100.00  E-value=0  Score=737.61  Aligned_cols=385  Identities=26%  Similarity=0.395  Sum_probs=337.7

Q ss_pred             CCEECCCCC-------CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCC--CCH
Q ss_conf             314515588-------88748985010379967997646410226743578789999999999997314506875--781
Q gi|254780432|r    4 NDFLFNTYD-------QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLY--QST   74 (392)
Q Consensus         4 ~~~~~~~~~-------~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~--~~~   74 (392)
                      +.|+||.|.       ..|++|+||+|+||||.|||+||||.||+|++||||+||+|++|+++|++++.+.+..+  .++
T Consensus        19 ~~h~~h~~~~~~~~~~~~P~vi~ra~G~~v~D~dG~~ylD~~sg~~~~~lGh~~p~I~~Ai~~q~~~l~~~~~~~~~~~~   98 (460)
T PRK12403         19 AAHHIHAFLDQKALNAEGPRVMVRGEGLHLWDNDGKRYLDGMSGLWCTNLGYGRKDLAAAAARQMEQLPYYNMFFHTTHP   98 (460)
T ss_pred             HHHCCCCCCCCCCCCCCCCEEEEEEEECEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCH
T ss_conf             86467887784322578995899622288997998999995636886435579599999999999755871565456788


Q ss_pred             HHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999986520101--3331235655540356777665432001347860023435465654321234553211347999
Q gi|254780432|r   75 QQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFG  152 (392)
Q Consensus        75 ~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~  152 (392)
                      ...+|+++|++..|  +++++|+||||||||+|||+||+|+...|+++|.+||++.+||||+|++++++++.+.. ..++
T Consensus        99 ~~~elAe~L~~~~P~~~~~v~f~~sGSEA~E~AiklAr~y~~~~g~~~~~~ii~~~~~yHG~T~ga~s~sg~~~~-~~~~  177 (460)
T PRK12403         99 AVIELSELLFSLLPGHYSHAIYTNSGSEANEVLIRTVRRYWQVLGKPQKKIMIGRWNGYHGSTLAATALGGMKFM-HEMG  177 (460)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHCCCCCCC-CCCC
T ss_conf             999999999975787658698448718999999999999998608997469999668877407988724674124-4567


Q ss_pred             CCCCCCCCCCCHH-----------------HHHHHHH----CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCC
Q ss_conf             8643332221002-----------------6887541----012332222333222211246210123221102234572
Q gi|254780432|r  153 PKIEGFDQAKFCD-----------------LQSLKNQ----ISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDA  211 (392)
Q Consensus       153 p~~~~~~~~~~~d-----------------~~~l~~~----~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~  211 (392)
                      +..+++.+++++.                 ...+++.    .+++|||||+|||||++|+++||++||++||++|++||+
T Consensus       178 ~~~p~~~~~~~P~~~~~~~~~~~~~~~~~~~~~le~~i~~~~~~~iAavi~EPi~g~gG~i~pp~~yl~~lr~lc~~~gi  257 (460)
T PRK12403        178 GLIPDVAHIDEPYWYANGGELTPAEFGRRAALQLEEKILELGAENVAGFVAEPFQGAGGMIFPPESYWPEIQRICRQYDV  257 (460)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCEECCCHHHHHHHHHHHHCCCC
T ss_conf             88998411477544556677887788899999999999962898669999545225586572756776999999732596


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCHHHHH
Q ss_conf             1310110034444555310111245453021034444443-44321000111222223----322345321111001233
Q gi|254780432|r  212 LLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQ----GSHGSTYGGNVLAMVLGE  286 (392)
Q Consensus       212 llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~----~~~~~T~~gnpl~~aaa~  286 (392)
                      +||+|||||||||||+||++|++||+|||+|+||+|+||| |+|||+++++|++.+.+    ..|++||+|||++||||+
T Consensus       258 llI~DEV~tGfGRtG~~fa~e~~gV~PDivt~gK~l~gG~~Plsav~~~~~i~~~~~~~~~~~~hg~T~~Gnpla~Aaal  337 (460)
T PRK12403        258 LLCADEVIGGFGRTGEWFAHEHFGFEPDTLSIAKGLTSGYVPMGGLVLSKRIAEALVEQGGVFAHGLTYSGHPVAAAVAI  337 (460)
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             69986251277634377300217958771222124457877617997358999875037865014778899989999999


Q ss_pred             HHHHHHHCCCCCCHHHH-HCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH---------H----HHHHHHHHCC
Q ss_conf             45543201222101121-00002688999988679707550464009998724998---------9----9999999689
Q gi|254780432|r  287 KVLNIIQSDGFLENVIN-IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP---------A----LLAAKFRDEC  352 (392)
Q Consensus       287 a~L~~l~~~~l~~~~~~-~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~---------~----~~~~~l~~~G  352 (392)
                      ++|++++++++++|+++ +|++|+++|+++.++|| +|.+|||+|||+++|++.++         .    .+...++++|
T Consensus       338 a~l~~i~~e~l~~~~~~~~g~~l~~~L~~l~~~~p-~vgdVRG~GLm~gielv~~~~~~~~~~~~~~~~~~~~~~~~~~G  416 (460)
T PRK12403        338 ANLKALRDEGVVTRVKDDTGPYLQRCLREVFGDHP-LVGEVQGAGLVAALQFAEDKATRKRFANENDLAWRCRTIGFEEG  416 (460)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEECCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             99999986669999999999999999999872599-58863014549999942576421136525789999999999799


Q ss_pred             EEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             899626898899558986889999999999999999852
Q gi|254780432|r  353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       353 ll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +++++..+ .++|.|||+||++|||+++++|+++|.+++
T Consensus       417 lli~~~~~-~~~l~PPLiit~~eid~~~~~l~~al~~~~  454 (460)
T PRK12403        417 VIIRSTLG-RMIMAPALVAGRAEIDELVDKTRIAVDRTA  454 (460)
T ss_pred             EEEEECCC-EEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             89973698-099989943889999999999999999999


No 64 
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated
Probab=100.00  E-value=0  Score=736.17  Aligned_cols=386  Identities=29%  Similarity=0.445  Sum_probs=338.2

Q ss_pred             CCCEECCCCCC----CCE-EEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHH
Q ss_conf             43145155888----874-89850103799679976464102267435787899999999999973145068-7578189
Q gi|254780432|r    3 KNDFLFNTYDQ----SDI-RFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQ   76 (392)
Q Consensus         3 ~~~~~~~~~~~----~p~-~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~   76 (392)
                      |++|+||.|.+    .|+ .|+||+|+||||.|||+||||.||+|++++||+||+|.+|+++|++++.|+.. .+.++..
T Consensus         9 d~~~~~hp~t~~~~~~~~~~I~~a~G~~l~D~dG~~ylD~~sg~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~   88 (428)
T PRK07986          9 DQRHIWHPYTSMTSPLPVYPVASAEGCELILADGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFGGITHQPA   88 (428)
T ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEECCEEEECCCCEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHH
T ss_conf             98517899766677889967696332889979999999866228750047996999999999997578703688677899


Q ss_pred             HHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             999986520101--3331235655540356777665432001347860023435465654321234553211-3479998
Q gi|254780432|r   77 EIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQ-YLEGFGP  153 (392)
Q Consensus        77 ~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~-~~~~~~p  153 (392)
                      .+|+++|++..|  +++|+|+||||||||+|||+||+|+..+| ++|++||+|++||||+|++++|+|+... .+..+.+
T Consensus        89 ~~lae~L~~~~p~~l~~vff~~sGSEAvE~AlKlAr~y~~~~g-~~r~~ii~~~~syHG~T~gals~t~~~~~~~~~~~~  167 (428)
T PRK07986         89 IELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQYWQAKG-EPRQRFLTFRHGYHGDTFGAMSVCDPDNSMHSLYKG  167 (428)
T ss_pred             HHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHC-CCCCEEEEECCCCCCCCHHHEEECCCCCCCCCCCCC
T ss_conf             9999999984888758699648628999999999999999709-986449998387389971225731686444345577


Q ss_pred             CCCCCC-----------CCCCHHHHHHHHHC---CCCCCCCCCCCC-CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC
Q ss_conf             643332-----------22100268875410---123322223332-222112462101232211022345721310110
Q gi|254780432|r  154 KIEGFD-----------QAKFCDLQSLKNQI---SNDTAAILIEPI-QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV  218 (392)
Q Consensus       154 ~~~~~~-----------~~~~~d~~~l~~~~---~~~iAavi~Epv-~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV  218 (392)
                      ..+...           ....+|+..+++.+   .++|||||+||| ||+||+++||++||++||++|++||++||+|||
T Consensus       168 ~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iAAviiEPi~qg~gG~~~p~~~yl~~lr~lc~~~gillI~DEV  247 (428)
T PRK07986        168 YLPENLFAPAPQSRFDGEWDERDIAPFARLMAAHRHEIAAVILEPIVQGAGGMRIYHPEWLKRIRKLCDREGILLIADEI  247 (428)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEECCHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             79985013788766565557123999999997478870189983244676983538999999999999863963661100


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             034444555310111245453021034444443-443210001112222233-----22345321111001233455432
Q gi|254780432|r  219 QTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQG-----SHGSTYGGNVLAMVLGEKVLNII  292 (392)
Q Consensus       219 ~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~~-----~~~~T~~gnpl~~aaa~a~L~~l  292 (392)
                      ||||||||+||++|++||+|||+|+||+|+||| |+|++++++++++.+..+     .|++||+|||++||||+++|+++
T Consensus       248 ~tGfGRtG~~fa~e~~gv~PDiit~gKgl~gG~~Pl~av~~~~~i~~~~~~~~~~~f~hg~Tf~Gnpla~Aaa~a~L~~i  327 (428)
T PRK07986        248 ATGFGRTGKLFACEHAGIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCFMHGPTFMGNPLACAVANASLSLL  327 (428)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEECHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             02788667865000047899889975201388775389998699996305687654101778999989999999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEEEECCCCC
Q ss_conf             012221011210000268899998867970755046400999872499--899999999689899626898899558986
Q gi|254780432|r  293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVVRILPPLT  370 (392)
Q Consensus       293 ~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~  370 (392)
                      +++++++|++++|++|+++|++|+ ++ ++|.+|||+|+|+++|+..+  ...+.+.++++|+++.+.+ |+|+|+|||+
T Consensus       328 ~~~~l~~~~~~~g~~l~~~L~~L~-~~-~~V~dVRg~Gl~~~ve~~~p~~~~~~~~~~~~~Gll~~~~g-~~i~l~PPLi  404 (428)
T PRK07986        328 ESGDWQQQVAAIESQLREELAPLR-DA-EMVADVRVLGAIGVVETTRPVNMAALQRFFVEQGVWIRPFG-KLIYLMPPYI  404 (428)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHH-CC-CCEEEEEECCEEEEEEECCCCCHHHHHHHHHHCCCEEEECC-CEEEEECCCC
T ss_conf             865699999999999999999875-59-95787742672899980794539999999997994897459-9999989914


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899999999999999998529
Q gi|254780432|r  371 ITAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       371 it~~eid~~i~~l~~al~~L~~  392 (392)
                      ||++|||+++++|+++|.+..+
T Consensus       405 it~~ei~~~~~~l~~al~e~t~  426 (428)
T PRK07986        405 ILPEQLQRLTAAVNRAVQDETF  426 (428)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999975522


No 65 
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional
Probab=100.00  E-value=0  Score=731.32  Aligned_cols=362  Identities=36%  Similarity=0.622  Sum_probs=341.8

Q ss_pred             CCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             58888748985010379967997646410226743578789999999999997314506875781899999865201013
Q gi|254780432|r   10 TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFA   89 (392)
Q Consensus        10 ~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~~   89 (392)
                      +|++.|+.|+||+|+|+||.|||+||||+||+|+++|||+||+|++|+++|++++.+.++.+.++...+++++|.+..++
T Consensus         2 ~~y~~~i~ivrg~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~ai~~ql~~~~~~~~~~~~~~~~~l~~~l~~~~~~   81 (364)
T PRK04013          2 SLYRKRLRLVRGEGIYVWDSQGRRYLDLIAGIGVNVLGHNHPEWVEEMSEQLEKLVVAGPMFEHEEKEEMLEELSKWVNY   81 (364)
T ss_pred             CCCCCCCCEEEEECCEEEECCCCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             98888876898478999969979999957527765654898899999999997557657763658999999997525797


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             33123565554035677766543200134786002343546565432123455321134799986433322210026887
Q gi|254780432|r   90 DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSL  169 (392)
Q Consensus        90 ~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l  169 (392)
                      ++|+|++|||||||+|||+||+|      |+|++||+++++|||+|.+++++++++.++++|+|..+++.++||+|++++
T Consensus        82 ~~v~f~~SGseAve~AiklAr~~------tgr~~ii~~~~~yHG~t~g~ls~~~~~~~~~~~~~~~~~~~~~p~~d~~~~  155 (364)
T PRK04013         82 EYVYMGNSGTEAVEAALKFARLY------TGRKEIIAMTNAFHGRTMGALSATWKPKYREDFEPLVPGFKHIPFNDVEAA  155 (364)
T ss_pred             CEEEECCCHHHHHHHHHHHHHHC------CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCHHHH
T ss_conf             88996388469999999998762------799989996488677866633445773334577899887055576439999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCC
Q ss_conf             54101233222233322221124621012322110223457213101100344445553101112454530210344444
Q gi|254780432|r  170 KNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGG  249 (392)
Q Consensus       170 ~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~g  249 (392)
                      ++.+.+++||||+|||||++|+++||++||+++|++|++||++||+||||||| |||+||++|+||++|||+|+||+|||
T Consensus       156 ~~~~~~~iAavi~EPi~g~~G~~~~~~~yl~~lr~lc~~~gillI~DEV~tGf-RtG~~~a~e~~gv~PDiv~~gKglgg  234 (364)
T PRK04013        156 KEAITKETAAVIFEPIQGEGGIVPAKEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYKVEPDIVTMGKGIGN  234 (364)
T ss_pred             HHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC-CCCCCCHHHCCCCCCCEEEECCCCCC
T ss_conf             98726673599997677788862487799999999999769976710230360-43430231158999989996340008


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             43443210001112222233223453211110012334554320122210112100002688999988679707550464
Q gi|254780432|r  250 GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQ  329 (392)
Q Consensus       250 G~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~  329 (392)
                      |+|+|+|+++.++    .++.|++||+|||++|+||+++|++++++++++|+++.       +.++  ++ ..+.+|||+
T Consensus       235 G~Pl~av~~~~~i----~~~~h~~T~~Gnp~~~aaa~a~L~ii~~e~l~~~~~~~-------~~~~--~~-~~v~~vRG~  300 (364)
T PRK04013        235 GVPVSLTLTNFDV----ERGKHGSTFGGNPLACKAVAVTLRILRRERLVEKAGEK-------FIEI--KG-ERVVTTRGR  300 (364)
T ss_pred             CCCCEEEEECCCC----CCCCCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHH-------HHHH--CC-CCEEEEECC
T ss_conf             8651899964101----13765675588989999999999999866399999999-------9985--65-700898615


Q ss_pred             EEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             009998724998999999996898996268988995589868899999999999999998529
Q gi|254780432|r  330 GLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       330 Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~~  392 (392)
                      |||+++|+..+...+.+.++++|+++.+.++++|||.|||+||++|||+++++|++++.+|..
T Consensus       301 GL~~gie~~~p~~~~~~~~~~~G~l~~~~g~~virl~PPL~it~~eid~~~~~l~~al~ev~~  363 (364)
T PRK04013        301 GLMIGIVLKKPVGKYVEELQNRGYLVHTAGQRVIRLLPPLIISKDTMEEAKSAIEGVINDILG  363 (364)
T ss_pred             CEEEEEEECCCHHHHHHHHHHCCEEEEECCCCEEEEECCEECCHHHHHHHHHHHHHHHHHHHC
T ss_conf             379999977848999999995996996379998999888137899999999999999999857


No 66 
>TIGR03372 putres_am_tran putrescine aminotransferase. Members of this family are putrescine aminotransferase, as found in Escherichia coli, Erwinia carotovora subsp. atroseptica, and closely related species. This pyridoxal phosphate enzyme, as characterized in E. coli, can act also on cadaverine and, more weakly, spermidine.
Probab=100.00  E-value=0  Score=732.67  Aligned_cols=370  Identities=35%  Similarity=0.589  Sum_probs=342.6

Q ss_pred             CEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCC
Q ss_conf             74898501037996799764641022674357878999999999999731450687578189999986520101--3331
Q gi|254780432|r   15 DIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRV   92 (392)
Q Consensus        15 p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v   92 (392)
                      ++.|..+...|+||.|||+||||.||+|++++||+||+|++|+++|+++..+.+..+.++.+.+|+++|++..|  .+++
T Consensus        58 ~~~~~~~~~~~L~D~dG~~YLD~~sG~~~~~lGH~hp~I~~Ai~~Ql~~~~~~s~~~~~~~~~~lae~L~~~~P~~~~~v  137 (442)
T TIGR03372        58 AVEWQAGGLNTLIDTQGNEFIDCLGGFGIFNVGHRNPNVIAAVENQLAKQPLHSQELLDPLRALLAKTLAALTPGKLKYS  137 (442)
T ss_pred             EEEEECCCCCEEEECCCCEEEECCHHHHHHHCCCCCHHHHHHHHHHHHHCCCEECCCCCHHHHHHHHHHHHHCCCCCCEE
T ss_conf             58996388167997989998884563885100679899999999997236830144456899999999997478887879


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             23565554035677766543200134786002343546565432123455321134799986433322210026887541
Q gi|254780432|r   93 FFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQ  172 (392)
Q Consensus        93 ~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~  172 (392)
                      +|+||||||||+|||+||+|+..   +||.+||+++++|||+|++++|+++++.++++|.|..+++.+++++|++++++.
T Consensus       138 ff~nSGSEAvE~AiKlAr~y~~~---~Gk~~ii~~~~syHG~T~ga~s~t~~~~~~~~~~p~~~~~~~~~~~d~~~~~~~  214 (442)
T TIGR03372       138 FFCNSGTESVEAALKLAKAYQSP---RGKFTFIAASGAFHGKSLGALSATAKPAFRKPFMPLLPGFHHVAFGDIEAMLKA  214 (442)
T ss_pred             EECCCCHHHHHHHHHHHHHHHHC---CCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCHHHHHHH
T ss_conf             86388679999999999997326---898189999167787475703024784335788789998255578999999999


Q ss_pred             C------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             0------1233222233322221124621012322110223457213101100344445553101112454530210344
Q gi|254780432|r  173 I------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG  246 (392)
Q Consensus       173 ~------~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~  246 (392)
                      +      .++|||||+|||||++|+++||++||+++|++|++||++||+|||||||||||+||++|++||+|||+|+||+
T Consensus       215 ~~~~~~~~~~iAaviiEPiqg~gG~~~p~~~yl~~lr~lc~~~gvllI~DEVqtGfGRTG~~fa~e~~gV~PDIvt~gKg  294 (442)
T TIGR03372       215 LNECKKTGDDVAAIILEPIQGEGGVILPPEGYLPAVRALCDEFGALLILDEVQTGMGRTGKMFACEHEGVQPDILCLAKA  294 (442)
T ss_pred             HHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHH
T ss_conf             99887559978999984677777874499999999999999849703236212279847783376548999976865454


Q ss_pred             CCCC-CCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEE
Q ss_conf             4444-3443210001112222--233223453211110012334554320122210112100002688999988679707
Q gi|254780432|r  247 MGGG-FPIGACLATNEVAACM--NQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMF  323 (392)
Q Consensus       247 l~gG-~P~sav~~~~~i~~~~--~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v  323 (392)
                      |||| +|+|++++++++++.+  .+..|++||+|||++|+||+++|+++++++++++++++|++|+++|+++.++||++|
T Consensus       295 LggG~~Pi~av~~~~~i~~~~~~~~~~h~sTf~Gnpla~aaalavL~~i~~~~l~~~~~~~G~~l~~~L~~L~~~~p~~V  374 (442)
T TIGR03372       295 LGGGVMPIGATIATEAVFSVLFDNPFLHTTTFGGNPLACAAALATINELLEKNLPAQAAIKGDFLLDGFQQLAAEYPDLI  374 (442)
T ss_pred             HCCCCCCEEEEEECHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             15887762689750999877624897547888989999999999999998656999999999999999999987687816


Q ss_pred             EEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEEC--CCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             55046400999872499--899999999689899626--89889955898688999999999999999
Q gi|254780432|r  324 LEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPS--SDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       324 ~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~--~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      .+|||+|||+++|++.+  ...+.+.++++|+++.+.  +.++|||.|||+||++|||+++++|+++|
T Consensus       375 ~dVRG~GLm~giE~~~~~~~~~~~~~~~~~gvl~~~~~~~~~~iri~PPL~it~eeid~~i~~l~~aL  442 (442)
T TIGR03372       375 IEARGKGLLMAIEFRDNEIGYAFAKELFQQNILVAGTLNNAKSIRIEPPLTITIEQCALVIKAAKDAL  442 (442)
T ss_pred             EEEEECCEEEEEEECCCHHHHHHHHHHHHCCCEEEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             68564538999997881679999999997897998558998989998895089999999999999869


No 67 
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase; InterPro: IPR012773    Members of this family of class III pyridoxal-phosphate-dependent aminotransferases are diaminobutyrate--2-oxoglutarate aminotransferase (2.6.1.76 from EC) that catalyze the first step in ectoine biosynthesis from L-aspartate beta-semialdehyde. This family is readily separated phylogenetically from enzymes with the same substrate and product but involved in other process such as siderophore (Q9Z3R2 from SWISSPROT) or 1,3-diaminopropane (P44951 from SWISSPROT) biosynthesis. Ectoine is a compatible solute particularly effective in conferring salt tolerance.; GO: 0030170 pyridoxal phosphate binding, 0047307 diaminobutyrate-pyruvate transaminase activity, 0019491 ectoine biosynthetic process.
Probab=100.00  E-value=0  Score=735.83  Aligned_cols=380  Identities=32%  Similarity=0.562  Sum_probs=348.8

Q ss_pred             CCCEECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHH--CCCCCCCCCCHHHH--
Q ss_conf             43145155888-87489850103799679976464102267435787899999999999973--14506875781899--
Q gi|254780432|r    3 KNDFLFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK--LWHVSNLYQSTQQE--   77 (392)
Q Consensus         3 ~~~~~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~--~~~~~~~~~~~~~~--   77 (392)
                      +-|--+|+|++ +|++|+||+|+||||.|||+||||.||.|+.|.|||||.|++++.+.++.  +.|.-++++...+.  
T Consensus         5 ~~ES~VRSY~R~FPtvF~~AkG~~L~D~~Gk~YIDFlaGAGaLNYGHN~p~~K~~L~~Yl~~DGI~hsLDM~T~AK~~Fl   84 (413)
T TIGR02407         5 ELESEVRSYCRSFPTVFEKAKGSTLWDEDGKEYIDFLAGAGALNYGHNNPKLKQALIDYLADDGIIHSLDMATEAKREFL   84 (413)
T ss_pred             CCCCCCCCCCCCCHHHHHHCCCCEEEECCCCEEECHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCHHHHHHH
T ss_conf             01212000358860354312265787034873110210156467888898999999999985893362002417899999


Q ss_pred             -HHHHHHHHHCCCC-CCCC-CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             -9998652010133-3123-565554035677766543200134786002343546565432123455321134799986
Q gi|254780432|r   78 -IFANHLIHSTFAD-RVFF-TNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPK  154 (392)
Q Consensus        78 -~la~~L~~~~~~~-~v~f-~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~  154 (392)
                       .|.+.++++..+| ||.| ..+||.|||+||||||++      |||.-||||+|||||+|+||+|+||+..+|++.+-.
T Consensus        85 ~~F~~~IL~PR~LdYK~qFpGPTGTNaVEsAlKLARKv------tGR~nvvaFTNaFHGmt~GsLsvTGN~~~R~~aG~~  158 (413)
T TIGR02407        85 ETFQEIILKPRGLDYKVQFPGPTGTNAVESALKLARKV------TGRSNVVAFTNAFHGMTLGSLSVTGNRFKRQGAGVP  158 (413)
T ss_pred             HHHHHHCCCCCCCCCEEECCCCCCHHHHHHHHHHHHCC------CCCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99998526788789515688878640799999998503------898406885177302348988864334443026744


Q ss_pred             CCCCCCCCC--------HHHHHHHHHCCC------CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCC
Q ss_conf             433322210--------026887541012------332222333222211246210123221102234572131011003
Q gi|254780432|r  155 IEGFDQAKF--------CDLQSLKNQISN------DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQT  220 (392)
Q Consensus       155 ~~~~~~~~~--------~d~~~l~~~~~~------~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~t  220 (392)
                      ..++...||        +++..+++.+.|      .+||||+||||||||+.+++.+||++|++|||+||||||+|+||.
T Consensus       159 ~~~v~~mPYDgY~~~~~D~~~Yfe~~L~D~sSGvd~PAAvILETVQGEGGiNvAs~eWLq~l~~lCr~~DILLIVDDIQa  238 (413)
T TIGR02407       159 LSNVSRMPYDGYLGGEVDTIAYFEKLLEDSSSGVDLPAAVILETVQGEGGINVASKEWLQRLEKLCRRHDILLIVDDIQA  238 (413)
T ss_pred             CCCCEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEC
T ss_conf             77825687655778643228999986178889847672589811037577031235579999999986498687731741


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEECCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-HHCCCCC
Q ss_conf             44445553101112454530210344444-434432100011122222332234532111100123345543-2012221
Q gi|254780432|r  221 GYGRTGKLFAYEWANVKPDIMTIAKGMGG-GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNI-IQSDGFL  298 (392)
Q Consensus       221 G~GRtG~~f~~e~~gi~PDi~~~gK~l~g-G~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~-l~~~~l~  298 (392)
                      |+||||+||+||..||+|||||+||+|+| |+|+|.|+.+.|+ |.|+|++|..||.||.+|..+|.++|+. +.++.+.
T Consensus       239 GCGRTG~FFSFE~AgI~PDiVcLSKSisG~GLPlal~L~kPe~-D~W~PGEHNGTFRGNNlAFVtA~aAL~~yW~Dd~f~  317 (413)
T TIGR02407       239 GCGRTGTFFSFEPAGIEPDIVCLSKSISGYGLPLALVLIKPEL-DVWKPGEHNGTFRGNNLAFVTATAALEYYWSDDAFE  317 (413)
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHCCCC-CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHH
T ss_conf             8888789645344677566178502003551268999735456-746788778864665278999999999848962689


Q ss_pred             CHHHHHCCHHHHHHHHHHHHCCCEE-EEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECC--CCEEEECCCCCCCH
Q ss_conf             0112100002688999988679707-55046400999872499--8999999996898996268--98899558986889
Q gi|254780432|r  299 ENVINIAKILFEGLTAIKNRFPNMF-LEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSS--DNVVRILPPLTITA  373 (392)
Q Consensus       299 ~~~~~~g~~l~~~L~~l~~~~~~~v-~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~--~~~irl~Ppl~it~  373 (392)
                      ++++++++.+.+.|+++.++||..+ .++||+|||+||++...  ...+++.|+++||++-.+|  +++|+|.|||||++
T Consensus       318 ~~v~~~s~~~~~~l~~~~~~~~~~~~~~~RGRGlm~Gl~~~~~~~A~~i~~~aF~~GLiiEtsGp~DeV~K~lPpLTI~~  397 (413)
T TIGR02407       318 KAVQRKSEIIQERLDEIVAEFPELIEKSVRGRGLMQGLECGDGDLAGKIAKAAFENGLIIETSGPEDEVIKLLPPLTIDE  397 (413)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCCCEEEECCCCCCCH
T ss_conf             99999999999999999987455213110452014200047724689999998646838987188984587038898887


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999998
Q gi|254780432|r  374 EEIHEGLERIERTAIK  389 (392)
Q Consensus       374 ~eid~~i~~l~~al~~  389 (392)
                      ++|++++++|++|+.+
T Consensus       398 ~~L~~GL~IL~~a~~~  413 (413)
T TIGR02407       398 ETLQQGLDILEQAVEE  413 (413)
T ss_pred             HHHHHHHHHHHHHHHC
T ss_conf             8899999999999719


No 68 
>PRK08297 L-lysine aminotransferase; Provisional
Probab=100.00  E-value=0  Score=724.09  Aligned_cols=388  Identities=27%  Similarity=0.416  Sum_probs=323.2

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEEC-CCCEEEECHHHHHHHCCCCCCHHHHHHHHH--HHHHCCC---CCCCCCCHHHH
Q ss_conf             31451558888748985010379967-997646410226743578789999999999--9973145---06875781899
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSE-NGIPFLDFASGIAVNSLGHSHPELVAILKS--QSEKLWH---VSNLYQSTQQE   77 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~-dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~--q~~~~~~---~~~~~~~~~~~   77 (392)
                      ++|++.+++|+|+.|+||+|+||||. |||+||||+||+|++++||+||+|+++++.  |+.....   .+..+.+...+
T Consensus        25 ~~~~~~~~~~~pi~iergeG~yl~D~~DG~~YLD~~sg~~~~~lGH~hP~iv~a~~~~~~~~~~~~~~~~~~~~~~~~~~  104 (449)
T PRK08297         25 SRSILADGFDLVLDLERSRGSYLVDARTGRRYLDMFTFFASSALGMNHPALADDPEFRAELAQAALNKPSNSDVYTVAMA  104 (449)
T ss_pred             HHHHCCCCCCCCEEEEEEECCEEEECCCCCEEEECHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             87532127997527885153999999999886572252998888479899998799999999998736465236669999


Q ss_pred             HHHHHHHHHC---CCCCCCCCCCCCCCHHHHHHHHHHHHHCC----CCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9998652010---13331235655540356777665432001----3478--6002343546565432123455321134
Q gi|254780432|r   78 IFANHLIHST---FADRVFFTNSGAESVECAIKTARRYHYMA----GKTN--KFRIVTFEGAFHGRTLATISAGGKLQYL  148 (392)
Q Consensus        78 ~la~~L~~~~---~~~~v~f~~SGseA~e~Aiklar~~~~~~----g~t~--r~~ii~~~~~yHG~t~~a~s~s~~~~~~  148 (392)
                      ++++++++..   .+++|+|+||||||||+|||+||+|+...    |++.  +++||+|+++|||+|.+++|+|+...++
T Consensus       105 ~l~~~l~~~~~~~~l~~vff~nsGSEAvE~AlKlA~~~~~r~~~~~g~~~~~~~kii~~~~sYHG~T~gals~tg~~~~~  184 (449)
T PRK08297        105 RFVDTFARVLGDPALPHLFFVDGGALAVENALKVAFDWKSRHNEAHGIDPALGTRVLHLRGAFHGRSGYTLSLTNTDPVK  184 (449)
T ss_pred             HHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHCCCCCC
T ss_conf             99999998618877775886187689999999999998654300236777677569996365379607778861798533


Q ss_pred             CCCCCCCCC----CCC------------CCCHHHHHHHHH---CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCC
Q ss_conf             799986433----322------------210026887541---0123322223332222112462101232211022345
Q gi|254780432|r  149 EGFGPKIEG----FDQ------------AKFCDLQSLKNQ---ISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDI  209 (392)
Q Consensus       149 ~~~~p~~~~----~~~------------~~~~d~~~l~~~---~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~  209 (392)
                      ..+.|....    .+.            ....+++.+++.   .+++|||||+|||||+||+++||++||++||++|++|
T Consensus       185 ~~~~p~~~~~~~~~P~~~~~~~~~~~~~~~~~~l~~l~~~i~~~~~~iAAvIvEPIqG~gG~~~~p~~yl~~lr~lc~~~  264 (449)
T PRK08297        185 TARFPKFDWPRIDAPYVRPGLDADAVAALEAEALRQARAAFEAHPHDIACFIAEPIQGEGGDRHFRPEFFAAMRALCDEH  264 (449)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             57888888877889987789873016678999999999999858997799999678747799889989999999999971


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             721310110034444555310111245453021034444443443210001112222-2332234532111100123345
Q gi|254780432|r  210 DALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACM-NQGSHGSTYGGNVLAMVLGEKV  288 (392)
Q Consensus       210 g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~-~~~~~~~T~~gnpl~~aaa~a~  288 (392)
                      |++||+|||||||||||+||++|++||+|||+|+||+|++|.++++....+.....+ .++.+++||+|||++|+||+++
T Consensus       265 giLLI~DEVqtGfGRTG~~fa~e~~gv~PDiit~~Kgl~~G~~~~~~~~~~~~~~~~~~~~~~~sTf~Gnp~acaaala~  344 (449)
T PRK08297        265 DALLIFDEVQTGCGLTGTAWAYQQLGVAPDVVAFGKKTQVCGVMAGRRVDEVADNVFAVSSRINSTWGGNLTDMVRARRI  344 (449)
T ss_pred             CCEEECCCCEECCCCCCCHHHCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             88454452202787676513313358999889877633455077889999999886416877788889888999999999


Q ss_pred             HHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH--HHHHHHHHHCCEEEEECCCCEEEEC
Q ss_conf             54320122210112100002688999988679707550464009998724998--9999999968989962689889955
Q gi|254780432|r  289 LNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP--ALLAAKFRDECLLTAPSSDNVVRIL  366 (392)
Q Consensus       289 L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~--~~~~~~l~~~Gll~~~~~~~~irl~  366 (392)
                      |++|+++++++|++++|++|.++|+++.++||+++.+|||+|||+++|+..+.  ..+..+++++|+++.+.+.|+|||+
T Consensus       345 L~ii~~e~l~~~~~~~g~~l~~~L~~l~~~~p~ii~dVRG~GLm~giel~~~~~~~~~~~~~~~~Gll~~~~g~~~irl~  424 (449)
T PRK08297        345 LEVIEAEGLFDRARQQGAYLLARLDELAAEFPAVVLDPRGRGLMCAFSLPTTADRDELIRRLWRERVILLPAGEDSVRFR  424 (449)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCEEEEEECCCHHHHHHHHHHHHHCCCEEEECCCCEEEEE
T ss_conf             99984304999999999999999999997689844653115689999828867899999999978958975799979998


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             8986889999999999999999852
Q gi|254780432|r  367 PPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       367 Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      |||+||++|||+++++|+++|.+|+
T Consensus       425 PPL~it~~eid~~~~~l~~al~ela  449 (449)
T PRK08297        425 PALTVSRAEIDAAVDAVRRVLRTLA  449 (449)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             9912889999999999999999869


No 69 
>KOG1402 consensus
Probab=100.00  E-value=0  Score=713.71  Aligned_cols=386  Identities=36%  Similarity=0.633  Sum_probs=369.7

Q ss_pred             CCCEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             43145155888874898501037996799764641022674357878999999999999731450687578189999986
Q gi|254780432|r    3 KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANH   82 (392)
Q Consensus         3 ~~~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~   82 (392)
                      |++|.+|+|+|.|++|+||+|+++||.+|++|+||.++++++|.|||||.|++|+++|.++++.++..|.+....+++|.
T Consensus        30 E~k~~ahnyhpLpvvf~ka~g~~vwD~eGk~ylDflsaysaVnqGhchpki~~aLqeq~~kLtlssrafYnd~~~~f~~~  109 (427)
T KOG1402          30 ENKYGAHNYHPLPVVFSKAKGSRVWDPEGKEYLDFLSAYSAVNQGHCHPKIIKALQEQADKLTLSSRAFYNDVLGEFAEY  109 (427)
T ss_pred             HHHCCCCCCCCCCEEEEECCCCEEECCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             44415444776755888167857987775503446655421025778779999999987675133677765567899999


Q ss_pred             HHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC
Q ss_conf             520101333123565554035677766543200134--786002343546565432123455321134799986433-32
Q gi|254780432|r   83 LIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGK--TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEG-FD  159 (392)
Q Consensus        83 L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~--t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~-~~  159 (392)
                      +...+++++|.-+|+|.||+|.|+|+||+|.+..+.  ..+.+|++..++|||+|++++|+|+++..+++|+|++|+ ++
T Consensus       110 vt~lf~~~kvlpmnTGaEa~Eta~KLaR~wgy~~K~ip~nka~il~~~~nFhGrT~~ais~s~d~ds~~~fgp~~P~~~~  189 (427)
T KOG1402         110 VTKLFGYDKVLPMNTGAEAVETACKLARKWGYRKKNIPKNKAKILSAENNFHGRTLGAISLSTDPDSWDGFGPFLPGVVD  189 (427)
T ss_pred             HHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCEEEEEEECCCCCHHHCCCCCCCCCCE
T ss_conf             99866854553235540677879999999777631688660048985055567334567715780065456999998630


Q ss_pred             CCCCHHHHHHHHHCC-CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             221002688754101-2332222333222211246210123221102234572131011003444455531011124545
Q gi|254780432|r  160 QAKFCDLQSLKNQIS-NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP  238 (392)
Q Consensus       160 ~~~~~d~~~l~~~~~-~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~P  238 (392)
                      .+||+|+++++..+. .++|+||+|||||++|+++||++||+++|+||++|+++||+||||||+||||+||+++|.+++|
T Consensus       190 ~v~Y~d~eale~~l~~~~vaaFivEPIQGEaGVvvP~~GYL~~vreLCtkynvl~I~DEvQTGl~RTGk~la~d~env~P  269 (427)
T KOG1402         190 KVPYGDAEALEVALKSPNVAAFIVEPIQGEAGVVVPPPGYLKKVRELCTKYNVLLIADEVQTGLARTGKLLACDYENVRP  269 (427)
T ss_pred             EECCCCHHHHHHHHCCCCEEEEEEECCCCCCCEEECCCHHHHHHHHHHHHHCEEEEEHHHHHCCCCCCCEEEEEHHHCCC
T ss_conf             32268779999986298756898511346653372892067899999875147888244342523467478865431587


Q ss_pred             CEEECCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHH
Q ss_conf             302103444444-3443210001112222233223453211110012334554320122210112100002688999988
Q gi|254780432|r  239 DIMTIAKGMGGG-FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKN  317 (392)
Q Consensus       239 Di~~~gK~l~gG-~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~  317 (392)
                      ||+.+||+|+|| ||+|+|+.+++||..++|++|+|||+|||++|++|.|+||++++++|.+|++++|..|+.+|+++..
T Consensus       270 DivilgKalSGG~~Pvsavl~~~~im~~~~pgeHgsTyggNpLg~~vaiAalevi~eekL~era~~lG~~l~~~L~~l~~  349 (427)
T KOG1402         270 DIVILGKALSGGVYPVSAVLADDDIMLNIKPGEHGSTYGGNPLGCAVAIAALEVIVEEKLVERAAKLGEILRDQLNKLQK  349 (427)
T ss_pred             CEEEEECCCCCCEEEEEEEEECHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             76898111368704568998547898616877555656888088899999999999978999999987999999985440


Q ss_pred             HCCCEEEEECCCEEEEEEEECCC------HHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             67970755046400999872499------899999999689899626898899558986889999999999999999
Q gi|254780432|r  318 RFPNMFLEVRGQGLLIGLKTVFS------PALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       318 ~~~~~v~~vRG~Gl~~~ie~~~~------~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      ++|.++++|||+|++.+|++...      ...++-.+.++|++..++++|+|||+|||+|+++|+++.+++|++++.
T Consensus       350 ~~p~~v~~VRGrGl~~ai~i~~~~~~~~~aw~~cl~lk~~g~LAkptH~~IiRfaPPL~I~e~dl~eg~e~i~k~i~  426 (427)
T KOG1402         350 KFPHVVKEVRGRGLLNAIVINPSKTSGQDAWDVCLALKENGLLAKPTHGNIIRFAPPLVISEEDLREGIEAIEKTIA  426 (427)
T ss_pred             CCCCHHHEEECCCEEEEEEECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             25644433422533788996155566465888887030256104777887587468843578999889999999742


No 70 
>TIGR00700 GABAtrnsam 4-aminobutyrate transaminase; InterPro: IPR004632   Eukaryotic 4-aminobutyrate aminotransferase (2.6.1.19 from EC) is a class III pyridoxal-phosphate-dependent aminotransferase. The enzyme catalyses the conversion of 4-aminobutanoate and 2-oxoglutarate into succinate semialdehyde and L-glutamate. The degree of sequence difference between this set and known bacterial examples is greater than the distance between, in either set, the most similar enzyme with a distinct function, and so the prokaryotic and eukaryotic sets have been placed into separate families.    This family describes known bacterial examples of the enzyme. The best archaeal matches are presumed but not trusted to have the equivalent function. Escherichia coli has two isozymes. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase.; GO: 0003867 4-aminobutyrate transaminase activity, 0009448 gamma-aminobutyric acid metabolic process.
Probab=100.00  E-value=0  Score=709.33  Aligned_cols=368  Identities=36%  Similarity=0.572  Sum_probs=339.3

Q ss_pred             CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCHHHHHHHHHHHHHCCC---
Q ss_conf             874898501037996799764641022674357878999999999999731450687-5781899999865201013---
Q gi|254780432|r   14 SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL-YQSTQQEIFANHLIHSTFA---   89 (392)
Q Consensus        14 ~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~-~~~~~~~~la~~L~~~~~~---   89 (392)
                      .|....||+|..|+|.||||||||.+|++++|.||+||+|++|+++|++.+.|+.+. ..-+...+|||+|+...|.   
T Consensus        15 ~~~fa~~aega~l~DvdGnr~IDfa~gIavln~GhshP~vV~AV~~Q~~ef~Ht~f~v~pYe~Yv~lAEkln~iaPgSg~   94 (427)
T TIGR00700        15 LRVFAAKAEGAILKDVDGNRYIDFAAGIAVLNVGHSHPKVVEAVKRQVEEFTHTAFQVVPYESYVELAEKLNAIAPGSGE   94 (427)
T ss_pred             CCEEEEECCCCEEEECCCCEEEHHCCCHHHHCCCCCCHHHHHHHHHHHHHHCCCCCEEECCHHHHHHHHHHCCCCCCCCC
T ss_conf             51225755884787437752100011023203689873589999999997438853452162589999997157889731


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCHH---
Q ss_conf             33123565554035677766543200134786002343546565432123455321-13479998643332221002---
Q gi|254780432|r   90 DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL-QYLEGFGPKIEGFDQAKFCD---  165 (392)
Q Consensus        90 ~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~-~~~~~~~p~~~~~~~~~~~d---  165 (392)
                      .|..|.|||+||||+|+|+||.|      |+|+-||+|+++|||||..+|++|++- .|+.+|+|+.+.+.++||+.   
T Consensus        95 kk~~ffnsGAEAVENAVKIAR~y------TgrpgVvaF~~gfHGRTnmTMalT~Kv~PYK~GFGPFapevY~aP~py~y~  168 (427)
T TIGR00700        95 KKAVFFNSGAEAVENAVKIARKY------TGRPGVVAFDRGFHGRTNMTMALTAKVKPYKIGFGPFAPEVYRAPYPYDYR  168 (427)
T ss_pred             HHEEEECCCHHHHHHHHHHHHHH------CCCCCEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCEECCCCCCCC
T ss_conf             00021115437888899999874------589616863687466126788765227873457888674521168872002


Q ss_pred             --------------HHHHHH-------HCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCC
Q ss_conf             --------------688754-------10123322223332222112462101232211022345721310110034444
Q gi|254780432|r  166 --------------LQSLKN-------QISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGR  224 (392)
Q Consensus       166 --------------~~~l~~-------~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GR  224 (392)
                                    +.++++       .-++++||+|+||||||||.++||++|+..|+++|+||+|+||+|||||||.|
T Consensus       169 ~~~~~~q~s~d~m~~~A~~~~f~~dkqv~a~~vAa~v~EPvQGEGGFivp~k~fv~a~~~~C~ehgiVfiADEvQtGFAR  248 (427)
T TIGR00700       169 DIALDKQESLDDMVLAAIEALFVADKQVEAENVAAVVIEPVQGEGGFIVPAKEFVAAVLDLCKEHGIVFIADEVQTGFAR  248 (427)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCCCCCCH
T ss_conf             43344222200389999998312103325010437897322478873338588999999975438758997254568000


Q ss_pred             CCCCCCCCCCCC---CCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHH
Q ss_conf             555310111245---45302103444444344321000111222223322345321111001233455432012221011
Q gi|254780432|r  225 TGKLFAYEWANV---KPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV  301 (392)
Q Consensus       225 tG~~f~~e~~gi---~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~  301 (392)
                      ||++||+|||+.   +||++|++|+|.+|+|+|+|+++.++|+...++..|.||+|||++||||+|+|++|++|.|.||+
T Consensus       249 TG~~FA~eH~~~dGl~PDLit~aKslA~GlPLSgV~GrAeimdApapGgLGGTyaGnPlacAAAlAvl~iIe~egL~ERa  328 (427)
T TIGR00700       249 TGKLFAIEHYDDDGLKPDLITVAKSLADGLPLSGVVGRAEIMDAPAPGGLGGTYAGNPLACAAALAVLDIIEEEGLIERA  328 (427)
T ss_pred             HCCCEEEEECCCCCCCCCHHHHHHHHHCCCCCCHHHCCHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             02112541006788875188786677356862111044121168888888775568879999999999863113124789


Q ss_pred             HHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEE--EEECCCCEEEECCCC
Q ss_conf             2100002688999988679707550464009998724998----------9999999968989--962689889955898
Q gi|254780432|r  302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLL--TAPSSDNVVRILPPL  369 (392)
Q Consensus       302 ~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~Gll--~~~~~~~~irl~Ppl  369 (392)
                      +++|+++.++|-++++..| .|.+|||+|.|.++|+++++          +.++.+..++||+  +++..+|+|||.|||
T Consensus       329 ~qig~~~~d~l~~~k~~~p-~IgdvRglGaMiAvE~vkdp~T~EPda~~a~~ia~~A~a~GlllLTcG~~GNiIRfL~PL  407 (427)
T TIGR00700       329 EQIGKLVKDKLIELKEEVP-AIGDVRGLGAMIAVELVKDPDTTEPDAALAEKIAAAALAAGLLLLTCGIYGNIIRFLTPL  407 (427)
T ss_pred             HHHHHHHHHHHHHHHHHCC-CHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCHHHHHCCHHCCHHHHCCCC
T ss_conf             9987889888888876067-211120263357888654887888317999999999975682212303011555434886


Q ss_pred             CCCHHHHHHHHHHHHHHHH
Q ss_conf             6889999999999999999
Q gi|254780432|r  370 TITAEEIHEGLERIERTAI  388 (392)
Q Consensus       370 ~it~~eid~~i~~l~~al~  388 (392)
                      +|+|+++++++++|+..|.
T Consensus       408 tI~D~ll~egl~Il~a~L~  426 (427)
T TIGR00700       408 TISDELLDEGLDILEAALA  426 (427)
T ss_pred             CCCHHHHHHHHHHHHHHHC
T ss_conf             5467889889999999852


No 71 
>TIGR03251 LAT_fam L-lysine 6-transaminase. Characterized members of this protein family are L-lysine 6-transaminase, also called lysine epsilon-aminotransferase (LAT). The immediate product of the reaction of this enzyme on lysine, 2-aminoadipate 6-semialdehyde, becomes 1-piperideine 6-carboxylate, or P6C. This product may be converted subsequently to pipecolate or alpha-aminoadipate, lysine catabolites that may be precursors of certain seconary metabolites.
Probab=100.00  E-value=0  Score=704.97  Aligned_cols=383  Identities=28%  Similarity=0.407  Sum_probs=314.2

Q ss_pred             CCEECCCCCCCCEEEEEECCCEEEEC-CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-----CCCCHHHH
Q ss_conf             31451558888748985010379967-9976464102267435787899999999999973145068-----75781899
Q gi|254780432|r    4 NDFLFNTYDQSDIRFEKGKGAWLFSE-NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-----LYQSTQQE   77 (392)
Q Consensus         4 ~~~~~~~~~~~p~~i~~a~G~~i~d~-dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-----~~~~~~~~   77 (392)
                      ++|.....+|+|+.|+||+|+||||. |||+||||+||+|++++||+||+|++|+..|.+...+..+     -..+....
T Consensus         9 ~~~~~~~~~p~~i~i~rgeG~~l~D~~dG~~yLD~~~g~~~~~lGh~hp~iv~a~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (431)
T TIGR03251         9 SRHMLTDGFDLVLDLDRSRGSVLVDARDGRRYLDMFSFFASMALGMNHPALVDDLAFRARLGAAAVNKPSNSDVYTVAMA   88 (431)
T ss_pred             HHHHCCCCCCCCEEEEEEECCEEEECCCCCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             77422138996206886026999989999884170141998877079799999999999998876538566225569999


Q ss_pred             HHHHHHHHHC---CCCCCCCCCCCCCCHHHHHHHHHHHHHCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9998652010---133312356555403567776654320013------4786002343546565432123455321134
Q gi|254780432|r   78 IFANHLIHST---FADRVFFTNSGAESVECAIKTARRYHYMAG------KTNKFRIVTFEGAFHGRTLATISAGGKLQYL  148 (392)
Q Consensus        78 ~la~~L~~~~---~~~~v~f~~SGseA~e~Aiklar~~~~~~g------~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~  148 (392)
                      ++++++++..   .+++++|+||||||||+|||+||+|....+      .+.+++||+|++||||+|.+++|+|+...++
T Consensus        89 ~l~~~l~~~~~~~~l~~v~f~~sGsEAvE~AiKlA~~y~~r~~~~~~~~~~~~~kiis~~~syHG~T~gals~t~~~~~~  168 (431)
T TIGR03251        89 RFVDTFARVLGDPALPHLFFIEGGALAVENALKTAFDWKSRHNQARGIPAALGTQVLHLRQAFHGRSGYTLSLTNTDPRK  168 (431)
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCEECCCCCCCCCCCCCCCCC
T ss_conf             99999998508877785897586799999999999999764312345577776479997253659963333443687533


Q ss_pred             CCCCCCCCC----------------CCCCC---CHHHHHHHH---HCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             799986433----------------32221---002688754---10123322223332222112462101232211022
Q gi|254780432|r  149 EGFGPKIEG----------------FDQAK---FCDLQSLKN---QISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKIC  206 (392)
Q Consensus       149 ~~~~p~~~~----------------~~~~~---~~d~~~l~~---~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc  206 (392)
                      ..+.|....                .....   ..+++.++.   ..+++|||||+|||||+||+++||++||+++|++|
T Consensus       169 ~~~~p~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~iAAvI~EPIqG~gG~~~~p~~yl~~lr~lc  248 (431)
T TIGR03251       169 TARFPKFDWPRIDNPKLTFPLDAPNLDQVIALEEEALRQARAAFAERPHDIACFIAEPIQGEGGDNHFRPEFLRAMRALC  248 (431)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             57788778777779887688887650025556899999999999738995799996777677798568989999999998


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCHHHH
Q ss_conf             345721310110034444555310111245453021034444443443210001112222-2332234532111100123
Q gi|254780432|r  207 DDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACM-NQGSHGSTYGGNVLAMVLG  285 (392)
Q Consensus       207 ~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~-~~~~~~~T~~gnpl~~aaa  285 (392)
                      ++||+|||+|||||||||||+||++|++||+|||+|+||+|++|.++++....+.....+ .++.+++||+|||++||||
T Consensus       249 ~~~giLLI~DEVqtGfGRtG~~fa~e~~gv~PDiv~~gKgl~~g~~~~~~~~~~~~~~~~~~~~~~~sT~~gnpla~aaa  328 (431)
T TIGR03251       249 DEHDALLIFDEVQTGVGLTGTAWAYQQLGVQPDIVAFGKKTQVCGIMAGRRVDEVADNVFAVPSRLNSTWGGNLVDMVRA  328 (431)
T ss_pred             HHCCCEEECCCCEECCCCCCCCHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH
T ss_conf             76275055341013677667744677507889989877722355188899999999986417877678888898999999


Q ss_pred             HHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEECCCCEE
Q ss_conf             3455432012221011210000268899998867970755046400999872499--89999999968989962689889
Q gi|254780432|r  286 EKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPSSDNVV  363 (392)
Q Consensus       286 ~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~~~~~i  363 (392)
                      +++|++++++++++|++++|++|+++|++++++||++|.+|||+|||+++|++.+  ...+.++++++|+++.+.++++|
T Consensus       329 la~l~ii~~e~l~~~v~~~g~~l~~~L~~l~~~~p~~V~dVRG~GLm~giel~~~~~~~~~~~~~~~~Gll~~~~g~~~i  408 (431)
T TIGR03251       329 TRILEIIEEERLVDNARVQGAHLLARLHELAAEFPHLVSNPRGRGLMCAFDLPSTADRDEVIRQLYREGVLLLGCGERSI  408 (431)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCEEEEEECCCHHHHHHHHHHHHHCCCEEEECCCCEE
T ss_conf             98899986246999999999999999999987687824563013369999818816799999999978939974799989


Q ss_pred             EECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             95589868899999999999999
Q gi|254780432|r  364 RILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       364 rl~Ppl~it~~eid~~i~~l~~a  386 (392)
                      ||.|||+||++|||+++++|+++
T Consensus       409 r~~PPL~it~~eid~~~~~l~~V  431 (431)
T TIGR03251       409 RFRPPLTVTREEIDAAIDAIRRV  431 (431)
T ss_pred             EEECCCCCCHHHHHHHHHHHCCC
T ss_conf             99889308899999999997269


No 72 
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional
Probab=100.00  E-value=0  Score=681.40  Aligned_cols=372  Identities=27%  Similarity=0.407  Sum_probs=323.3

Q ss_pred             CCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             15588887489850103799679976464102267435787899999999999973145068757818999998652010
Q gi|254780432|r    8 FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHST   87 (392)
Q Consensus         8 ~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~   87 (392)
                      +.+|.+.|++|+||+|+||||.|||+||||++|+|++++||+||+|.+|+++|+++...  ....++...+|+++|++..
T Consensus        28 ~~~~~~~P~~i~~g~G~~v~D~dG~~YlD~~~g~~~~~lGH~~p~v~~Ai~~q~~~~~~--~~~~~~~~~~lAe~l~~~~  105 (429)
T PRK00062         28 FKSVGGTPFFIKRAKGAYLYDVDGNEYIDYVLSWGPMILGHAHPAVVEAVIEAAEKGLS--FGAPTELEVKLAELVIERV  105 (429)
T ss_pred             CCCCCCCCEEEEEEECCEEEECCCCEEEECCCCHHHCCCCCCCHHHHHHHHHHHHHCCC--CCCCCHHHHHHHHHHHHHC
T ss_conf             46899988599970349899699999988330766500189979999999999863576--6699789999999998558


Q ss_pred             C-CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCC-----CCCCC
Q ss_conf             1-333123565554035677766543200134786002343546565432123455321--134799986-----43332
Q gi|254780432|r   88 F-ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKL--QYLEGFGPK-----IEGFD  159 (392)
Q Consensus        88 ~-~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~--~~~~~~~p~-----~~~~~  159 (392)
                      | .++|+|+||||||||+|||+||.|      |+|++||+|+++|||+|..+++.+++.  .+..+..|.     .+...
T Consensus       106 p~~~~v~f~~sGsEAve~AiklAR~~------tgr~~ii~~~g~YHG~~d~~l~~~gs~~~~~~~p~~~g~p~~~~~~~~  179 (429)
T PRK00062        106 PSVEMVRMVNSGTEATMSAIRLARGF------TGRDKIIKFEGCYHGHSDSLLVKAGSGVATLGLPDSPGVPADFAKNTL  179 (429)
T ss_pred             CCCCEEEEECCHHHHHHHHHHHHHHH------HCCCCEEEECCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             98777987187699999999999761------188762111465668862056534897544678998899764447526


Q ss_pred             CCCCHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22100268875410---123322223332222112462101232211022345721310110034444555310111245
Q gi|254780432|r  160 QAKFCDLQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANV  236 (392)
Q Consensus       160 ~~~~~d~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi  236 (392)
                      ..||||++++++.+   +++|||||+|||||++|+++||++||+++|++|++||+|||+||||||| |||++|++|++||
T Consensus       180 ~~~~nd~~~~~~~l~~~~~~iAAvivEPi~g~~G~i~p~~~yl~~lr~lc~~~giLlI~DEV~tGf-RtG~~~a~e~~gv  258 (429)
T PRK00062        180 TAPYNDLEAVKAAFEEYGDEIACVIVEPVAGNMGCVPPLPGFLEGLRELTDENGALLIFDEVMTGF-RVAYGGAQGYYGV  258 (429)
T ss_pred             EECCCCHHHHHHHHHHCCCCEEEEEEEEECCCCCEEECCHHHHHHHHHHHCCCCEEEEEECCCCCE-ECCCCHHHCCCCC
T ss_conf             305777888899998568865699974323778614488899999999960466479997142570-0576435417899


Q ss_pred             CCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHH
Q ss_conf             453021034444443443210001112222233---22345321111001233455432012221011210000268899
Q gi|254780432|r  237 KPDIMTIAKGMGGGFPIGACLATNEVAACMNQG---SHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLT  313 (392)
Q Consensus       237 ~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~---~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~  313 (392)
                      +|||+|+||+|+||+|+|||+++++||+.+.+.   .|++||+|||++||||+++|++++++++++|++++|++|+++|+
T Consensus       259 ~PDi~t~gK~lggG~Pi~av~~~~eim~~~~~~g~~~~~gTf~gnpla~AAa~a~L~~l~~~~l~~~~~~~G~~l~~~l~  338 (429)
T PRK00062        259 TPDLTTLGKVIGGGLPVGAFGGRREIMEQLAPLGPVYQAGTLSGNPLAMAAGLATLRLLDQEGVYETLDALTDRLAEGLK  338 (429)
T ss_pred             CCCEEEECCCCCCCCCEEEEEEHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             89689963234798753788677999986375898412587888879999999999999735799999999999999999


Q ss_pred             HHHHHCCCEEEEECCCEEEEEEEECCCH---------------HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHH
Q ss_conf             9988679707550464009998724998---------------9999999968989962689889955898688999999
Q gi|254780432|r  314 AIKNRFPNMFLEVRGQGLLIGLKTVFSP---------------ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHE  378 (392)
Q Consensus       314 ~l~~~~~~~v~~vRG~Gl~~~ie~~~~~---------------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~  378 (392)
                      ++.++| +++.+|||.|+|++++|..++               ..+...++++||++.+.+....  ..++.+|++|||+
T Consensus       339 ~~~~~~-~~~~~v~G~G~m~~i~f~~~~~~~~~~~~~~d~~~~~~~~~~m~~~Gv~~~p~~~~~~--~ls~aht~~did~  415 (429)
T PRK00062        339 EAAEKA-GIPLVVNRVGSMFGIFFTDEPVTNYEDAKASDTERFARFFHAMLEEGVYLAPSQFEAG--FVSTAHTDEDIEK  415 (429)
T ss_pred             HHHHHC-CCCEEEEEECCEEEEEECCCCCCCHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCCC--EEECCCCHHHHHH
T ss_conf             999877-9987999657478999648988898998644299999999999978864478642471--1033589999999


Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             9999999999852
Q gi|254780432|r  379 GLERIERTAIKLS  391 (392)
Q Consensus       379 ~i~~l~~al~~L~  391 (392)
                      .++++++++++|+
T Consensus       416 ~l~a~~~al~~l~  428 (429)
T PRK00062        416 TLAAAREAFAALA  428 (429)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999984


No 73 
>KOG1404 consensus
Probab=100.00  E-value=0  Score=673.15  Aligned_cols=368  Identities=37%  Similarity=0.626  Sum_probs=331.3

Q ss_pred             CCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             55888874898501037996799764641022674357878999999999999731450687578189999986520101
Q gi|254780432|r    9 NTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF   88 (392)
Q Consensus         9 ~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~   88 (392)
                      .+|+..|+.|+||+|+||||.+|++|+|+.+|.+++++|||||+|.+|+.+|+.+++|....|.+++..+||++|+...|
T Consensus        27 ~~~~~~Pl~Iv~~~~~ylyDe~G~ryLD~f~Gi~tvslGHchP~v~~a~~kQl~~l~H~t~~~~~~pi~~~Ae~L~s~~P  106 (442)
T KOG1404          27 TSYYKKPLVIVRGEGQYLYDEEGRRYLDAFGGIVTVSLGHCHPDVVAAAVKQLKKLYHTTSGYLNPPIHDLAEALVSKLP  106 (442)
T ss_pred             ECCCCCCCEEEECCEEEEECCCCCEEEHHHCCEEEEECCCCCHHHHHHHHHHHHHHEEEECCCCCCCHHHHHHHHHHHCC
T ss_conf             13566885578442679986888650022087489973788847899999864532873012148708999999998688


Q ss_pred             C--CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----
Q ss_conf             3--331235655540356777665432001347860023435465654321234553211347999864333222-----
Q gi|254780432|r   89 A--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQA-----  161 (392)
Q Consensus        89 ~--~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~-----  161 (392)
                      .  ++++|+||||||||+||||||.|      |++..||+++++|||.|..++++|+...++..+.....++.+.     
T Consensus       107 ~~l~~vfF~nsGsEANelal~mar~Y------t~~~diIa~r~~YHG~t~~t~glt~~~~~k~~~~~~~~~~~~~~~Pdp  180 (442)
T KOG1404         107 GDLKVVFFVNSGSEANELALKMARLY------TGNLDIIARRNSYHGNTLYTLGLTGLSPWKQNFPGVASGVHHTMNPDP  180 (442)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHH------CCCCEEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             77128999558745889999999986------297158875055367735530244677645567888776512689983


Q ss_pred             ---CCHH----------HHHHHHHC----CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCC
Q ss_conf             ---1002----------68875410----123322223332222112462101232211022345721310110034444
Q gi|254780432|r  162 ---KFCD----------LQSLKNQI----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGR  224 (392)
Q Consensus       162 ---~~~d----------~~~l~~~~----~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GR  224 (392)
                         ++.+          .+.+++.+    ++.|||||.|||||.||++.+|++||++++++|+++|.++|+|||||||||
T Consensus       181 ~r~~~~~~~~~e~~d~~a~~l~d~i~~~~~~~vAafiaEtIqGvgG~v~~p~GYlka~~~~v~k~Ggl~IaDEVqtGfGR  260 (442)
T KOG1404         181 YRGIFGGSNEEEASDRYAKELEDLILYDGPETVAAFIAETIQGVGGIVELPPGYLKAAYKVVRKRGGLFIADEVQTGFGR  260 (442)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEHHHHHCCCC
T ss_conf             11567997324568888887778887358775147875300167753138811899999999975978985434436455


Q ss_pred             CCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHH
Q ss_conf             5553101112454530210344444434432100011122222332-234532111100123345543201222101121
Q gi|254780432|r  225 TGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGS-HGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN  303 (392)
Q Consensus       225 tG~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~~-~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~  303 (392)
                      ||+||+||+.|++|||+||+|+||||+|++||++++||++++.+.. |++||+|||++||+++++|+++++++|+||+++
T Consensus       261 tG~~wgfe~h~v~PDIvTmAKgiGnG~Pl~AVvtt~EIa~v~~~~~~~fnTyggnP~a~avg~aVL~Vikee~LqE~aa~  340 (442)
T KOG1404         261 TGHMWGFESHGVVPDIVTMAKGIGNGFPLGAVVTTPEIADVLNQKSSHFNTYGGNPVACAVGLAVLKVIKEENLQENAAE  340 (442)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             52510100168772099998652488700256327899999985213520337882567888999999988767888999


Q ss_pred             HCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH-----------HHHHHHHHHCCEEEEE--CCCCEEEECCCCC
Q ss_conf             00002688999988679707550464009998724998-----------9999999968989962--6898899558986
Q gi|254780432|r  304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-----------ALLAAKFRDECLLTAP--SSDNVVRILPPLT  370 (392)
Q Consensus       304 ~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~-----------~~~~~~l~~~Gll~~~--~~~~~irl~Ppl~  370 (392)
                      .|.+|+++|.+++++|| +|.||||+|||+|+|++.+.           ..+-++|.+.|+++..  ..+|++|++|||+
T Consensus       341 vG~yl~~~l~~l~d~h~-iIGdVRG~GLm~GvE~V~dk~~~~pp~~~~~~~i~~~cke~Gvlvg~g~i~G~vfriaPPlc  419 (442)
T KOG1404         341 VGSYLLEKLAALKDKHP-IIGDVRGRGLMLGVELVSDKSEPKPPATAEGAVIGEQCKELGVLVGKGGIHGNVFRIAPPLC  419 (442)
T ss_pred             HHHHHHHHHHHHHHCCC-CEEECCCCEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCEEEECCCCCCEEEEECCCEE
T ss_conf             99999999998741487-35521354148888872266778894067788998998974856410423231798369854


Q ss_pred             CCHHHHHHHHHHH
Q ss_conf             8899999999999
Q gi|254780432|r  371 ITAEEIHEGLERI  383 (392)
Q Consensus       371 it~~eid~~i~~l  383 (392)
                      ||.+|+|.+++.+
T Consensus       420 iT~edi~f~~~~~  432 (442)
T KOG1404         420 ITKEDIDFAVEYF  432 (442)
T ss_pred             CCHHHHHHHHHHH
T ss_conf             3489988999999


No 74 
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional
Probab=100.00  E-value=0  Score=660.55  Aligned_cols=367  Identities=24%  Similarity=0.401  Sum_probs=319.7

Q ss_pred             CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC-CCCC
Q ss_conf             887489850103799679976464102267435787899999999999973145068757818999998652010-1333
Q gi|254780432|r   13 QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHST-FADR   91 (392)
Q Consensus        13 ~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~-~~~~   91 (392)
                      +.|++|+||+|+||||.|||+||||.+|+|+++|||+||+|++|+++|+++..+.  ...++...+|+++|++.. +.++
T Consensus        34 ~~P~~i~~g~G~~l~D~dG~~yiD~~~g~g~~~lGh~~p~v~~Ai~~q~~~g~~~--~~~~~~~~~lAe~l~~~~p~~~~  111 (429)
T PRK12389         34 GAPVAMERGKGAYFYDVDGNKYIDYLAAYGPIITGHAHPHITKAIQTAAENGVLY--GTPTELEIEFAKMLKEAIPSLEK  111 (429)
T ss_pred             CCCEEEEEEECCEEEECCCCEEEECCHHHHHHCCCCCCHHHHHHHHHHHHHCCCC--CCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             9996899604398997998999883221665400389899999999998238857--79989999999999985788766


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--C-----CCCCCCCCCCCCH
Q ss_conf             12356555403567776654320013478600234354656543212345532113479--9-----9864333222100
Q gi|254780432|r   92 VFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEG--F-----GPKIEGFDQAKFC  164 (392)
Q Consensus        92 v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~--~-----~p~~~~~~~~~~~  164 (392)
                      |+|+||||||||+|||+||+|      |+|++||+|+++|||+|.++++.++......+  .     .+..+.+...||+
T Consensus       112 v~F~~sGsEA~e~AiklAR~~------tgr~kii~~~~~yHG~t~~~l~~~~~~~~~~~~p~~~g~p~~~~~~~~~~p~n  185 (429)
T PRK12389        112 VRFVNSGTEAVMTTIRVARAY------TGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPESIAQEVITVPFN  185 (429)
T ss_pred             EEEECCCHHHHHHHHHHHHHH------CCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECCC
T ss_conf             986268428999999999983------49996541145759985432231368853468987678876555652530789


Q ss_pred             HHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             268875410---12332222333222211246210123221102234572131011003444455531011124545302
Q gi|254780432|r  165 DLQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM  241 (392)
Q Consensus       165 d~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~  241 (392)
                      |++++++.+   +++|||||+|||||++|+++||++||++||++|++||+|||+||||||| |+|.+|+++++||+|||+
T Consensus       186 d~~~l~~~l~~~~~~iAavI~EPi~g~~G~i~p~~~yl~~lr~lc~~~giLLI~DEV~TGf-R~g~~~a~~~~gV~PDi~  264 (429)
T PRK12389        186 DIESYKEALDKWGDEVAAVLVEPIVGNFGIVEPKPGFLEEVNELAHEAGALVIYDEVITAF-RFMYGGAQDLLGVIPDLT  264 (429)
T ss_pred             CHHHHHHHHHHCCCCEEEEEEECCCCCCCEECCCHHHHHHHHHHHHHCCCEEEEECCCCCC-CCCCCCHHHCCCCCCCHH
T ss_conf             9999999998458966899960223678801699899999999999719889996551031-566670765538999710


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHH
Q ss_conf             10344444434432100011122222---332234532111100123345543201222101121000026889999886
Q gi|254780432|r  242 TIAKGMGGGFPIGACLATNEVAACMN---QGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR  318 (392)
Q Consensus       242 ~~gK~l~gG~P~sav~~~~~i~~~~~---~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~  318 (392)
                      |+||+|+||||+|||+++++||+.+.   +..|++||+|||++||||+++|++++++++++|++++|++|+++|+++.++
T Consensus       265 t~gK~lggG~Pi~av~g~~eim~~~~~~g~~~~~gTf~gnpla~AAalA~L~~l~~~~l~~~~~~~G~~l~~gl~~l~~~  344 (429)
T PRK12389        265 ALGKIIGGGLPIGAYGGRQDIMEQVAPLGPAYQAGTMAGNPASMAAGIACLEVLQQEGVYEKLDELGAMLEEGILKLAEK  344 (429)
T ss_pred             HEHHHCCCCCCEEEEEEHHHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             01032279864488767799998731579850258888688999999999999971689999999999999999999987


Q ss_pred             CCCEEEEECCCEEEEEEEECCCH---------------HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             79707550464009998724998---------------999999996898996268988995589868899999999999
Q gi|254780432|r  319 FPNMFLEVRGQGLLIGLKTVFSP---------------ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERI  383 (392)
Q Consensus       319 ~~~~v~~vRG~Gl~~~ie~~~~~---------------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l  383 (392)
                      |+ ++.+|+|.|.|+++.+..++               ..+...++++||++.|.+.+.  ..+++.+|++|||++++++
T Consensus       345 ~~-~~~~v~~~g~~~~i~f~~~~v~~~~~~~~~~~~~~~~~~~~ml~~Gv~~~p~~~~~--~~ls~~hTe~dId~~l~a~  421 (429)
T PRK12389        345 HN-ITITINRLKGALTVYFTDEKVTDYDQAERSDGEAFGKFFKLMLNQGINLAPSKYEA--WFLTTEHTEEDIEETIKAV  421 (429)
T ss_pred             CC-CCEEEEECCCEEEEEECCCCCCCHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCC--CCCCCCCCHHHHHHHHHHH
T ss_conf             79-98799414856899945898889899861579999999999997886456867777--4164678999999999999


Q ss_pred             HHHHHHHC
Q ss_conf             99999852
Q gi|254780432|r  384 ERTAIKLS  391 (392)
Q Consensus       384 ~~al~~L~  391 (392)
                      ++++++|+
T Consensus       422 d~al~~la  429 (429)
T PRK12389        422 DRAFAQMA  429 (429)
T ss_pred             HHHHHHHC
T ss_conf             99999759


No 75 
>PRK06942 glutamate-1-semialdehyde 2,1-aminomutase; Validated
Probab=100.00  E-value=0  Score=656.30  Aligned_cols=371  Identities=23%  Similarity=0.361  Sum_probs=320.9

Q ss_pred             CCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             15588887489850103799679976464102267435787899999999999973145068757818999998652010
Q gi|254780432|r    8 FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHST   87 (392)
Q Consensus         8 ~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~   87 (392)
                      ++.|.+.|++|+||+|+||||.|||+||||.+|+|++++||+||+|++|+++|+++...  ....++...+|||+|++..
T Consensus        26 ~~~~~~~P~~i~rg~G~~l~D~dGn~YiD~~~g~g~~~lGH~~p~v~~Av~~q~~~~~~--~~~~~~~~~~lAe~L~~~~  103 (425)
T PRK06942         26 FRSVGGTPRFVARAQGPYFWDADGKRYIDYIGSWGPMIVGHVHPEVLRAVQRVLADGFS--FGAPTEAEIEIAEEICKLV  103 (425)
T ss_pred             CCCCCCCCEEEEEEECCEEEECCCCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHCCC--CCCCCHHHHHHHHHHHHHC
T ss_conf             67899987079970439899598998888234288654288979999999999985785--7899789999999999858


Q ss_pred             C-CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCC-----CCCCCCC
Q ss_conf             1-3331235655540356777665432001347860023435465654321234553211--347999-----8643332
Q gi|254780432|r   88 F-ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQ--YLEGFG-----PKIEGFD  159 (392)
Q Consensus        88 ~-~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~--~~~~~~-----p~~~~~~  159 (392)
                      | .++|+|+||||||||+|||+||.|      |+|++||+|+++|||+|...++.++...  +..+..     +......
T Consensus       104 P~~~~v~f~~SGsEA~e~AiklAR~~------tgr~~ii~~~g~YHG~~~~~~~~~~~~~~~~~~p~~~g~p~~~~~~~~  177 (425)
T PRK06942        104 PSIEQVRMVSSGTEATMSALRLARGF------TGRSRIVKFEGCYHGHADSLLVKAGSGLLTFGNPTSAGVPADVAKHTT  177 (425)
T ss_pred             CCCCEEEEECCHHHHHHHHHHHHCCC------CCCCCCCEECCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             89885987388799999999996103------479865312345147741021213787655588865688765457664


Q ss_pred             CCCCHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22100268875410---123322223332222112462101232211022345721310110034444555310111245
Q gi|254780432|r  160 QAKFCDLQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANV  236 (392)
Q Consensus       160 ~~~~~d~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi  236 (392)
                      ..+|+|++++++.+   .++|||||+|||||++|+++||++||++||++|++||+|||+||||||| |||++|+++++||
T Consensus       178 ~~~~nd~~~l~~~~~~~~~~iAAvI~EPi~g~~G~i~p~~~yl~~lr~lc~~~gilLI~DEV~TGf-R~g~~~a~~~~gv  256 (425)
T PRK06942        178 VLEYNNVAALEEAFAAFGGEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGF-RVALGGAQQHYGI  256 (425)
T ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCC-CCCCCHHHHHHCC
T ss_conf             667676888999998438966899955644778750289899999999861378389997462574-0676538762189


Q ss_pred             CCCEEECCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHH
Q ss_conf             45302103444444344321000111222223---322345321111001233455432012221011210000268899
Q gi|254780432|r  237 KPDIMTIAKGMGGGFPIGACLATNEVAACMNQ---GSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLT  313 (392)
Q Consensus       237 ~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~---~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~  313 (392)
                      +|||+|+||+|+||+|+||++++++||+.+.+   ..|++||+|||++||||+++|++++++++++|+.++|++|+++|+
T Consensus       257 ~PDi~t~gK~iggG~Pi~Av~g~~eim~~~~~~g~~~h~gTf~gnp~a~AAalatL~~~~~~~~~~~~~~~g~~L~~gl~  336 (425)
T PRK06942        257 TPDLTCLGKVIGGGMPAAAFGGRRDIMAHLAPLGGVYQAGTLSGNPIAVAAGLKTLRLIQAPGFYDALAAQTRRLADGLA  336 (425)
T ss_pred             CCCEEEEHHHCCCCCCCEEEEEHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             98799871005798870210259999975067888722789987879999999999998456799999999999999999


Q ss_pred             HHHHHCCCEEEEECCCEEEEEEEECCCH---------------HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHH
Q ss_conf             9988679707550464009998724998---------------9999999968989962689889955898688999999
Q gi|254780432|r  314 AIKNRFPNMFLEVRGQGLLIGLKTVFSP---------------ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHE  378 (392)
Q Consensus       314 ~l~~~~~~~v~~vRG~Gl~~~ie~~~~~---------------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~  378 (392)
                      ++.+++ ++...++|.|.|+++.|....               ..+...++++|+++.|.+..  ...-+...|++|||+
T Consensus       337 ~~~~~~-g~~~~~~g~gs~f~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Gv~~~p~~~~--~~f~s~aHt~~did~  413 (425)
T PRK06942        337 AEARAA-GVPFAADSIGGMFGLYFTERVPTSFAEVTKSDVERFNRFFHLMLDEGVYFAPSAYE--AGFVSSTHDDAVLDA  413 (425)
T ss_pred             HHHHHC-CCCEEEEEECCEEEEEECCCCCCCHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCHH--CCCCCCCCCHHHHHH
T ss_conf             999977-99889965376479986899999999998554999999999999789677985242--176230379999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999985
Q gi|254780432|r  379 GLERIERTAIKL  390 (392)
Q Consensus       379 ~i~~l~~al~~L  390 (392)
                      .++++++++++|
T Consensus       414 ~l~a~~~a~~~l  425 (425)
T PRK06942        414 TLDAARRAFAAL  425 (425)
T ss_pred             HHHHHHHHHHHC
T ss_conf             999999999739


No 76 
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional
Probab=100.00  E-value=0  Score=652.51  Aligned_cols=371  Identities=20%  Similarity=0.268  Sum_probs=316.3

Q ss_pred             CCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             55888874898501037996799764641022674357878999999999999731450687578189999986520101
Q gi|254780432|r    9 NTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF   88 (392)
Q Consensus         9 ~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~   88 (392)
                      ..|.+.|++|+||+|+||||.|||+||||++|+|++++||+||+|++|+++|+++..+  ..+.++...+||++|++..+
T Consensus        30 ~~~~~~P~~i~ra~G~~l~D~dGn~YiD~~~g~g~~~lGH~hp~V~~Av~~q~~~~~~--~~~~~~~~~~lAe~L~~~~~  107 (433)
T PRK00615         30 RSVGITPPIVSSASGDIFIDSFGKTFIDFCGSWGSLIHGHSHPKICDAIQQGASRGTS--YGLTSEQEILFATELFSYLG  107 (433)
T ss_pred             CCCCCCCCEEEEEECCEEEECCCCEEEEHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC--CCCCCHHHHHHHHHHHHHCC
T ss_conf             8889988569971439899698998777014188633167988999999999964665--67788899999999986279


Q ss_pred             CC--CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCC----CCCCCCCCCC
Q ss_conf             33--31235655540356777665432001347860023435465654321234---553211347----9998643332
Q gi|254780432|r   89 AD--RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATIS---AGGKLQYLE----GFGPKIEGFD  159 (392)
Q Consensus        89 ~~--~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s---~s~~~~~~~----~~~p~~~~~~  159 (392)
                      .+  +|+|+||||||||+|||+||.|      |||++||+|+++|||++..+++   .+.......    ...+..+...
T Consensus       108 ~~~~~V~F~nSGsEA~e~AiklAR~~------TgR~~Ii~~~g~YHG~~d~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  181 (433)
T PRK00615        108 LEDHKIRFVSSGTEATMTAVRLARGI------TGRSIIIKFLGCYHGHADTLLQGISFDETNLDNLTHLVDTDLPHPLTL  181 (433)
T ss_pred             CCCCEEEEECCHHHHHHHHHHHHHCC------CCCCEEEEEECCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             86365997188399999999997226------488769999677678720012314578766678987777888878521


Q ss_pred             CCCCHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22100268875410---123322223332222112462101232211022345721310110034444555310111245
Q gi|254780432|r  160 QAKFCDLQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANV  236 (392)
Q Consensus       160 ~~~~~d~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi  236 (392)
                      ..||+|++.+++.+   .++|||||+||||+++|+++||++||++||++|++||+|||+||||||| |||++|++|+|||
T Consensus       182 ~~p~nd~~~~e~~~~~~~~~iAAvi~EPi~~~~G~i~p~~~yL~~lr~lc~~~giLLI~DEV~tGf-Rtg~~~a~e~~gV  260 (433)
T PRK00615        182 SLPYNDSQIFHEVMEQLGHRVAGVIFEPICANMGVVLPKPGFIEGIIQTCRRFGSLSIMDEVVTGF-RVAFGGAAAIFDV  260 (433)
T ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCEEEEEECCCCCC-EECCCHHHHHHCC
T ss_conf             678773999999998515430357875502468876899899999999987659389851341160-6254057787399


Q ss_pred             CCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHH
Q ss_conf             453021034444443443210001112222233---22345321111001233455432012221011210000268899
Q gi|254780432|r  237 KPDIMTIAKGMGGGFPIGACLATNEVAACMNQG---SHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLT  313 (392)
Q Consensus       237 ~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~---~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~  313 (392)
                      +|||+|+||+||||||+|||+++++||+.+.+.   .|++||+|||++||||+++|++|+++++++++.++|++|+++|+
T Consensus       261 ~PDi~t~gK~lggG~Pi~Av~g~~~im~~~~~~g~~~~~gTf~gnpla~AAa~AtL~~l~~~~~~~~~~~~g~~l~~gl~  340 (433)
T PRK00615        261 KPDITVYGKILGGGLPAAAVVAHRSIMDHLMPEGTIFQAGTLSGNPLAMAAGKASIELCREEGFYTQLSNLEQLFLSPIE  340 (433)
T ss_pred             CCCEEEECCCCCCCCCEEEEEEHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             86178754556799870566686999986377898654688740699999999999998357899999999999999999


Q ss_pred             HHHHHCCCEEEEECCCEEEEEEEECCCH---------------HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHH
Q ss_conf             9988679707550464009998724998---------------9999999968989962689889955898688999999
Q gi|254780432|r  314 AIKNRFPNMFLEVRGQGLLIGLKTVFSP---------------ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHE  378 (392)
Q Consensus       314 ~l~~~~~~~v~~vRG~Gl~~~ie~~~~~---------------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~  378 (392)
                      ++.+++ ++...|+|.|.|+.+.|..++               ..+...++++||++.|.....  ...+...|++|||+
T Consensus       341 ~~~~~~-g~~~~v~~~gs~~~~~f~~~~~~~~~~~~~~d~~~~~~f~~~~l~rGV~~~p~~~~~--~fis~aHt~edi~~  417 (433)
T PRK00615        341 EMIRSQ-GFPVSLVRYGSMFSFFFRENRPTNLDEAQLSDVEKFQTFYQEAFSKGVYLSPSPFEA--SFLSSAHSMENLAY  417 (433)
T ss_pred             HHHHHC-CCCEEEEEECCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC--CCCCCCCCHHHHHH
T ss_conf             999976-998899755767999967999889999986359999999999997897889863226--46430249999999


Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             9999999999852
Q gi|254780432|r  379 GLERIERTAIKLS  391 (392)
Q Consensus       379 ~i~~l~~al~~L~  391 (392)
                      .++++.++++++-
T Consensus       418 t~~a~~~al~~~~  430 (433)
T PRK00615        418 AQNVLIDSLEKIF  430 (433)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999998


No 77 
>pfam00202 Aminotran_3 Aminotransferase class-III.
Probab=100.00  E-value=0  Score=654.46  Aligned_cols=321  Identities=46%  Similarity=0.755  Sum_probs=300.8

Q ss_pred             EEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHHHHHHHHCC--CCCCC
Q ss_conf             89850103799679976464102267435787899999999999973145068-7578189999986520101--33312
Q gi|254780432|r   17 RFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQQEIFANHLIHSTF--ADRVF   93 (392)
Q Consensus        17 ~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~~~~la~~L~~~~~--~~~v~   93 (392)
                      .|+||+|+||||.|||+||||++|+|+++|||+||+|++|+++|++++.+++. .+.++...+|+++|++..|  +++++
T Consensus         1 ~i~r~~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~q~~~~~~~~~~~~~~~~~~~lae~l~~~~p~~~~~v~   80 (338)
T pfam00202         1 FITKAKGVWLYDVDGRRYLDFLSGIAVVNLGHCHPKIVQAVKEQADKLTHTSFRAFTTEPALQLAEKLAQLTPGGLDRVF   80 (338)
T ss_pred             CEEECCCCEEEECCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             96513589999599699999661988634169959999999999953898566755888999999999985788868799


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH-----
Q ss_conf             356555403567776654320013478600234354656543212345532113479998643332221002688-----
Q gi|254780432|r   94 FTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQS-----  168 (392)
Q Consensus        94 f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~-----  168 (392)
                      |++|||||||+|||+||+|+..++.|+|++||+|+++|||+|.+++++++.+.++..+.|..+.+..+|+++.+.     
T Consensus        81 f~~sGseA~e~AiklAr~~~~~~g~t~r~~il~~~~~yHG~t~~~~s~s~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~  160 (338)
T pfam00202        81 FMNSGSEANETAIKLARQYAKKKGATGKTKIIAFSGGFHGRTLGALSVTGSSGYKKGFGPSLPGVYFLPYPDLEAAEEEL  160 (338)
T ss_pred             EECCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCEEEEECCCCCCCCCCCCCCCCCEECCCCCHHHHHHHH
T ss_conf             82876899999999999977753789988799993882588730588158855555677899994574899735420015


Q ss_pred             ---------HHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ---------75410123322223332222112462101232211022345721310110034444555310111245453
Q gi|254780432|r  169 ---------LKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD  239 (392)
Q Consensus       169 ---------l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD  239 (392)
                               +.+..+++|||||+|||||++|++++|++||+.||++|++||++||+|||||||||||++|++|++||+||
T Consensus       161 ~~~~~~~~~~~~~~~~~iaaviiEPi~g~~G~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfgRtG~~~~~~~~gv~PD  240 (338)
T pfam00202       161 ACADEALRLIKAVHDDNIAAVIVEPIQGEGGVVPPPPGFLAGLREICKKHGVLLIADEVQTGFGRTGKLFACEHYGVTPD  240 (338)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEECCCCEECCCCCCCCCHHHHCCCCCE
T ss_conf             66899999999858997799999887788997679879999999997432775764531008775348740232498875


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHC
Q ss_conf             02103444444344321000111222223322345321111001233455432012221011210000268899998867
Q gi|254780432|r  240 IMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF  319 (392)
Q Consensus       240 i~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~  319 (392)
                      |+|+||+|+||||+|||++++++++.+.+..|++||+|||++|+||+++|+++++++++++++++|++|+++|++|+++ 
T Consensus       241 iv~~gK~l~~G~P~sav~~~~~i~~~~~~~~~~~T~~g~p~~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~-  319 (338)
T pfam00202       241 IMTLAKALTGGLPLSAVLATAEIMQAFHPGSHGGTFGGNPLACAAALAVLDIIEDENLLQNAQEKGDYLRKGLLALQDK-  319 (338)
T ss_pred             EEEECCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCC-
T ss_conf             9995642458998753116477997177999587776649999999999999965589999999999999999985459-


Q ss_pred             CCEEEEECCCEEEEEEEECC
Q ss_conf             97075504640099987249
Q gi|254780432|r  320 PNMFLEVRGQGLLIGLKTVF  339 (392)
Q Consensus       320 ~~~v~~vRG~Gl~~~ie~~~  339 (392)
                       +.|.+|||+|||+++|+++
T Consensus       320 -~~v~~VRG~Gl~~g~elv~  338 (338)
T pfam00202       320 -PVIGDVRGRGLMIAIEIVK  338 (338)
T ss_pred             -CCEEECCCCCEEEEEEEEC
T ss_conf             -9737733272499999879


No 78 
>PRK07046 aminotransferase; Validated
Probab=100.00  E-value=0  Score=623.90  Aligned_cols=367  Identities=20%  Similarity=0.266  Sum_probs=317.0

Q ss_pred             CCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             88887489850103799679976464102267435787899999999999973145068757818999998652010133
Q gi|254780432|r   11 YDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFAD   90 (392)
Q Consensus        11 ~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~~~   90 (392)
                      +.|+|++|+||+|+|+||.|||+|||+++|+|++++||+||+|.+|+++|+++..+  ..+.++...+++++|++..+.+
T Consensus        53 ~~p~P~~i~~a~G~~l~D~DG~~YiD~~~g~~~~~lGH~~p~v~~Av~~q~~~g~~--~~~~~~~~~~lae~l~~~~~~~  130 (452)
T PRK07046         53 STPFPLFVAEARGARFTDVDGHRYVDFCLGDTGAMFGHSPAPVARALAEQARRGLT--TMLPSEDAAWVGEELARRFGLP  130 (452)
T ss_pred             CCCCCEEEEEEEECEEEECCCCEEEECCHHHHHCCCCCCCHHHHHHHHHHHHHCCC--CCCCCHHHHHHHHHHHHHHCCC
T ss_conf             99998279974518899698999988561155121577999999999999872554--5578579999999989873886


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCC----CCCCCCCCCCCH
Q ss_conf             3123565554035677766543200134786002343546565432123455--3211347999----864333222100
Q gi|254780432|r   91 RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAG--GKLQYLEGFG----PKIEGFDQAKFC  164 (392)
Q Consensus        91 ~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s--~~~~~~~~~~----p~~~~~~~~~~~  164 (392)
                      +++|+|||||||+.|||+||.+      |||++||+|+++|||++..+++..  +.+..+.++.    +.......++||
T Consensus       131 ~~~f~~sGsEA~~~AirlAR~~------TgR~~Ii~f~g~YHG~~d~~~~~~~~g~~~~~~~~~g~~~~~~~~~~~~~~n  204 (452)
T PRK07046        131 YWQVATTASDANRFVLRWARAA------TGRKKILVFNGCYHGTVDDVFVDLADGRPVQRPGLLGQVHDLTATTRVVEFN  204 (452)
T ss_pred             EEEEECCHHHHHHHHHHHHHHC------CCCCEEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEECCCC
T ss_conf             1775377999999999998645------4997699963676786057898647998667898889887767764301668


Q ss_pred             HHHHHHHHC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             268875410-1233222233322221124621012322110223457213101100344445553101112454530210
Q gi|254780432|r  165 DLQSLKNQI-SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI  243 (392)
Q Consensus       165 d~~~l~~~~-~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~  243 (392)
                      |++++++.+ .++|||||+||||+++|+++||++||++||++|++||+|||+|||+|  +|+|...+++.|||+|||+|+
T Consensus       205 d~~~le~~l~~~~iAAvi~EPi~g~~G~i~p~~~fl~~lrelc~~~giLLI~DEV~T--~r~g~Gg~~~~~Gv~PDl~t~  282 (452)
T PRK07046        205 DLAALEAALADGDVACVLAEPAMTNIGMVLPEPGFWEALRELTRRHGTLLVIDETHT--ISSGPGGYTRAHGLEPDFLVV  282 (452)
T ss_pred             CHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEECCCC--CCCCCCHHHHHHCCCCCEEEE
T ss_conf             789999971789867999976886788757999999999999975897999936661--001685387986879666764


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC---------CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHH
Q ss_conf             34444443443210001112222233---------223453211110012334554320122210112100002688999
Q gi|254780432|r  244 AKGMGGGFPIGACLATNEVAACMNQG---------SHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTA  314 (392)
Q Consensus       244 gK~l~gG~P~sav~~~~~i~~~~~~~---------~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~  314 (392)
                      ||+|+||+|+||+.+++++++.+...         .+++||+|||++|||++++|+++++++++++++++|++|+++|++
T Consensus       283 gK~iggG~P~ga~~~~~~i~~~~~~~~~~~~~g~~~~ggTf~gnpla~AAa~A~L~~l~~~~~~~~~~~~g~~L~~gL~~  362 (452)
T PRK07046        283 GKPIAGGVPCAVYGFSAALAERARAAKASAPPGHSGIGTTLSANALAMAAMRATLAEVMTDAAYAHMFALAARLAAGLRA  362 (452)
T ss_pred             HHHHCCCCCEEEECCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             44312888634340259999888752145678756878887879899999999999995552999999999999999999


Q ss_pred             HHHHCCCEEEEECCCEEEEEEEECCCH----------------HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHH
Q ss_conf             988679707550464009998724998----------------9999999968989962689889955898688999999
Q gi|254780432|r  315 IKNRFPNMFLEVRGQGLLIGLKTVFSP----------------ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHE  378 (392)
Q Consensus       315 l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~  378 (392)
                      +.++|+ +..+|||.|+|+.+.+...+                ..+...|+++|+++.|.+ |.+.++|  .+|++|||+
T Consensus       363 ~~~~~~-~~~~v~g~G~~~~~~f~~~~~~~~~~~~~~~d~~~~~~~~~~ll~rGVll~p~~-n~~~~sp--~~T~edID~  438 (452)
T PRK07046        363 TIARHG-LPWHVTRIGARVEFQFAPTPPRNGAEAGAALDGELEHALHLYLLNRGVLITPFH-NMMLVCP--QTTAEDVDR  438 (452)
T ss_pred             HHHHCC-CCEEEEEECCEEEEEEECCCCCCHHHHHHCCCHHHHHHHHHHHHHCCEEECCCC-CCEEECC--CCCHHHHHH
T ss_conf             998679-975997557468999607887567888744339999999999997995588767-5477864--489999999


Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             9999999999852
Q gi|254780432|r  379 GLERIERTAIKLS  391 (392)
Q Consensus       379 ~i~~l~~al~~L~  391 (392)
                      .++++++++.+|.
T Consensus       439 ~v~a~~~al~el~  451 (452)
T PRK07046        439 LVAAFDACLGELL  451 (452)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999850


No 79 
>KOG1401 consensus
Probab=100.00  E-value=0  Score=619.12  Aligned_cols=387  Identities=38%  Similarity=0.558  Sum_probs=358.1

Q ss_pred             CEECCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             14515588887489850103799679976464102267435787899999999999973145068757818999998652
Q gi|254780432|r    5 DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLI   84 (392)
Q Consensus         5 ~~~~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~   84 (392)
                      ....-+|+++|+++++++|++++|.||++||||+++||++.+||+||++.+|+.+|+.++.|+.+.+.+.+..+++++|.
T Consensus        29 ~~~~~t~~~~pv~~~~gkg~kl~D~~g~EyiD~~ssw~~~~~Ghanpev~ral~~q~~k~~hs~~~~~t~eav~l~~~l~  108 (433)
T KOG1401          29 TRIVSTYARYPVVIESGKGSKLFDPDGKEYIDFTSSWAVTILGHANPEVARALAEQAKKLGHSSNGYFTLEAVELEEVLS  108 (433)
T ss_pred             EEEEECCCCCCEEEECCEEEEEECCCCCEEEEECCCHHCCCCCCCCHHHHHHHHHHHHHHEEECCCCCCHHHHHHHHHHH
T ss_conf             17861046685466445134642688664413001100135588998999999998755344047532088899999997


Q ss_pred             HHC---CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             010---13331235655540356777665432001347860023435465654321234553211347999864333222
Q gi|254780432|r   85 HST---FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQA  161 (392)
Q Consensus        85 ~~~---~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~  161 (392)
                      +..   ..+||||+||||||||.|||+||+.......+++++||+|+|||||+|+++++++++..|+-+++|..|++.+.
T Consensus       109 ~~~~~~~~~rvff~nsGTeAne~ALK~Ark~~~~~~~~~~t~~Iaf~nsyHG~tlgals~~~~s~y~~~~~p~~p~v~~~  188 (433)
T KOG1401         109 AVLGKGSAERVFFCNSGTEANETALKFARKFTGKKHPEKKTKFIAFENSYHGRTLGALSVTGNSKYGLPFDPIAPDVVTA  188 (433)
T ss_pred             HCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCEEEE
T ss_conf             42356874179995697289999999999863534776641289985675776236667523466688887779853530


Q ss_pred             CCHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             100268875410---12332222333222211246210123221102234572131011003444455531011124545
Q gi|254780432|r  162 KFCDLQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP  238 (392)
Q Consensus       162 ~~~d~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~P  238 (392)
                      +++|..++++.+   .++|||||+|||||+||++++.|+|++.||.+|+++|+++|+|||||||||+|..|++|+++++|
T Consensus       189 ~ynd~t~l~k~~e~~~~~IaAvIvEPiqGaGG~~p~~peFl~~l~k~C~~~~vl~I~DEV~tG~gR~g~~~a~e~~~~~P  268 (433)
T KOG1401         189 EYNDSTALEKLFESHKGEIAAVIVEPIQGAGGIIPADPEFLIGLRKECDDNGVLLIFDEVQTGLGRLGYGWAQEYFGVTP  268 (433)
T ss_pred             CCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEHHHHCCCCCCHHHHHHHHCCCC
T ss_conf             55889999999984788568999713457888656988999999999861596699603431765355277888858697


Q ss_pred             CEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHH
Q ss_conf             302103444444344321000111222223322---34532111100123345543201222101121000026889999
Q gi|254780432|r  239 DIMTIAKGMGGGFPIGACLATNEVAACMNQGSH---GSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAI  315 (392)
Q Consensus       239 Di~~~gK~l~gG~P~sav~~~~~i~~~~~~~~~---~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l  315 (392)
                      ||+|+||.|+||+|+||++++++|++.+.++.|   ++||+|||++|+++.++|+.+.+++..+++.++++.|+++|.+.
T Consensus       269 DI~t~aK~L~gGlPigA~~v~~kV~~~i~~~~~l~hg~Tf~gnpLacs~~~~~l~~l~~pe~~k~vs~~~k~L~~~l~e~  348 (433)
T KOG1401         269 DITTVAKPLGGGLPIGATGVRDKVAEMISPGDHLYHGGTFSGNPLACSAGIKVLDELKDPETLKNVSKIGKELRKLLDEY  348 (433)
T ss_pred             CEEEEHHHCCCCCEEEEEEEHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             60231020368851578865577886518888655576657880555488999998718899998988878999999998


Q ss_pred             HHHCCCEEEEECCCEEEEEEEECCCHHHHHHHHHHCCEEEEECCC----CEEEECC--CCCCC--HHHHHHHHHHHHHHH
Q ss_conf             886797075504640099987249989999999968989962689----8899558--98688--999999999999999
Q gi|254780432|r  316 KNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD----NVVRILP--PLTIT--AEEIHEGLERIERTA  387 (392)
Q Consensus       316 ~~~~~~~v~~vRG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~~----~~irl~P--pl~it--~~eid~~i~~l~~al  387 (392)
                      ..++++.+...+|+|+++++++..+........++.+++....+.    ..+|++|  ++++.  +|.+.+.++++++.+
T Consensus       349 ~~~~~~~i~g~~grgl~ig~~~~~p~~~~~d~~~~~~ll~~~~~~~~~~~gv~i~P~~~l~~~~~~E~i~~~l~i~~k~l  428 (433)
T KOG1401         349 LKKTPNSICGGVGRGLVIGFEFEGPVYKFADAAREQGLLILTLGKGLLEEGVRIAPIYLLTVEHTPEVIQRLLTILEKVL  428 (433)
T ss_pred             HCCCCCCEEEEEEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             64798743677525889989983050543013445568888763246225179955520105686899999999999999


Q ss_pred             HHHC
Q ss_conf             9852
Q gi|254780432|r  388 IKLS  391 (392)
Q Consensus       388 ~~L~  391 (392)
                      ..++
T Consensus       429 ~~l~  432 (433)
T KOG1401         429 SALN  432 (433)
T ss_pred             HHHC
T ss_conf             8742


No 80 
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional
Probab=100.00  E-value=0  Score=606.41  Aligned_cols=351  Identities=19%  Similarity=0.300  Sum_probs=292.8

Q ss_pred             CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC-CCCC
Q ss_conf             874898501037996799764641022674357878999999999999731450687578189999986520101-3331
Q gi|254780432|r   14 SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF-ADRV   92 (392)
Q Consensus        14 ~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~-~~~v   92 (392)
                      .|++|+||+|+||||.|||+|||+.+|+|++++||+||+|.+|+++|+++..+..  ..+....+++++|++..| .++|
T Consensus        30 ~P~~i~rg~G~~l~D~dG~~YlD~~~g~~~~~lGH~~p~i~~Ai~~Ql~~~~~~~--~~~~~~~~~ae~l~~~~p~~~~v  107 (431)
T PRK06209         30 APGFLQRGKGAHVWDVDGNEYIEYGMGLRAVGLGHAYPPVVEAVREALQDGCNFT--RPSAIELDAAELFLDLIDGAEMV  107 (431)
T ss_pred             CCCEEEEEECCEEEECCCCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCC--CCCHHHHHHHHHHHHHCCCCCEE
T ss_conf             9827996433989979879999846649989773796999999999997526554--76589999999999758986569


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCC-CCCCCCC---CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHH
Q ss_conf             23565554035677766543200134786002343-5465654---32123455321134799-9864333222100268
Q gi|254780432|r   93 FFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTF-EGAFHGR---TLATISAGGKLQYLEGF-GPKIEGFDQAKFCDLQ  167 (392)
Q Consensus        93 ~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~-~~~yHG~---t~~a~s~s~~~~~~~~~-~p~~~~~~~~~~~d~~  167 (392)
                      +|+||||||||+|||+||+|      |||++|+.. .+.|||.   ..++...+.      +. ..........+|+|++
T Consensus       108 ~F~nSGsEA~e~AlklAR~~------tgr~~i~~~~~~~~~~~~~~~~g~~~~~~------g~~~~~~~~~~~~~y~d~~  175 (431)
T PRK06209        108 KFCKNGSDATSAAVRLARAY------TGRDLVARCADHPFFSTDDWFIGTTPMSA------GIPASVSALTKTFRYNDIA  175 (431)
T ss_pred             EECCCCCHHHHHHHHHHHHH------HCCCEEEECCCCCEEECCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCHH
T ss_conf             87278837899999999997------59953777057755643566557876557------8887545666564765599


Q ss_pred             HHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             875410---12332222333222211246210123221102234572131011003444455531011124545302103
Q gi|254780432|r  168 SLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA  244 (392)
Q Consensus       168 ~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g  244 (392)
                      ++++.+   +++|||||+||+||+    .||++||++||++|++||+|||+||||||| |||.+|++++|||+|||+|+|
T Consensus       176 ~le~~~~~~~~~iAAvIvEPi~g~----~p~~~fl~~lr~lc~~~giLLI~DEV~TGf-R~g~~~a~~~~gv~PDi~t~g  250 (431)
T PRK06209        176 SLEALFEDYPGRIACVILEPATAD----EPQDNFLHEVQRLCHENGALFILDEMITGF-RWHMRGAQKLYGIVPDLSCFG  250 (431)
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCC----CCCHHHHHHHHHHHHHCCCEEEECCCCCCC-CCCCCCHHHHCCCCCCEEEEH
T ss_conf             999987645566678885031377----897899999999998729079970560266-167522766208998799870


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC--------CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHH
Q ss_conf             44444434432100011122222--------3322345321111001233455432012221011210000268899998
Q gi|254780432|r  245 KGMGGGFPIGACLATNEVAACMN--------QGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIK  316 (392)
Q Consensus       245 K~l~gG~P~sav~~~~~i~~~~~--------~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~  316 (392)
                      |+||||||+|||++++++|+...        ...|++||+|||++||||+++|++++++++++|++++|++|+++|++++
T Consensus       251 K~iggG~Pi~Av~g~~eim~~~~~~~~~~~~~f~~~~T~~g~p~~~AAalatL~~~~~~~l~~~~~~~G~~L~~~l~~l~  330 (431)
T PRK06209        251 KAMGNGFSISALAGKREYMELGGLEHTDFERVFLLSTTHGAETHALAAAIATMAIYREEDVIERLWEQGAKLAAGVNEAA  330 (431)
T ss_pred             HHHHCCCCCEEEEEHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             13228888057778699764035556786654110457788879999999999999854499999999999999999999


Q ss_pred             HHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             8679707550464009998724998----------999999996898996268988995589868899999999999999
Q gi|254780432|r  317 NRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       317 ~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~a  386 (392)
                      ++|+ ++.+|||.|+|+++++...+          ..+...++++|++..+       +..+...|++|||+.+++++++
T Consensus       331 ~~~~-~~~~vr~~G~~~~~~f~~~~~~~~~~~~~~~~~~~~ml~~Gvl~~~-------~~iS~aHt~~di~~~l~a~~~a  402 (431)
T PRK06209        331 AEHG-LQDHVRVSGRPCCLTYSTLDGNGQPSQAFRTLFLQEMIRRGVLMPS-------LVVSYAHGDADIERTIDAVHGA  402 (431)
T ss_pred             HHCC-CCEEEEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCEEHHH-------HHHHHCCCHHHHHHHHHHHHHH
T ss_conf             7679-9779976401337899324455687699999999999958975124-------7760533999999999999999


Q ss_pred             HHHHC
Q ss_conf             99852
Q gi|254780432|r  387 AIKLS  391 (392)
Q Consensus       387 l~~L~  391 (392)
                      |.++.
T Consensus       403 l~~l~  407 (431)
T PRK06209        403 LGVYR  407 (431)
T ss_pred             HHHHH
T ss_conf             99999


No 81 
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase; InterPro: IPR004639   Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway . The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin .   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.   The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.   Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) .   This entry represents glutamate-1-semialdehyde (GSA) aminotransferase (5.4.3.8 from EC), which catalyse a transamination reaction to produce 5-aminoaevulinic acid during the first stage of tetrapyrrole biosynthesis by the C5 pathway , . This enzyme has a high degree of similarity to amino acid transaminases, and is classed as a class III aminotransferase.; GO: 0042286 glutamate-1-semialdehyde 21-aminomutase activity, 0033014 tetrapyrrole biosynthetic process.
Probab=100.00  E-value=0  Score=607.29  Aligned_cols=371  Identities=29%  Similarity=0.431  Sum_probs=320.4

Q ss_pred             CCCCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             15588887489850103799679976464102267435787899999999999973145068757818999998652010
Q gi|254780432|r    8 FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHST   87 (392)
Q Consensus         8 ~~~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~   87 (392)
                      |.+..+.|+++.||+|+||||.|||+||||+.+||...|||+||+|++|+++|+++.+  ++.-+++...+||+++++..
T Consensus        24 FkaV~~~P~f~~~g~G~~l~DvDG~~YIDyv~swGPLILGHahp~v~~Av~e~lerG~--syG~PtE~Ei~lA~~i~~~v  101 (434)
T TIGR00713        24 FKAVGGTPFFVERGKGAYLYDVDGNEYIDYVLSWGPLILGHAHPKVVEAVKEALERGT--SYGAPTEAEILLAKEIISRV  101 (434)
T ss_pred             CCCCCCCCCEEECCCCCEEEECCCCEEEHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCHHHHHHHHHHHHHC
T ss_conf             0267795675651676778833888001211000020117897689999999997301--26899889999999998640


Q ss_pred             C-C--CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCC------
Q ss_conf             1-3--33123565554035677766543200134786002343546565432123455321134799--98643------
Q gi|254780432|r   88 F-A--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGF--GPKIE------  156 (392)
Q Consensus        88 ~-~--~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~--~p~~~------  156 (392)
                      + .  +||+|+||||||+.+||||||-|      |||++||-|+|||||+.-.-+.-.|+..-.-+.  -|..+      
T Consensus       102 ~~~t~e~vRfVnSGTEATMsAvRLARG~------TGR~~IiKFeGcYHGh~D~lLv~AGSGaaT~g~CG~P~SpGvP~~~  175 (434)
T TIGR00713       102 PSVTEEMVRFVNSGTEATMSAVRLARGF------TGRDKIIKFEGCYHGHHDALLVKAGSGAATLGSCGLPTSPGVPEDF  175 (434)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHC------CCCCCEEEECCCCCCCHHHHCCCCCCHHHCCCCCCCCCCCCCHHHH
T ss_conf             5554651686217648899999986310------5887278861764101232003545210104688778888870114


Q ss_pred             --CCCCCCCHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC
Q ss_conf             --33222100268875410---1233222233322221124621012322110223457213101100344445553101
Q gi|254780432|r  157 --GFDQAKFCDLQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY  231 (392)
Q Consensus       157 --~~~~~~~~d~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~  231 (392)
                        ....+||||++++++.+   .++|||||+|||.|+-|+++|.+|||+.||++|+|||+|||+|||.||| |...--|+
T Consensus       176 ~k~Tl~~PYND~~a~~~~f~~~G~~iAgvIvEPv~GNmGvvpP~~eFL~~Lr~lt~e~g~LLI~DEV~TGF-Rva~~GAQ  254 (434)
T TIGR00713       176 AKLTLVLPYNDLEALEEAFEEYGEEIAGVIVEPVAGNMGVVPPKKEFLEGLRELTEEYGALLIFDEVITGF-RVALGGAQ  254 (434)
T ss_pred             HHHCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCEEEEECCCCHH-HCCHHHCC
T ss_conf             31134045173899999998679834378861202576664885223589999998729577550221012-21332150


Q ss_pred             CCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCH
Q ss_conf             11245453021034444443443210001112222233---22345321111001233455432012-221011210000
Q gi|254780432|r  232 EWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQG---SHGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVINIAKI  307 (392)
Q Consensus       232 e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~~---~~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~  307 (392)
                      ++|+|+|||+||||=||||+|+||+.+|+||||.+.|.   -+..||+|||++++|+++||+.++++ .++++..++++.
T Consensus       255 ~yfgV~PDl~~lGKI~GGGlP~gA~gGrrEiM~~laP~G~vYQAGTlsGNPlam~AG~atLk~~~~~~~~Y~~l~~~~~~  334 (434)
T TIGR00713       255 EYFGVEPDLTTLGKIIGGGLPVGAFGGRREIMERLAPEGPVYQAGTLSGNPLAMAAGLATLKLLDEEKGVYTELDELAKR  334 (434)
T ss_pred             HHCCCCCCCEEECHHHCCCCCCEEECCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             11378741034233233764510122675688431788774456435558899999999999853488834899999999


Q ss_pred             HHHHHHHHHHHCCCEEEEECCCEEEEEEEEC-CCH---------------HHHHHHHHHCCEEEEECCCCEEEECCCCCC
Q ss_conf             2688999988679707550464009998724-998---------------999999996898996268988995589868
Q gi|254780432|r  308 LFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV-FSP---------------ALLAAKFRDECLLTAPSSDNVVRILPPLTI  371 (392)
Q Consensus       308 l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~-~~~---------------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~i  371 (392)
                      |.+.|+++..++ ++..+|-..|.|++|=|. .++               ..+.+.++++||++-|+.-++.-++  .-.
T Consensus       335 L~~g~~e~l~~~-gip~~~~~~gSMf~~FFtd~~~V~ny~~A~~SD~e~F~~Ff~~mL~~GVylpPS~FEa~F~S--~AH  411 (434)
T TIGR00713       335 LAEGLSEVLEDK-GIPHTVNRVGSMFSLFFTDEEEVTNYADAKKSDTELFAKFFHEMLEKGVYLPPSQFEACFIS--AAH  411 (434)
T ss_pred             HHHHHHHHHHHC-CCCEEEEECCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHC--CCC
T ss_conf             999999999827-98589950440045665778898788999886189889999999858887898721155516--777


Q ss_pred             CHHHHH----HHHHHHHHHHHHH
Q ss_conf             899999----9999999999985
Q gi|254780432|r  372 TAEEIH----EGLERIERTAIKL  390 (392)
Q Consensus       372 t~~eid----~~i~~l~~al~~L  390 (392)
                      |+|+||    ..++.++++++++
T Consensus       412 ~~E~i~yaq~~ti~a~~~~f~~~  434 (434)
T TIGR00713       412 TEEDIEYAQTNTIEAAEEVFAEL  434 (434)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             72117899999999999998409


No 82 
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminase; InterPro: IPR004637 This is a very small family, with two known examples at the time of model creation. This enzyme is a pyridoxal phosphate-containing class III aminotransferase and is quite similar to 4-aminobutyrate aminotransferase (2.6.1.19 from EC). Diaminobutyrate-2-oxoglutarate transaminase (2.6.1.76 from EC) is a homotetramer which catalyses the conversion of L-2,4-diaminobutyrate and 2-oxoglutarate to L-glutamate and L-aspartic 4-semialdehyde during 1,3-diaminopropane biosynthesis.; GO: 0008483 transaminase activity, 0009058 biosynthetic process.
Probab=100.00  E-value=0  Score=598.20  Aligned_cols=376  Identities=32%  Similarity=0.576  Sum_probs=339.5

Q ss_pred             ECCCCCC-CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHH--CCCCCCCCCCHHHHHHHHHH
Q ss_conf             5155888-87489850103799679976464102267435787899999999999973--14506875781899999865
Q gi|254780432|r    7 LFNTYDQ-SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK--LWHVSNLYQSTQQEIFANHL   83 (392)
Q Consensus         7 ~~~~~~~-~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~--~~~~~~~~~~~~~~~la~~L   83 (392)
                      -+++|.+ +|.+|.+|+|+||||.||++|+||.+|.|+.++|||||.+++++++.++.  ..|+-. ..++...+|.+.|
T Consensus        13 ~VRSY~R~lP~~~~~A~G~~~~D~~G~~Y~DflaGAG~L~~GHN~~~~~Q~~~~~l~~~~~~H~LD-l~T~~K~~F~~~l   91 (445)
T TIGR00709        13 NVRSYPRKLPLAFAKAQGCWVTDVEGKEYLDFLAGAGTLALGHNHPNLKQKIKDVLQSGLPLHTLD-LTTPLKDAFIEAL   91 (445)
T ss_pred             CCCCCCCCCCHHHHHCCCCEEEECCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCEEEHH-CCHHHHHHHHHHH
T ss_conf             113122344124240174279842775021222100021046788899999999986078554300-2200027899999


Q ss_pred             HHHCCCC-----CCCC-CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2010133-----3123-565554035677766543200134786002343546565432123455321134799986433
Q gi|254780432|r   84 IHSTFAD-----RVFF-TNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEG  157 (392)
Q Consensus        84 ~~~~~~~-----~v~f-~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~  157 (392)
                      ....+..     .+.| ..||++|+|+||||||+|      |||..||+|+++|||+|.|++++||+...+....-.+++
T Consensus        92 ~~~~~~~r~~~Y~l~F~GP~GA~a~EaA~KLA~~~------TGR~~visF~~GfHGMT~GaLa~TGN~~~~Na~~~~~~~  165 (445)
T TIGR00709        92 LNILPKPRKEDYKLQFPGPSGADAVEAAIKLAKTY------TGRTNVISFSGGFHGMTIGALALTGNLFAKNAVEMLLPG  165 (445)
T ss_pred             HHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHC------CCCCEEEEECCCCCHHHHHHHHHHCCCHHHCCCCCCCCC
T ss_conf             99706887763178718889853578999974311------787004763388510122136652242000124556777


Q ss_pred             CCCCCCHH-----------------HHHHHHHCC------CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEE
Q ss_conf             32221002-----------------688754101------2332222333222211246210123221102234572131
Q gi|254780432|r  158 FDQAKFCD-----------------LQSLKNQIS------NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLI  214 (392)
Q Consensus       158 ~~~~~~~d-----------------~~~l~~~~~------~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI  214 (392)
                      +...||+.                 .+.+|.-+.      +++||||+|.||||||+...|.+||+.+|++|++|+|+||
T Consensus       166 ~~~~PY~~~~~~P~G~GGeaG~~~~~~Y~ENF~~~~~SG~~KPAA~I~E~iQGEGG~~~A~~~wL~~i~~v~~~~~I~lI  245 (445)
T TIGR00709       166 VQFLPYPHEYRCPLGLGGEAGSNAVIEYFENFIEDVESGVDKPAAVILEAIQGEGGVVAAPVEWLQKIREVTRKHDIKLI  245 (445)
T ss_pred             CCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             62278842324766677034467899998775413667765760468863307885102247999999998742784799


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             01100344445553101112454530210344444-43443210001112222233223453211110012334554320
Q gi|254780432|r  215 FDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGG-GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQ  293 (392)
Q Consensus       215 ~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~g-G~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~  293 (392)
                      +||||.||+|||+||+||+.||+||+|||||++|| |.|++.+..+++ +|.|+|+.|..||.||.++++.+.++|++++
T Consensus       246 lD~VQAG~~R~G~~FaFE~AGI~PD~v~~SKavGGng~PLAv~~i~~~-fD~~~Pa~H~GTFRGN~lA~~TG~~~L~~~k  324 (445)
T TIGR00709       246 LDEVQAGFGRSGKMFAFEHAGIEPDVVVLSKAVGGNGLPLAVLLIKKE-FDAWQPAGHTGTFRGNQLAMVTGLEALNIIK  324 (445)
T ss_pred             EECCCCCCCCCCCCEEECCCCCCCCEEEEECCCCCCCHHHHHHHHHHH-CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             822345701255511002478986768983033888506888776343-0456889866554301578888899999888


Q ss_pred             CCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEEC-CCEEEEEEEECCCH----------------HHHHHHHHHCCEEEE
Q ss_conf             1222101121000026889999886797075504-64009998724998----------------999999996898996
Q gi|254780432|r  294 SDGFLENVINIAKILFEGLTAIKNRFPNMFLEVR-GQGLLIGLKTVFSP----------------ALLAAKFRDECLLTA  356 (392)
Q Consensus       294 ~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vR-G~Gl~~~ie~~~~~----------------~~~~~~l~~~Gll~~  356 (392)
                      +++|.+|++++++++-+-|+++.++|| ++..|| |+|||.||+.+.+.                +.++.+|++++|++-
T Consensus       325 d~~L~~N~QE~~E~~t~~L~~~~K~~P-~~~~VRkGRGlM~Gi~~~~E~~~~D~~G~~P~D~~LA~~I~~~CF~~~LllE  403 (445)
T TIGR00709       325 DDNLAQNAQERGERITSFLDDLIKEYP-CIGNVRKGRGLMIGIEIVDERKSKDAIGAYPADSELAAAIQGACFENGLLLE  403 (445)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             766765554446789999999987378-5476205663354132102577422247886214899999863220573343


Q ss_pred             --ECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             --26898899558986889999999999999999852
Q gi|254780432|r  357 --PSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       357 --~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                        +..++++|+.||++|+++++.+.+.+|.+++.++.
T Consensus       404 ~~G~~~~V~~ll~p~~I~~~~~~~~~~~~~~av~e~~  440 (445)
T TIGR00709       404 KGGREGEVVRLLCPITIDQEELEEVISRLKQAVEEAL  440 (445)
T ss_pred             ECCCCCCEEEEECCEEECHHHHHHHHHHHHHHHHHHH
T ss_conf             0689973689706603245668999999999999999


No 83 
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism]
Probab=100.00  E-value=0  Score=543.50  Aligned_cols=366  Identities=30%  Similarity=0.434  Sum_probs=313.2

Q ss_pred             CCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCC-CCC
Q ss_conf             8748985010379967997646410226743578789999999999997314506875781899999865201013-331
Q gi|254780432|r   14 SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFA-DRV   92 (392)
Q Consensus        14 ~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~~-~~v   92 (392)
                      .|++++||+|+||||.|||+|||++++|+...|||+||.|.+|+++|+++.+.  ..-+++...++||.|++..|. ++|
T Consensus        35 ~P~fi~~g~Ga~l~DvDGn~YIDy~~~~Gp~ilGH~~p~V~~Av~~~l~~G~~--fg~Pte~Ei~~Aell~~~~p~~e~v  112 (432)
T COG0001          35 YPIFIERGKGAYLTDVDGNEYIDYVLGWGPLILGHAHPAVVEAVQEQLERGLS--FGAPTELEVELAELLIERVPSIEKV  112 (432)
T ss_pred             CCEEEEECCCCEEEECCCCEEEEHHCCCCCCCCCCCCHHHHHHHHHHHHHCCC--CCCCCHHHHHHHHHHHHHCCCCCEE
T ss_conf             98467745578699479987540130576500088987999999999972677--7899778999999999865865089


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCC-----CCCCCCCCCHH
Q ss_conf             23565554035677766543200134786002343546565432123455--321134799986-----43332221002
Q gi|254780432|r   93 FFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAG--GKLQYLEGFGPK-----IEGFDQAKFCD  165 (392)
Q Consensus        93 ~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s--~~~~~~~~~~p~-----~~~~~~~~~~d  165 (392)
                      .|+||||||+..|||+||.|      |||+|||.|+|+|||++-..+.-.  |-..+..+-.|-     ...+..+||||
T Consensus       113 rfvnSGTEAtmsAiRlARa~------TgR~kIikF~G~YHG~~D~~lv~agsg~~t~g~p~s~Gvp~~~a~~ti~~~yND  186 (432)
T COG0001         113 RFVNSGTEATMSAIRLARAY------TGRDKIIKFEGCYHGHSDSLLVKAGSGAATLGSPSSPGVPADVAKHTLVLPYND  186 (432)
T ss_pred             EEECCHHHHHHHHHHHHHHH------HCCCEEEEECCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCHHHHCCEEEECCCC
T ss_conf             98606408999999999876------479759997288888711878426767555789999999734534478845799


Q ss_pred             HHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             68875410---123322223332222112462101232211022345721310110034444555310111245453021
Q gi|254780432|r  166 LQSLKNQI---SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT  242 (392)
Q Consensus       166 ~~~l~~~~---~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~  242 (392)
                      ++++++.+   .++|||||+|||+|+.|+++|+++||++||++|++||++||+|||.||| |...--++++|||+|||.|
T Consensus       187 ~~al~~~~~~~g~~IAaVIvEPv~gn~g~i~p~~~Fl~~Lr~lt~e~G~lLI~DEViTGF-R~~~gGaq~~~gi~PDltt  265 (432)
T COG0001         187 LEALEEAFEEYGDDIAAVIVEPVAGNMGVVPPEPGFLEGLRELTEEHGALLIFDEVITGF-RVALGGAQGYYGVEPDLTT  265 (432)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHC-CCCCCCCCCCCCCCCCHHH
T ss_conf             999999998768967999954246788989898789999999999719489986221204-5477642010086963332


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHHHHHHHHHHH
Q ss_conf             034444443443210001112222233---22345321111001233455432012-22101121000026889999886
Q gi|254780432|r  243 IAKGMGGGFPIGACLATNEVAACMNQG---SHGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILFEGLTAIKNR  318 (392)
Q Consensus       243 ~gK~l~gG~P~sav~~~~~i~~~~~~~---~~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~~~L~~l~~~  318 (392)
                      +||-||||+|+||+.+++|||+.+.+.   .+.+||+|||++++|+.++|+.++++ .+.++..+++++|.++|+++.++
T Consensus       266 lGKiIGGGlP~ga~gGr~eiM~~~~p~g~vyqaGT~sgnplamaAG~atl~~l~~~~~~y~~l~~~~~~L~~gl~~~~~~  345 (432)
T COG0001         266 LGKIIGGGLPIGAFGGRAEIMEQLAPLGPVYQAGTLSGNPLAMAAGLATLEELMTEEGVYERLDALGERLAEGLRAAAER  345 (432)
T ss_pred             HHHHHCCCCCEEEECCHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             22440477520112569999963277887645677788689999999999998736518999999999999999999998


Q ss_pred             CCCEEEEECCCEEEEEEEECCCH---------------HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             79707550464009998724998---------------999999996898996268988995589868899999999999
Q gi|254780432|r  319 FPNMFLEVRGQGLLIGLKTVFSP---------------ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERI  383 (392)
Q Consensus       319 ~~~~v~~vRG~Gl~~~ie~~~~~---------------~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l  383 (392)
                      + .+-..|.+.|.|+++-|...+               ..+...++++|+++.|..-+..-++++  .|+++||+.++++
T Consensus       346 ~-g~~~~v~~~gsm~~i~F~~~~~~n~~da~~sd~~~~~~~~~~~l~~GV~l~ps~~ea~flS~a--hte~di~~~~~a~  422 (432)
T COG0001         346 H-GIPLTVNRVGSMFGIFFTEEGVRNYADAKRSDVERFAKFFHHLLNRGVYLAPSQFEAGFLSTA--HTEEDIDRTLEAA  422 (432)
T ss_pred             H-CCCEEEEEECCEEEEEECCCCCCCHHHHHHHCHHHHHHHHHHHHHCCCCCCCCCCCCEEEECC--CCHHHHHHHHHHH
T ss_conf             3-998588620425899955899888999986356999999999996882347755554552004--6899999999999


Q ss_pred             HHHHHHHC
Q ss_conf             99999852
Q gi|254780432|r  384 ERTAIKLS  391 (392)
Q Consensus       384 ~~al~~L~  391 (392)
                      ++++.++.
T Consensus       423 ~~~~~~~~  430 (432)
T COG0001         423 DEAFKELA  430 (432)
T ss_pred             HHHHHHHH
T ss_conf             99999863


No 84 
>KOG1403 consensus
Probab=100.00  E-value=0  Score=500.92  Aligned_cols=369  Identities=25%  Similarity=0.458  Sum_probs=313.0

Q ss_pred             CCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC-C
Q ss_conf             888874898501037996799764641022674357878999999999999731450687578189999986520101-3
Q gi|254780432|r   11 YDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF-A   89 (392)
Q Consensus        11 ~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~-~   89 (392)
                      |..-|+-|+||.|.|++|.+|++|||++++  +.-.|||||++++|..+||.++ .++..|.+....+.|+.|....| +
T Consensus        26 y~sDP~kivRaq~QYmfDE~g~~yLDCInN--VaHvghchp~VV~A~~kQmat~-~tN~RFlhd~lv~cA~~l~stlPeL  102 (452)
T KOG1403          26 YRSDPLKIVRAQGQYMFDEEGTRYLDCINN--VAHVGHCHPEVVRAGAKQMATI-STNNRFLHDELVQCARTLTSTLPEL  102 (452)
T ss_pred             ECCCCHHHEHHCCCEEECCCCCCHHHHHHH--HHHCCCCCHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             617961201010011115676638887642--2112557899999999887675-0452466778999999986108785


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C------
Q ss_conf             331235655540356777665432001347860023435465654321234553211347999864333222-1------
Q gi|254780432|r   90 DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQA-K------  162 (392)
Q Consensus        90 ~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~-~------  162 (392)
                      +-++|+||||||||.|+|+||.|      |+++.+|+++++|||+-...|-+|. -++.++-+-..|++.|+ |      
T Consensus       103 svc~F~NSGSEANDLALRLAR~f------tkhqDvItldHAYHGHl~s~mE~SP-YKF~~g~~v~kpd~VHVAPcPDvyr  175 (452)
T KOG1403         103 SVCFFVNSGSEANDLALRLARNF------TKHQDVITLDHAYHGHLQSVMEVSP-YKFNQGGGVAKPDYVHVAPCPDVYR  175 (452)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHH------CCCCCEEEEECHHCCCEEEEEECCC-EECCCCCCCCCCCEEEECCCCCCCC
T ss_conf             18999668861558999998751------2567548873000343001465064-4306898857876167457863125


Q ss_pred             -------CH--H-----HHHHHHHC------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCC
Q ss_conf             -------00--2-----68875410------1233222233322221124621012322110223457213101100344
Q gi|254780432|r  163 -------FC--D-----LQSLKNQI------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGY  222 (392)
Q Consensus       163 -------~~--d-----~~~l~~~~------~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~  222 (392)
                             ++  |     .+..++.+      ...|||+|.|.+|+-||-+.||.+|++.+.+..+.+|.++|+||||+||
T Consensus       176 GK~r~~~~~~a~~~~~Yad~vk~I~~d~~~~g~gvAAfiAEslQSCGGQiiPPagYFq~Va~~Vr~aGGv~IaDEVQvGF  255 (452)
T KOG1403         176 GKFRDKMYPDADMGALYADPVKEICQDQLAKGQGVAAFIAESLQSCGGQIIPPAGYFQAVADAVRSAGGVCIADEVQVGF  255 (452)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCEEEEEHHHHCC
T ss_conf             61220138766500443037999999998527757999999998569813584327899999985179769842121043


Q ss_pred             CCCC-CCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             4455-531011124545302103444444344321000111222223--3223453211110012334554320122210
Q gi|254780432|r  223 GRTG-KLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQ--GSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE  299 (392)
Q Consensus       223 GRtG-~~f~~e~~gi~PDi~~~gK~l~gG~P~sav~~~~~i~~~~~~--~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~  299 (392)
                      ||.| ++|+||.|++.|||+|+||.+|||+|+++|+++++|.+.+..  ..+++||+|||++||+++++|+++++++|++
T Consensus       256 GRvG~hyWafq~y~fiPDIVtmgKpmGNGhPVa~VattkeIA~Af~atgv~YFNTyGGnPVsCAv~laVm~v~e~E~Lq~  335 (452)
T KOG1403         256 GRVGSHYWAFQTYNFIPDIVTMGKPMGNGHPVAAVATTKEIAQAFHATGVEYFNTYGGNPVSCAVGLAVMRVCEDENLQE  335 (452)
T ss_pred             CCCCHHHHHHHHHCCCCCHHEECCCCCCCCEEEEEECCHHHHHHHCCCCCEEHHCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             32310354444524564330004657799702688536889998502660000046998065899999999974566778


Q ss_pred             HHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH----------HHHHHHHHHC-CEEEEEC--CCCEEEEC
Q ss_conf             112100002688999988679707550464009998724998----------9999999968-9899626--89889955
Q gi|254780432|r  300 NVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP----------ALLAAKFRDE-CLLTAPS--SDNVVRIL  366 (392)
Q Consensus       300 ~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~----------~~~~~~l~~~-Gll~~~~--~~~~irl~  366 (392)
                      +++++|+.|..-|++++.+| .++.+|||.||+|||+++++.          ..+..++++. ++++...  +.|++++.
T Consensus       336 ha~~vG~~L~~lL~~~k~kh-~~IGDvRGvGLFiGIdLVkD~~tRtP~tk~A~~~v~rlke~y~VLlsaDGPh~NilKiK  414 (452)
T KOG1403         336 HAQQVGEKLEVLLRRLKQKH-ECIGDVRGVGLFIGIDLVKDRKTRTPDTKEAHWVVNRLKELYRVLLSADGPHRNILKIK  414 (452)
T ss_pred             HHHHHHHHHHHHHHHHHHHC-CCEECCCCCEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHEEEECCCCCCCEEECC
T ss_conf             89988799999999876506-13101333227885200011123797378799999999886407870689987636437


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             898688999999999999999985
Q gi|254780432|r  367 PPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       367 Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      ||+.++++.+++.+..|++.|.-+
T Consensus       415 PPmCFneena~e~v~~ld~iLT~m  438 (452)
T KOG1403         415 PPMCFNEENADEFVLGLDEILTVM  438 (452)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             984347312999999899999999


No 85 
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase; InterPro: IPR004631 4-aminobutyrate aminotransferase eukaryotic (2.6.1.19 from EC) is a class III pyridoxal-phosphate-dependent aminotransferase. The enzyme catalyses the conversion of 4-aminobutanoate and 2-oxoglutarate into succinate semialdehyde and L-glutamate. The degree of sequence difference between this set and known bacterial examples is greater than the distance between either set the most similar enzyme with distinct function, and so the prokaryotic and eukaryotic sets have been placed into separate families. This family describes known eukaryotic examples of the enzyme. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase.; GO: 0003867 4-aminobutyrate transaminase activity, 0009448 gamma-aminobutyric acid metabolic process.
Probab=100.00  E-value=0  Score=496.24  Aligned_cols=368  Identities=25%  Similarity=0.394  Sum_probs=305.1

Q ss_pred             CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHH-HHHHCCCCC-CC---CCCHHHHHHHHH-HHHH
Q ss_conf             88748985010379967997646410226743578789999999999-997314506-87---578189999986-5201
Q gi|254780432|r   13 QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKS-QSEKLWHVS-NL---YQSTQQEIFANH-LIHS   86 (392)
Q Consensus        13 ~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~-q~~~~~~~~-~~---~~~~~~~~la~~-L~~~   86 (392)
                      .+++..+|+.|-||.|.|||.|||++|++++..+|||||.++|+++. ++.+. +++ ++   |.+..+...++. +++.
T Consensus        40 ~fl~dYekS~GNYl~DvDGN~lLDlYsQIsSiPiGYNnP~L~K~a~sPe~a~~-LinRPALGnfp~~~l~~~~~~g~~k~  118 (469)
T TIGR00699        40 KFLADYEKSVGNYLVDVDGNVLLDLYSQISSIPIGYNNPALLKAAQSPEMATT-LINRPALGNFPSKDLAKILKSGILKV  118 (469)
T ss_pred             HHHCCHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCCHHHHHHHCCHHHHHH-HHCCCCCCCCCHHHHHHHHCCCCHHH
T ss_conf             11103011157645631430478888777521224668789986517245788-64473014676679999854881232


Q ss_pred             CC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCC----------------------CCCCCCCCCCCCCCCCCCCC
Q ss_conf             01--3331235655540356777665432001347860----------------------02343546565432123455
Q gi|254780432|r   87 TF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKF----------------------RIVTFEGAFHGRTLATISAG  142 (392)
Q Consensus        87 ~~--~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~----------------------~ii~~~~~yHG~t~~a~s~s  142 (392)
                      .|  .+.|++..|||+|||.|-|.|..|++.+.+-|-+                      -|+||.+|||||++|++|.|
T Consensus       119 aPKg~~~v~~~~aG~dane~AfK~af~yYr~~~RGGp~~~Fs~eE~~s~m~N~~PG~P~~siLSF~~aFHGRlfGsLsTT  198 (469)
T TIGR00699       119 APKGQDSVYRAMAGSDANELAFKAAFMYYRSKQRGGPERDFSEEENESCMVNQAPGSPDLSILSFKAAFHGRLFGSLSTT  198 (469)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHCCCCHHHHHHHHHHC
T ss_conf             45210301144666426789999999999835898887531178877643168755850788852343103444420003


Q ss_pred             CCCCCCC-CC----CCCCCCCCCCCCH-----------------HHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCHH
Q ss_conf             3211347-99----9864333222100-----------------268875410123---322223332222112462101
Q gi|254780432|r  143 GKLQYLE-GF----GPKIEGFDQAKFC-----------------DLQSLKNQISND---TAAILIEPIQGEGGVRKVPEE  197 (392)
Q Consensus       143 ~~~~~~~-~~----~p~~~~~~~~~~~-----------------d~~~l~~~~~~~---iAavi~Epv~g~~G~~~~~~~  197 (392)
                      .+...++ ++    +|. .+|+...|+                 .+|.|.......   |||+||||||+|||+.+.+++
T Consensus       199 ~SKpiHKlD~PaF~WP~-A~FP~LkYPLeE~~~~N~~Ee~rCL~~vE~L~~~~~~pkrtVaA~IvEPIQSEGGDNHAS~~  277 (469)
T TIGR00699       199 RSKPIHKLDIPAFDWPQ-APFPSLKYPLEEHVEENAKEEQRCLEEVEDLIKKWHKPKRTVAAIIVEPIQSEGGDNHASPD  277 (469)
T ss_pred             CCCCCCCCCCCCCCCCC-CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCHH
T ss_conf             47760317865777467-77876678702325754558889999999999731798615888886243478885343378


Q ss_pred             HHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCC--CCCEEECCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             232211022345721310110034444555310111245--45302103444-444344321000111222223322345
Q gi|254780432|r  198 FLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANV--KPDIMTIAKGM-GGGFPIGACLATNEVAACMNQGSHGST  274 (392)
Q Consensus       198 ~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi--~PDi~~~gK~l-~gG~P~sav~~~~~i~~~~~~~~~~~T  274 (392)
                      |+++||++++|||+++|+||||||.|=||++||||||++  -||||||||-+ ++||    .....++ -.-.+..+++|
T Consensus       278 Ff~KLr~i~~k~~v~FivDEVQTGvGaTGklWAHe~W~L~~P~D~vtFSKK~qtAGy----FFH~~~l-rPn~pYr~FNT  352 (469)
T TIGR00699       278 FFRKLRDITKKHNVAFIVDEVQTGVGATGKLWAHEHWNLDDPPDMVTFSKKFQTAGY----FFHDPAL-RPNKPYRQFNT  352 (469)
T ss_pred             HHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCEEECHHHHCCCC----CCCCCCC-CCCCCCCCCCC
T ss_conf             889999999885956899645508788633123002741113850220456412764----2367356-88844000354


Q ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEEC--CCEEEEEEEECCC--HHHHHHHHHH
Q ss_conf             32111100123345543201222101121000026889999886797075504--6400999872499--8999999996
Q gi|254780432|r  275 YGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVR--GQGLLIGLKTVFS--PALLAAKFRD  350 (392)
Q Consensus       275 ~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vR--G~Gl~~~ie~~~~--~~~~~~~l~~  350 (392)
                      |.|.|.-+....+++++|++++|++|++..|++|..+|++|+++||..+..+|  |+|.+++.++..+  ...+...++-
T Consensus       353 W~GdP~r~l~~~~i~~eI~~~~L~~n~~~~Gd~Ly~GLe~L~~~YP~~~~nlRGKGrGTFiawD~p~~a~Rd~l~~~~r~  432 (469)
T TIGR00699       353 WMGDPSRALILREIIQEIKRKDLLNNVAAVGDYLYTGLEDLQKKYPEKVQNLRGKGRGTFIAWDTPDEAKRDKLLLKARL  432 (469)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCCCCCEEECCCCCHHHHHHHHHHHCC
T ss_conf             45778899999988876422577888998767889989999975013440344676421574049887888999996223


Q ss_pred             CCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             8989962689889955898688999999999999999
Q gi|254780432|r  351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       351 ~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      +|+.++++|.+.|||+|.|++.+.+.|-+++.|++.+
T Consensus       433 ~Gvn~GGcG~~aiRLRP~LvF~~hHA~ilL~~~~~~~  469 (469)
T TIGR00699       433 NGVNIGGCGVKAIRLRPMLVFQKHHADILLEAIEKII  469 (469)
T ss_pred             CCEEECCCCCCCEECCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             8257626535424237530103556899999986309


No 86 
>KOG1405 consensus
Probab=100.00  E-value=0  Score=439.00  Aligned_cols=371  Identities=27%  Similarity=0.398  Sum_probs=302.2

Q ss_pred             CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHH-HHHHCCCCC-CCCCCHHHHHHHHH----HHHH
Q ss_conf             88748985010379967997646410226743578789999999999-997314506-87578189999986----5201
Q gi|254780432|r   13 QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKS-QSEKLWHVS-NLYQSTQQEIFANH----LIHS   86 (392)
Q Consensus        13 ~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~-q~~~~~~~~-~~~~~~~~~~la~~----L~~~   86 (392)
                      .+++..+|+.|.|++|.|||.+||.++.++++.+|||||.++++++. |+-+. .++ +...+-+..++++.    |+..
T Consensus        57 ~F~~dYEkS~GNYlvDvDGN~lLDvYsQIsSvplGYn~P~LvK~a~~p~~~~~-lvnRPALg~fP~kd~~~~l~~~ll~~  135 (484)
T KOG1405          57 HFFVDYEKSIGNYLVDVDGNRLLDVYSQISSVPLGYNNPALVKAAQQPQNATM-LVNRPALGNFPPKDFAEKLRQSLLSI  135 (484)
T ss_pred             EEEHHHHHHCCCEEEECCCCEEEHHHHHHCCCCCCCCCHHHHHHHCCHHHHHH-HHCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             77501344217668954787630246565015667898899987348488888-70661015788066899999998764


Q ss_pred             C--CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCC--------------------CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             0--1333123565554035677766543200134786--------------------00234354656543212345532
Q gi|254780432|r   87 T--FADRVFFTNSGAESVECAIKTARRYHYMAGKTNK--------------------FRIVTFEGAFHGRTLATISAGGK  144 (392)
Q Consensus        87 ~--~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r--------------------~~ii~~~~~yHG~t~~a~s~s~~  144 (392)
                      .  |.+.|.++.+||.|||+|.|.|..|..++.+.++                    --|++|+++|||||++++|.|.+
T Consensus       136 APKG~~~v~tm~cGs~aNEnA~K~afiwy~~k~rg~~~~s~~e~eScm~n~aPg~P~lsvlsF~gaFHGR~~g~lstT~S  215 (484)
T KOG1405         136 APKGQKQVITMLCGSCANENAYKTAFIWYRAKERGQAGFSAEELESCMINQAPGAPDLSVLSFKGAFHGRTFGSLSTTHS  215 (484)
T ss_pred             CCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             85407778877505653388899999998751378899777888888705899998645554034104643013333457


Q ss_pred             CCCCC-C---CCCCCCCCCCCCCH-----------------HHHHHHHHCC---CCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             11347-9---99864333222100-----------------2688754101---23322223332222112462101232
Q gi|254780432|r  145 LQYLE-G---FGPKIEGFDQAKFC-----------------DLQSLKNQIS---NDTAAILIEPIQGEGGVRKVPEEFLQ  200 (392)
Q Consensus       145 ~~~~~-~---~~p~~~~~~~~~~~-----------------d~~~l~~~~~---~~iAavi~Epv~g~~G~~~~~~~~l~  200 (392)
                      ...++ +   |......|+...|+                 ++|++.....   ..|||+|+||||++||+.+.+++|++
T Consensus       216 KpIHKldiPaFdWPiA~fP~ykYPLdenv~~N~ked~~Cl~~Ve~li~~~~~k~~pVaaiIvEPIQsEGGDnhaSp~Ff~  295 (484)
T KOG1405         216 KPIHKLDIPAFDWPIAPFPRYKYPLDENVAENKKEDQGCLAEVEDLIVKYRKKKKPVAAIIVEPIQSEGGDNHASPDFFR  295 (484)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECHHCCCCCCCCCHHHHH
T ss_conf             66400688888897788743458745656551221366799999999997603797579986511025788668989999


Q ss_pred             HHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCC--CCCEEECCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             211022345721310110034444555310111245--45302103444-444344321000111222223322345321
Q gi|254780432|r  201 QLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANV--KPDIMTIAKGM-GGGFPIGACLATNEVAACMNQGSHGSTYGG  277 (392)
Q Consensus       201 ~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi--~PDi~~~gK~l-~gG~P~sav~~~~~i~~~~~~~~~~~T~~g  277 (392)
                      +||++|+|||+.+|+||||||-|-||++||+|||++  .||+||++|.+ +|||     ...++. -.-.+..+.+||.|
T Consensus       296 kLrdi~~Kh~v~fivDEVQTGgGaTGk~WaHehw~l~~PpD~vTFSKK~q~gGf-----fh~~~f-rpn~pYrifNTWmG  369 (484)
T KOG1405         296 KLRDITKKHGVAFIVDEVQTGGGATGKFWAHEHWNLDSPPDVVTFSKKFQTGGF-----FHDEEF-RPNEPYRIFNTWMG  369 (484)
T ss_pred             HHHHHHHHCCEEEEEEEEECCCCCCCCEEEEHHCCCCCCCCCEEHHHHHHCCCC-----CCCCCC-CCCCHHHHHHHHCC
T ss_conf             999999864958996400007886675432020389999510110255522764-----247334-87844787654307


Q ss_pred             CCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH--HHHHHHHHHCCEEE
Q ss_conf             1110012334554320122210112100002688999988679707550464009998724998--99999999689899
Q gi|254780432|r  278 NVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP--ALLAAKFRDECLLT  355 (392)
Q Consensus       278 npl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~--~~~~~~l~~~Gll~  355 (392)
                      .|.-..-..+++++|++++|+++++..|+.|.++|.+|.++||..+..+||+|.+++.++....  ..+...++-+|+.+
T Consensus       370 dP~k~lll~~vv~~I~~~~Ll~n~~~vG~~l~~gL~~Lq~~~p~~~~~~RGrGTF~a~d~ps~~~Rdk~i~~~~~nGv~~  449 (484)
T KOG1405         370 DPSKNLLLEEVVQEIKREDLLNNVAHVGKALLKGLLELQAKYPGKINNLRGRGTFIAWDCPSGSIRDKLILIARLNGVNL  449 (484)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCEE
T ss_conf             85888999999999858889988999999999889999886842554245663279973898178899999998769421


Q ss_pred             EECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             62689889955898688999999999999999985
Q gi|254780432|r  356 APSSDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       356 ~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      .++|...|||+|+|+.++.+.|-.+++|++++..|
T Consensus       450 GGCg~~siRfRPsLvf~~~Ha~i~l~~~~k~l~~l  484 (484)
T KOG1405         450 GGCGDKSIRFRPSLVFRKHHADIFLDIFDKILAGL  484 (484)
T ss_pred             CCCCCCEEEECCCEEEHHHHHHHHHHHHHHHHCCC
T ss_conf             46542025403320114666889999999986049


No 87 
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase; InterPro: IPR005815    All members of the seed alignment have been demonstrated experimentally to act as (2.6.1.62 from EC), an enzyme in the biotin biosynthetic pathway. Alternate names include 7,8-diaminopelargonic acid aminotransferase, DAPA aminotransferase, and adenosylmethionine-8-amino-7-oxononanoate aminotransferase. The gene symbol is bioA in E. coli and BIO3 in S. cerevisiae. ; GO: 0004015 adenosylmethionine-8-amino-7-oxononanoate transaminase activity, 0009102 biotin biosynthetic process.
Probab=100.00  E-value=0  Score=333.20  Aligned_cols=386  Identities=29%  Similarity=0.450  Sum_probs=325.2

Q ss_pred             CCCEECCCCCC----CCE-EEEEECCCEEEECCCC----EEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCC
Q ss_conf             43145155888----874-8985010379967997----6464102267435787899999999999973145068-757
Q gi|254780432|r    3 KNDFLFNTYDQ----SDI-RFEKGKGAWLFSENGI----PFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQ   72 (392)
Q Consensus         3 ~~~~~~~~~~~----~p~-~i~~a~G~~i~d~dG~----~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~   72 (392)
                      +.+++||.|..    .|. .+++++|+.+.-.||+    +.+|..+.||+...||+||++.++.++|++++.|+.. .+.
T Consensus        11 d~~~~w~p~~~~~~~~~~~~~~~~~g~~~~~~~g~p~~~~~~d~~~~ww~~~~g~~~p~~~~~~~~~~~~~~~~~~gg~~   90 (466)
T TIGR00508        11 DKRHIWHPYTSLSSPLPLYPVESADGVELTLEDGRPVDVRLIDGLSSWWAAIHGYNHPRLNAAAQKQLDKLSHVLFGGLT   90 (466)
T ss_pred             HHHHCCCCCCCCCCCCCCCEECCCCCEEEEECCCCCCEEEEECCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             12211343222467643200003564168863788420333211013455440577524567888878765555523544


Q ss_pred             CHHHHHHHHHHHHHC--CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             818999998652010--13331235655540356777665432001347860023435465654321234553211347-
Q gi|254780432|r   73 STQQEIFANHLIHST--FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLE-  149 (392)
Q Consensus        73 ~~~~~~la~~L~~~~--~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~-  149 (392)
                      ++....+++++++..  +.+.+++..||+-++|.++|++.+++...+...|++++++.++|||.|++++++.+...... 
T Consensus        91 ~~~~~~~~~~~~~~~~~~~~~~~~~d~g~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~g~~gd~~~~~~~cdp~~~~~~  170 (466)
T TIGR00508        91 HEPAVELCRKLLKLTPEPLDCVFLADSGSVAVEVALKLALQYWKGKGEPERTKFLTLRNGYHGDTFGALSVCDPENGLHS  170 (466)
T ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCHHHHHEEEEECCCCCCCCCCCEECCCCCCHHH
T ss_conf             31578999999973463100455305764024667788776542024111321000004545543342110266532123


Q ss_pred             ---------CCCCCC---CCCC--CC----CCHH-----HHHHHHHCCCC-CCCCCCCCC-CCCCCCCCCCHHHHHHHHC
Q ss_conf             ---------999864---3332--22----1002-----68875410123-322223332-2221124621012322110
Q gi|254780432|r  150 ---------GFGPKI---EGFD--QA----KFCD-----LQSLKNQISND-TAAILIEPI-QGEGGVRKVPEEFLQQLRK  204 (392)
Q Consensus       150 ---------~~~p~~---~~~~--~~----~~~d-----~~~l~~~~~~~-iAavi~Epv-~g~~G~~~~~~~~l~~l~~  204 (392)
                               -|.|.+   ++..  ..    ++++     ...+.+...++ ++++++||+ +|.||.++..+.|+.++++
T Consensus       171 ~~~~~~~~~~~~~~p~~~~g~p~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~g~gg~~~~~p~~~~~~~~  250 (466)
T TIGR00508       171 LWKGYLPENLFAPAPSIVDGLPTSQVRFDEEWNEEDISPLAKLLELHGDETVAAVILEPIVQGAGGLRFYHPTYLKRVRA  250 (466)
T ss_pred             HHCCCCCHHHHCCCCCHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             32022220221256511115655556776531045677899999852254011233344440457641023789999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCCCCC---------------CCCCEEECCCCCCCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             2234572131011003444455531011124---------------5453021034444443-44321000111222223
Q gi|254780432|r  205 ICDDIDALLIFDEVQTGYGRTGKLFAYEWAN---------------VKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQ  268 (392)
Q Consensus       205 lc~~~g~llI~DEV~tG~GRtG~~f~~e~~g---------------i~PDi~~~gK~l~gG~-P~sav~~~~~i~~~~~~  268 (392)
                      +|+++++++|+||+.|||||||+.|++++.+               +.||++|+||+++||| .+++.+.++++.+.+..
T Consensus       251 ~~~~~~~~~~~d~~~~g~g~~g~~~~~~~~~~~~~~~g~~p~~~~~~~pd~~c~g~~~~gg~~~~~~~~~~~~~~~~~~~  330 (466)
T TIGR00508       251 LCKKYGLLLIADEIATGFGRTGKLFACEHAGKYQDQHGISPSDQIKVVPDILCLGKALTGGYLTLSATLTTDKVAETISS  330 (466)
T ss_pred             HHHHHHHEEEEHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEECCCHHHHCCCCCCCCEEEEHHHHHHHHHHHHCC
T ss_conf             86442010220113203575320110121001001027884322010320221100003430000001223456775406


Q ss_pred             C--------CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHC-----CCEEEEECCCEEEEEE
Q ss_conf             3--------22345321111001233455432012221011210000268899998867-----9707550464009998
Q gi|254780432|r  269 G--------SHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF-----PNMFLEVRGQGLLIGL  335 (392)
Q Consensus       269 ~--------~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~-----~~~v~~vRG~Gl~~~i  335 (392)
                      +        .|+.||.+||++|+++.+.++++.+..+.+++..+...+...+..+...-     ...+.++|..|.+..+
T Consensus       331 ~~~p~~g~~~~gp~~~~~p~~c~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~p~~~~~~~g~~g~~~~~~~~~g~~g~~  410 (466)
T TIGR00508       331 GEGPTGGCFLHGPTFLGNPLACAVAEASLALLLEGPWQKQVSAIESQLKRELSPLRKNPDNGLIGTGVKDVRVLGAIGVV  410 (466)
T ss_pred             CCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             77764521321642013324566666678877403046789999888887664321156665201001122222001010


Q ss_pred             EEC--CCHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             724--998999999996898996268988995589868899999999999999998
Q gi|254780432|r  336 KTV--FSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       336 e~~--~~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      |..  .+...+...+.++|+|++|.+ ..+++.||++++.+++.+....+..++.+
T Consensus       411 ~~~~~~~~~~~~~~~~~~g~w~~p~g-~~~~~~pp~~~~~~~~~~~~~~~~~~~~~  465 (466)
T TIGR00508       411 ELKEPVNVEELQKGFVEKGVWIRPFG-KLLYLLPPYVITSEELAKLTAALIEALKG  465 (466)
T ss_pred             HCCCCCCHHHHHHHHHHCCCEECCCC-CEEEECCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             00123578888778764374121135-36564176200448888999999987505


No 88 
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional
Probab=99.97  E-value=6e-30  Score=216.27  Aligned_cols=342  Identities=18%  Similarity=0.237  Sum_probs=244.8

Q ss_pred             CCCCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCC-CHHHHHHHHHHHHHCCCCCC---C--CCCHHHHHHHHHH
Q ss_conf             5888874898501037996799764641022674357878-99999999999973145068---7--5781899999865
Q gi|254780432|r   10 TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHS-HPELVAILKSQSEKLWHVSN---L--YQSTQQEIFANHL   83 (392)
Q Consensus        10 ~~~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~-~p~i~~a~~~q~~~~~~~~~---~--~~~~~~~~la~~L   83 (392)
                      ..++....+++..|.++.-.||+++|+|.|+   .-||-+ ||+|++|..+.+++....+.   .  ..++...+|+++|
T Consensus        20 ~l~R~~~~~~~~~~~~i~i~dG~~~lnf~Sn---dYLGL~~~p~v~~a~~~a~~~yG~gs~~Srl~~G~~~~h~~LE~~l   96 (395)
T PRK06939         20 GLYKEERVITSPQGADITVADGKEVINFCAN---NYLGLANHPELIAAAKAALDSHGFGMASVRFICGTQDLHKELEQKL   96 (395)
T ss_pred             CCCCCCCCCCCCCCCEEEEECCCEEEEEECC---CCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             9986452214788875895389389997767---6557889989999999999972999877685747839999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             20101333123565554035677766543200134786002343546565432123455321134799986433322210
Q gi|254780432|r   84 IHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKF  163 (392)
Q Consensus        84 ~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~  163 (392)
                      .+..+.+.+.+.+||..||-.++..-         .++..+|-.+.--|-.-...+-+++            ..+...++
T Consensus        97 A~~~g~e~allf~SGy~aN~~~i~aL---------~~~~d~i~~D~l~HaSiidG~~ls~------------a~~~~f~H  155 (395)
T PRK06939         97 AKFLGTEDAILYSSCFDANGGLFETL---------LGKEDAIISDALNHASIIDGVRLCK------------AKRYRYAN  155 (395)
T ss_pred             HHHHCCCCEEEECCHHHHHHHHHHHH---------CCCCCEEEEECCCCHHHHHHHHHCC------------CCEEEECC
T ss_conf             99869994999755277678899996---------4799889984563588999998658------------94799668


Q ss_pred             HHHHHHHHHCCC------CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCC-C-CCCCCCCCCCCCCC
Q ss_conf             026887541012------332222333222211246210123221102234572131011003-4-44455531011124
Q gi|254780432|r  164 CDLQSLKNQISN------DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQT-G-YGRTGKLFAYEWAN  235 (392)
Q Consensus       164 ~d~~~l~~~~~~------~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~t-G-~GRtG~~f~~e~~g  235 (392)
                      ||+++|++.+..      +---|++|.|.++.|.+.|    |+++.++|++||++|++||--. | +|.+|+=. .+++|
T Consensus       156 nD~~~Le~~L~~~~~~~~~~~~ivtegVfSMdGDiap----L~~l~~L~~~y~a~L~vDeAH~~GvlG~~G~G~-~e~~g  230 (395)
T PRK06939        156 NDMADLEAQLKEAKEAGARHKLIATDGVFSMDGDIAN----LPEICDLADKYDALVMVDDSHAVGFLGENGRGT-VEHCG  230 (395)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCC----HHHHHHHHHHHCEEEEEECCCCEEEECCCCCCH-HHHCC
T ss_conf             9999999999960021586289999667777876015----999999999727379861430000345899867-99809


Q ss_pred             CC--CCEE--ECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHC
Q ss_conf             54--5302--1034444---443443210001112222233223--45321111001233455432012-2210112100
Q gi|254780432|r  236 VK--PDIM--TIAKGMG---GGFPIGACLATNEVAACMNQGSHG--STYGGNVLAMVLGEKVLNIIQSD-GFLENVINIA  305 (392)
Q Consensus       236 i~--PDi~--~~gK~l~---gG~P~sav~~~~~i~~~~~~~~~~--~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g  305 (392)
                      +.  .||+  +|||+++   |||    |.+++++.+.+.....+  +|.+-.|..+++++++|++++++ .+.++.+++.
T Consensus       231 l~~~vdi~~gTlsKA~~G~~Ggf----v~g~~~~i~~l~~~~r~~ifStalpp~~~aa~~~al~~~~~~~~~r~~L~~n~  306 (395)
T PRK06939        231 VMDRVDIITGTLGKALGGASGGY----TAGKKEVIDWLRQRSRPYLFSNSLAPAIVAASIKVLELLEESDELRDRLWENA  306 (395)
T ss_pred             CCCCCEEEECCCHHHHHCCCCCE----EECCHHHHHHHHHHCHHHHCCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHH
T ss_conf             99886899773276662476514----51667889999984712211579987999999999999874959999999999


Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEE-------ECCCCEEEECCCCCCCHHHH
Q ss_conf             00268899998867970755046400999872499--8999999996898996-------26898899558986889999
Q gi|254780432|r  306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTA-------PSSDNVVRILPPLTITAEEI  376 (392)
Q Consensus       306 ~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~-------~~~~~~irl~Ppl~it~~ei  376 (392)
                      ++|+++|+++--...+      +..-+..|-+..+  ...+.+.|+++|+++.       |.+...||++..-..|++||
T Consensus       307 ~~~r~~l~~~g~~~~~------s~spI~pi~iG~~~~a~~~~~~L~~~Gi~v~~ir~PtVp~g~~rlRi~lta~ht~~di  380 (395)
T PRK06939        307 RYFREGMTAAGFTLGP------GEHPIIPVMLGDAKLAQEFADRLLEEGVYVIGFSFPVVPKGQARIRTQMSAAHTKEQL  380 (395)
T ss_pred             HHHHHHHHHCCCCCCC------CCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEEECCCCCHHHH
T ss_conf             9999999967998689------9999799996999999999999997797482078998898985699887877999999


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999985
Q gi|254780432|r  377 HEGLERIERTAIKL  390 (392)
Q Consensus       377 d~~i~~l~~al~~L  390 (392)
                      |++++.|+++-+|+
T Consensus       381 d~lv~~l~~v~~~l  394 (395)
T PRK06939        381 DRAIDAFEKVGKEL  394 (395)
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             99999999999963


No 89 
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed
Probab=99.97  E-value=2.4e-29  Score=212.31  Aligned_cols=340  Identities=20%  Similarity=0.226  Sum_probs=239.8

Q ss_pred             CCCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCC--CC---CCCHHHHHHHHHHHH
Q ss_conf             8887489850103799679976464102267435787-89999999999997314506--87---578189999986520
Q gi|254780432|r   12 DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVS--NL---YQSTQQEIFANHLIH   85 (392)
Q Consensus        12 ~~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~--~~---~~~~~~~~la~~L~~   85 (392)
                      ++.-..+++..|.+++ .||++||||.|.   .-||- +||++++|..+.+++.....  ..   ..++...+|+++|.+
T Consensus        20 ~r~~~~~~~~~g~~i~-i~gr~~lnFsSn---dYLGL~~hp~v~~a~~~a~~~yG~g~~~SRl~~G~~~~h~~LE~~lA~   95 (387)
T PRK05958         20 YRRLRPREGAQGRWLV-VDGRRMLNFASN---DYLGLANHPELIAAAQQAARRYGVGSGGSRLVTGNSPAHEALEAELAE   95 (387)
T ss_pred             CCCCCCCCCCCCCEEE-ECCEEEEEEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHCCCCHHHHHHHHHHHH
T ss_conf             8615544688888599-899799985665---424778999999999999998389886563230686999999999999


Q ss_pred             HCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             10133312356555403567776654320013478600234354656543212345532113479998643332221002
Q gi|254780432|r   86 STFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCD  165 (392)
Q Consensus        86 ~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d  165 (392)
                      ..+.+.+.+.+||..||-.++..-         .++..+|-.+.--|-.-.....+++            ..+...++||
T Consensus        96 ~~g~e~allf~SGy~An~~~i~al---------~~~~d~ii~D~~~HaSi~dG~~ls~------------a~~~~f~HnD  154 (387)
T PRK05958         96 WFGAERALLFSSGYAANLAVLTAL---------VGKGDLIVSDKLNHASLIDGARLSR------------AEVRRYPHND  154 (387)
T ss_pred             HHCCCCEEEECCCHHHHHHHHHHC---------CCCCCEEEEECCCCHHHHHHHHHCC------------CCEEEECCCC
T ss_conf             868996796455238666566532---------7899789971004698999887279------------9289968999


Q ss_pred             HHHHHHHCC---CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCC-CC-CCCCCCCCCCCCCCCCC--
Q ss_conf             688754101---233222233322221124621012322110223457213101100-34-44455531011124545--
Q gi|254780432|r  166 LQSLKNQIS---NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQ-TG-YGRTGKLFAYEWANVKP--  238 (392)
Q Consensus       166 ~~~l~~~~~---~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~-tG-~GRtG~~f~~e~~gi~P--  238 (392)
                      +++|++.+.   .+-..|++|.|.++.|.+.|    |+.+.++|++||+.|++||-- .| +|++|+=. .+++++.|  
T Consensus       155 ~~~Le~~L~~~~~~~~~iv~egvySMdGd~ap----L~~i~~L~~~y~~~L~vDeAH~~Gv~G~~G~G~-~e~~~~~~~v  229 (387)
T PRK05958        155 VDALEALLAKWRAGRALIVTESVFSMDGDLAP----LAELVALARRHGAWLLVDEAHGTGVLGPQGRGL-AEAAGLAGEI  229 (387)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCCCCC----HHHHHHHHHHCCEEEEECCHHHCCCCCCCCCCH-HHHHCCCCCC
T ss_conf             99999999738898759997466577887668----999999999708478842622226337999848-9984788886


Q ss_pred             CEE--ECCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHHHHHH
Q ss_conf             302--10344444434432100011122222332--2345321111001233455432012-221011210000268899
Q gi|254780432|r  239 DIM--TIAKGMGGGFPIGACLATNEVAACMNQGS--HGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILFEGLT  313 (392)
Q Consensus       239 Di~--~~gK~l~gG~P~sav~~~~~i~~~~~~~~--~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~~~L~  313 (392)
                      ||+  ++||++|+.  =|.|++++++.+.+....  +..|.+..|..+++++++|++++++ ...++.+++.++|++.|+
T Consensus       230 di~~gTlsKA~gs~--GG~i~g~~~~i~~l~~~a~~~ifStalpP~~~aa~~~al~~i~~~~~~~~~L~~n~~~~~~~l~  307 (387)
T PRK05958        230 VILVGTLGKALGSS--GAAVLGSETLIDYLINRARPFIFTTALPPAQAAAARAALRILREEPERRERLAALIARLRAGLR  307 (387)
T ss_pred             EEEECCCCCCCCCC--CEEEEECHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
T ss_conf             89976054445677--4399507899999987390203158887799999999999986095999999999999986457


Q ss_pred             HHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             998867970755046400999872499--899999999689899626-------89889955898688999999999999
Q gi|254780432|r  314 AIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLTAPS-------SDNVVRILPPLTITAEEIHEGLERIE  384 (392)
Q Consensus       314 ~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i~~l~  384 (392)
                      ++.-...+.      ..-+..+.+..+  ...+.+.|+++|+++.+.       +..+||+...-..|++|||++++.|.
T Consensus       308 ~~g~~~~~s------~spIipi~ig~~~~~~~~~~~L~~~Gi~v~~i~~PtVp~~~~rlRi~i~a~ht~~dId~l~~~l~  381 (387)
T PRK05958        308 ALGLGLPDS------ESAIQPLIVGDNERALALAAALQAQGFWVGAIRPPTVPAGTSRLRITLTAAHTEADIDRLLEALA  381 (387)
T ss_pred             HCCCCCCCC------CCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             539985899------99879999699999999999999779528317899889998449999787799999999999999


Q ss_pred             HHHHH
Q ss_conf             99998
Q gi|254780432|r  385 RTAIK  389 (392)
Q Consensus       385 ~al~~  389 (392)
                      +++.+
T Consensus       382 e~~~~  386 (387)
T PRK05958        382 EALAA  386 (387)
T ss_pred             HHHHH
T ss_conf             99950


No 90 
>TIGR00858 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR004723   8-amino-7-oxononanoate synthase (2.3.1.47 from EC) is involved in biotin biosynthesis.   Synonym(s): AONS, 8-amino-7-ketopelargonate synthase, 7-keto-8-amino-pelargonic acid synthetase, 7-KAP synthetase; GO: 0008710 8-amino-7-oxononanoate synthase activity, 0009102 biotin biosynthetic process.
Probab=99.96  E-value=3.2e-29  Score=211.49  Aligned_cols=337  Identities=18%  Similarity=0.202  Sum_probs=243.2

Q ss_pred             CCCEEEEEECCCEEEECCC--CEEEECHHHHHHHCCCC-CCHHHHHH-HHHHHHHCCCCCCC-----CCCHHHHHHHHHH
Q ss_conf             8874898501037996799--76464102267435787-89999999-99999731450687-----5781899999865
Q gi|254780432|r   13 QSDIRFEKGKGAWLFSENG--IPFLDFASGIAVNSLGH-SHPELVAI-LKSQSEKLWHVSNL-----YQSTQQEIFANHL   83 (392)
Q Consensus        13 ~~p~~i~~a~G~~i~d~dG--~~yiD~~~g~~~~~lGh-~~p~i~~a-~~~q~~~~~~~~~~-----~~~~~~~~la~~L   83 (392)
                      +.+..++++.+.++. .||  +++|||+|+   .-||= +||+|++| .++.+++....+..     ..++...+|+++|
T Consensus         3 R~l~~~~~~~~~~~~-~dgPP~~~l~FsSN---DYLGLa~hp~l~~af~~~~~~~~G~Gs~aSrLv~G~~~~H~~LE~~l   78 (378)
T TIGR00858         3 RQLRPLSRAPGPEVV-RDGPPRRLLNFSSN---DYLGLASHPELIQAFAQQAAEQYGAGSTASRLVTGNSPLHEELEEEL   78 (378)
T ss_pred             CCCCCCCCCCCCEEE-ECCCCHHHHHCCCC---CCHHHCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             565543468866788-76887146531364---40100379889999999999866877367434037856899999999


Q ss_pred             HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             20101333123565554035677766543200134786002343546565432123455321134799986433322210
Q gi|254780432|r   84 IHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKF  163 (392)
Q Consensus        84 ~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~  163 (392)
                      ++..+.+.+...+||.-||-..|----.   +.+-.+++.|++-+-+     .++|-...+...        ..+...++
T Consensus        79 A~~kg~EaALlFsSGY~AN~Gvi~aL~~---~~~l~~~DlilsD~LN-----HASl~dG~rLS~--------A~~~~y~H  142 (378)
T TIGR00858        79 AEFKGTEAALLFSSGYLANVGVISALVG---KRVLEKGDLILSDALN-----HASLIDGCRLSG--------ARVLRYRH  142 (378)
T ss_pred             HHHHCCCCEEEEHHHHHHHHHHHHHHHH---CCCCCCCCEEEEHHHH-----HHHHHHHHHCCC--------CCEEECCC
T ss_conf             9862882034200278999999998751---5765678604420254-----777898641598--------62787068


Q ss_pred             HHHHHHHHHCC-----CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCC-CCC-CCCCCC
Q ss_conf             02688754101-----23322223332222112462101232211022345721310110034444555-310-111245
Q gi|254780432|r  164 CDLQSLKNQIS-----NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGK-LFA-YEWANV  236 (392)
Q Consensus       164 ~d~~~l~~~~~-----~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~-~f~-~e~~gi  236 (392)
                      +|.++|++.+.     .+=+-|+.|.|+++.|++.|    |++|.++|++|+++|++|| .-|.|=.|. =.| .+++|+
T Consensus       143 ~D~~~L~~lL~~~~g~~~~~livTDGVFSMDGD~AP----L~~L~~la~~~~A~L~VDD-AHgtGVlG~~G~G~~~~fgl  217 (378)
T TIGR00858       143 NDVEHLERLLEKNRGKERRKLIVTDGVFSMDGDIAP----LPQLVALAERYGAWLMVDD-AHGTGVLGEDGRGTLEHFGL  217 (378)
T ss_pred             CCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCCC----HHHHHHHHHHCCCEEEEEC-CCCCCCCCCCCCHHHHHCCC
T ss_conf             998999999974015137768897001316888489----7899999987098899986-54536628875414976598


Q ss_pred             CC---CEE--ECCCCCCC--CCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCHHHHHHHHHHHH-CC-CCCCHHHHHC
Q ss_conf             45---302--10344444--434432100011122222--33223453211110012334554320-12-2210112100
Q gi|254780432|r  237 KP---DIM--TIAKGMGG--GFPIGACLATNEVAACMN--QGSHGSTYGGNVLAMVLGEKVLNIIQ-SD-GFLENVINIA  305 (392)
Q Consensus       237 ~P---Di~--~~gK~l~g--G~P~sav~~~~~i~~~~~--~~~~~~T~~gnpl~~aaa~a~L~~l~-~~-~l~~~~~~~g  305 (392)
                      .|   ||+  ||||+||+  ||    |++++.+.+.+-  ..++.+|.+-.|..|+|++++|++|+ ++ ...+++.++.
T Consensus       218 ~~~~~~i~~GTlSKAlGs~Ga~----V~g~~~l~~yL~n~AR~~If~TaLPPa~~aA~~aAl~~i~~~~~~rr~~L~~~~  293 (378)
T TIGR00858       218 KPAPVDIQVGTLSKALGSYGAY----VAGSEALIDYLINRARTFIFSTALPPAVVAAALAALELIQEEEPWRREKLLALI  293 (378)
T ss_pred             CCCCEEEEEEECCHHHHHCHHH----HHHHHHHHHHHHHCCCCCEECCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             8887269986131665405256----354589999998415764232366588999999999972224864789999999


Q ss_pred             CHHHHHHHHHH---HHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHCCEEE-------EECCCCEEEECCCCCCCH
Q ss_conf             00268899998---867970755046400999872499--899999999689899-------626898899558986889
Q gi|254780432|r  306 KILFEGLTAIK---NRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDECLLT-------APSSDNVVRILPPLTITA  373 (392)
Q Consensus       306 ~~l~~~L~~l~---~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~Gll~-------~~~~~~~irl~Ppl~it~  373 (392)
                      ++|+++++++.   -...+.-+.      ++-+=+-.+  .-.+.+.|+++|+++       .|.|..+||++-.-..|+
T Consensus       294 ~~~~~~l~~~~~~~f~~~~~~TP------I~P~~~G~~~~al~~a~~L~~~G~~v~AIRPPTVP~G~sRLR~Tl~A~Ht~  367 (378)
T TIGR00858       294 ARLRKGLEALGKLVFQLMPSETP------IVPVIIGDEESALALAEELQEQGIFVGAIRPPTVPKGTSRLRLTLSAAHTE  367 (378)
T ss_pred             HHHHHHHHHCCCCCCEECCCCCC------CEEEEECCCHHHHHHHHHHHHCCCEEECCCCCCCCCCCCEEEEEEEECCCH
T ss_conf             99999987547663101678986------258870892899999999987794791025888877961045577404898


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254780432|r  374 EEIHEGLERIE  384 (392)
Q Consensus       374 ~eid~~i~~l~  384 (392)
                      +|||.+++.|+
T Consensus       368 ~di~~L~~~l~  378 (378)
T TIGR00858       368 GDIDRLLEALK  378 (378)
T ss_pred             HHHHHHHHHCC
T ss_conf             89999999739


No 91 
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to serine palmitoyltransferase (SPT), 5-aminolevulinate synthase (ALAS), 8-amino-7-oxononanoate synthase (AONS), and 2-amino-3-ketobutyrate CoA ligase (KBL). SPT is responsible for the condensation of L-serine with palmitoyl-CoA to produce 3-ketodihydrospingosine, the reaction of the first step in sphingolipid biosynthesis. ALAS is involved in heme biosynthesis; it catalyzes the synthesis of 5-aminolevulinic acid from glycine and succinyl-coenzyme A. AONS catalyses the decarboxylative condensation of l-alanine and pimeloyl-CoA in the first committed step of biotin biosynthesis. KBL catalyzes the second reaction step of the metabolic degradation pathway for threonine converting 2-amino-3-ketobutyrate, to glycine and acetyl-CoA. The members of this CD are widely found in all three forms of life.
Probab=99.96  E-value=7.2e-28  Score=202.68  Aligned_cols=317  Identities=19%  Similarity=0.237  Sum_probs=219.4

Q ss_pred             CEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCC--C-CC--CCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHH
Q ss_conf             76464102267435787-89999999999997314506--8-75--7818999998652010133312356555403567
Q gi|254780432|r   32 IPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVS--N-LY--QSTQQEIFANHLIHSTFADRVFFTNSGAESVECA  105 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~--~-~~--~~~~~~~la~~L~~~~~~~~v~f~~SGseA~e~A  105 (392)
                      |+||||.|   +.-||- .||++++|+.+++++.....  . .+  .++...+|+++|.+..+.+.+.+.+||..||-++
T Consensus         1 r~~l~f~s---~dYLgL~~~p~~~~a~~~a~~~~G~g~~~sr~~~G~~~~~~~lE~~la~~~g~e~al~~~sG~~an~~~   77 (349)
T cd06454           1 KKVLNFCS---NDYLGLANHPEVIEAAKEALDKYGVGAGGSRLISGTSDLHEELEEELAEFHGKEAALVFSSGYAANDGV   77 (349)
T ss_pred             CCEEEEEC---CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHH
T ss_conf             95899766---632478989999999999999739988876736478799999999999986998199955707877888


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC-----CCCCC
Q ss_conf             7766543200134786002343546565432123455321134799986433322210026887541012-----33222
Q gi|254780432|r  106 IKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-----DTAAI  180 (392)
Q Consensus       106 iklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~-----~iAav  180 (392)
                      +..-         .++..+|..+..-|..-...+.+++            ..+...++||+++|++.+..     .-..|
T Consensus        78 i~~l---------~~~~d~i~~D~~~H~si~~G~~~s~------------a~~~~f~Hnd~~~L~~~l~~~~~~~~~~~i  136 (349)
T cd06454          78 LSTL---------AGKGDLIISDSLNHASIIDGIRLSG------------AKKRIFKHNDMEDLEKLLREARRPYGKKLI  136 (349)
T ss_pred             HHHC---------CCCCCEEEECCCCCHHHHHHHHCCC------------CCEEEECCCCHHHHHHHHHHHHCCCCCEEE
T ss_conf             8620---------5789779741534372886365244------------647997899999999999853225897699


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCC--CCCCCCCCCCCCCCCC--CCCEE--ECCCCCCCCCCCC
Q ss_conf             2333222211246210123221102234572131011003--4444555310111245--45302--1034444443443
Q gi|254780432|r  181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQT--GYGRTGKLFAYEWANV--KPDIM--TIAKGMGGGFPIG  254 (392)
Q Consensus       181 i~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~t--G~GRtG~~f~~e~~gi--~PDi~--~~gK~l~gG~P~s  254 (392)
                      ++|.|.++.|.+.|    |+.+.++|++||+.||+||...  -+|++|.-. .++++.  .+||+  ++||++|+  .-|
T Consensus       137 v~egv~Sm~Gd~ap----L~~l~~l~~~~~~~livDeAH~~Gv~G~~G~G~-~~~~~~~~~~di~~~tlsKa~G~--~Gg  209 (349)
T cd06454         137 VTEGVYSMDGDIAP----LPELVDLAKKYGAILFVDEAHSVGVYGPHGRGV-EEFGGLTDDVDIIMGTLGKAFGA--VGG  209 (349)
T ss_pred             EECCCCCCCCCCCC----HHHHHHHHHHHCCEEEEECHHHCCCCCCCCCCH-HHHCCCCCCCEEEECCCCCCCCC--CCC
T ss_conf             96576788877679----899999999829789972323317415888767-88658988667998536543467--771


Q ss_pred             CCCCCCCCCCCCCCC--CCCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCC-E
Q ss_conf             210001112222233--22345321111001233455432012-2210112100002688999988679707550464-0
Q gi|254780432|r  255 ACLATNEVAACMNQG--SHGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQ-G  330 (392)
Q Consensus       255 av~~~~~i~~~~~~~--~~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~-G  330 (392)
                      .+++++++.+.+...  .+..|.+.+|..++++.++|++++++ +..++.+++.++|+++|+++-  + +    +.+. .
T Consensus       210 ~v~g~~~~i~~l~~~~~~~i~s~~l~p~~~aa~~~al~~l~~~~~~~~~L~~~~~~~~~~l~~~g--~-~----i~~~~~  282 (349)
T cd06454         210 YIAGSKELIDYLRSYARGFIFSTSLPPAVAAAALAALEVLQGGPERRERLQENVRYLRRGLKELG--F-P----VGGSPS  282 (349)
T ss_pred             EEECCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCC--C-C----CCCCCC
T ss_conf             24253568999986198857777768999999999999986395889999999999999999769--9-7----579999


Q ss_pred             -EEEEE--EECCCHHHHHHHHHHCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             -09998--72499899999999689899626-------8988995589868899999999999999
Q gi|254780432|r  331 -LLIGL--KTVFSPALLAAKFRDECLLTAPS-------SDNVVRILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       331 -l~~~i--e~~~~~~~~~~~l~~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i~~l~~a  386 (392)
                       ....+  +.......+.+.|+++|+++.+.       +...||+..+...|++|||++++.|+++
T Consensus       283 ~~i~~~~~~~~~~a~~~~~~L~~~Gi~v~~~~~Ptvp~~~~~lRi~~sa~ht~edId~li~~l~ev  348 (349)
T cd06454         283 HIIPPLIGDDPAKAVAFSDALLERGIYVQAIRYPTVPRGTARLRISLSAAHTKEDIDRLLEALKEV  348 (349)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             727999869999999999999887962863798978999835999868779999999999999974


No 92 
>PRK13392 5-aminolevulinate synthase; Provisional
Probab=99.96  E-value=1.3e-27  Score=201.08  Aligned_cols=344  Identities=17%  Similarity=0.197  Sum_probs=234.7

Q ss_pred             CCCCCEEEEEECCCEEEE-----CCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCC---CC--CCCHHHHHH
Q ss_conf             888874898501037996-----79976464102267435787-89999999999997314506---87--578189999
Q gi|254780432|r   11 YDQSDIRFEKGKGAWLFS-----ENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVS---NL--YQSTQQEIF   79 (392)
Q Consensus        11 ~~~~p~~i~~a~G~~i~d-----~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~---~~--~~~~~~~~l   79 (392)
                      .++..-.+++..|.+++.     .+|+++|+|.|+   .-||- +||+|++|+++++++.....   ..  ..++...+|
T Consensus        20 lyr~~~~~~~~~~~~~~~~~~~~~~g~~~l~f~SN---dYLGLs~~p~v~~a~~~a~~~yG~gs~gSrl~~G~~~~h~~L   96 (410)
T PRK13392         20 RYRVFADLEREAGSFPRAIDHGPETGKRVTIWCSN---DYLGMGQHPDVIGAMVDALDRYGAGAGGTRNISGTSHEHVLL   96 (410)
T ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCEEEEEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH
T ss_conf             98767403546788755420257899389897756---665778999999999999998099987758562787999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98652010133312356555403567776654320013478600234354656543212345532113479998643332
Q gi|254780432|r   80 ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFD  159 (392)
Q Consensus        80 a~~L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~  159 (392)
                      +++|.+..+.+.+.+.+||..||-.++..-      .++.... +|-.+.--|-.-...+.+++            ..+.
T Consensus        97 E~~LA~f~g~e~allf~SGy~AN~g~i~aL------~~~~~~d-~i~~D~l~HaSiidG~rlS~------------a~~~  157 (410)
T PRK13392         97 ERELADLHGKQSALLFTSGYVSNDAALSTL------ARLLPNC-LILSDALNHASMIEGIRRSG------------AEKQ  157 (410)
T ss_pred             HHHHHHHHCCCCEEEECCHHHHHHHHHHHH------HCCCCCC-EEEECCCCCHHHHHHHHHCC------------CCEE
T ss_conf             999999869992999766478889999998------2779997-99987312288998787558------------9589


Q ss_pred             CCCCHHHHHHHHHCC----CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCC-C-CCCCCCCCCCCC
Q ss_conf             221002688754101----2332222333222211246210123221102234572131011003-4-444555310111
Q gi|254780432|r  160 QAKFCDLQSLKNQIS----NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQT-G-YGRTGKLFAYEW  233 (392)
Q Consensus       160 ~~~~~d~~~l~~~~~----~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~t-G-~GRtG~~f~~e~  233 (392)
                      ..++||+++|++.+.    ++.--|++|.|.++.|.+.|    |+.+.++|++||+.|++||--. | +|.+|.= ..++
T Consensus       158 ~f~HnD~~~Le~~L~~~~~~~~~~IvtEgVfSMdGd~ap----L~~l~~L~~~y~a~L~VDeAH~~GvlG~~GrG-~~e~  232 (410)
T PRK13392        158 VWAHNDLADLERQLASVDPDRPKLICFESCYSMDGDFAP----MAAICDLAEKYNAFTYVDEVHAVGLYGPRGGG-IAER  232 (410)
T ss_pred             EECCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCC----HHHHHHHHHHHCCEEEEECCCCCCCCCCCCCC-HHHH
T ss_conf             971899899999997566678559997253124788689----99999999984959996131002413589987-7997


Q ss_pred             CCCC--CCEE--ECCCCCCC--CCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCHHHHHHHHHHHHCCC-CCCHHHHH
Q ss_conf             2454--5302--10344444--43443210001112222233223--453211110012334554320122-21011210
Q gi|254780432|r  234 ANVK--PDIM--TIAKGMGG--GFPIGACLATNEVAACMNQGSHG--STYGGNVLAMVLGEKVLNIIQSDG-FLENVINI  304 (392)
Q Consensus       234 ~gi~--PDi~--~~gK~l~g--G~P~sav~~~~~i~~~~~~~~~~--~T~~gnpl~~aaa~a~L~~l~~~~-l~~~~~~~  304 (392)
                      +|+.  +||+  ||||++|+  ||    |++++++.+.+.....+  +|-+-.|..+++++++|++++++. ..++..++
T Consensus       233 ~g~~~~vdi~~gTlsKA~Gs~Ggf----v~gs~~~id~l~~~ar~~IfStalpP~~~aa~~~al~~l~~~~~~r~~L~~~  308 (410)
T PRK13392        233 DGLMDRIDMFQGTLSKAFGCLGGY----IAASADLVDFVRSFAPGFIFTTALPPPVVAGARAALRHLKTSQWERDAHQDR  308 (410)
T ss_pred             CCCCCCCEEEECCCCCCCCCCCEE----EECCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHH
T ss_conf             289876679985065412367603----4237377899987387543666789999999999999987195889999999


Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH--HHHHHHH-HHCCEEEE-------ECCCCEEEECCCCCCCHH
Q ss_conf             0002688999988679707550464009998724998--9999999-96898996-------268988995589868899
Q gi|254780432|r  305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP--ALLAAKF-RDECLLTA-------PSSDNVVRILPPLTITAE  374 (392)
Q Consensus       305 g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~--~~~~~~l-~~~Gll~~-------~~~~~~irl~Ppl~it~~  374 (392)
                      .++|+++|+++.  ++ +.   .+..-++-+-+..+.  ..+.+++ .++|+++.       |.+..+||++..-..|++
T Consensus       309 ~~~lr~~l~~~g--~~-~~---~s~s~Iipi~ig~~~~a~~~~~~ll~e~Gi~v~~i~~PtVP~g~~rLRi~lsA~Ht~~  382 (410)
T PRK13392        309 TASLKAKLNANG--IP-VL---PSPSHIVPVMVGDPEKCKAISDLLMAEHGIYIQPINYPTVPRGTERLRITPSPLHTDE  382 (410)
T ss_pred             HHHHHHHHHHCC--CC-CC---CCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCEEEEEECCCCCHH
T ss_conf             999999998679--98-48---9999879999799999999999998759989986788837999744987758668999


Q ss_pred             HHHHHHHHHHHHHHHHC
Q ss_conf             99999999999999852
Q gi|254780432|r  375 EIHEGLERIERTAIKLS  391 (392)
Q Consensus       375 eid~~i~~l~~al~~L~  391 (392)
                      |||++++.|.++.+|+.
T Consensus       383 dId~l~~~L~~v~~e~g  399 (410)
T PRK13392        383 DIDALVAALVAIWRELA  399 (410)
T ss_pred             HHHHHHHHHHHHHHHCC
T ss_conf             99999999999999809


No 93 
>PRK07505 hypothetical protein; Provisional
Probab=99.95  E-value=2.1e-26  Score=193.15  Aligned_cols=342  Identities=16%  Similarity=0.149  Sum_probs=224.8

Q ss_pred             EEEEEECCCEEEECCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCC---CC--CCCCHHHHHHHHHHHHHCCC
Q ss_conf             489850103799679976464102267435787-8999999999999731450---68--75781899999865201013
Q gi|254780432|r   16 IRFEKGKGAWLFSENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHV---SN--LYQSTQQEIFANHLIHSTFA   89 (392)
Q Consensus        16 ~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~---~~--~~~~~~~~~la~~L~~~~~~   89 (392)
                      .++++.+|..++..||+++|||.|+   .-||- +||+|++|..+++++....   ..  ...++...+|+++|.+..+.
T Consensus        33 ~~~~~~~~~~~~~~dGr~~lnF~Sn---dYLGL~~hp~v~~aa~~a~~~yG~g~~~s~~~~g~~~~h~~LE~~LA~~~g~  109 (405)
T PRK07505         33 LIVKKSEGKVITLTDGKEFVNFVSC---SYLGLDNHPAIIDGAVDALRRTGVLDLSSSRTRVQSQILKDLEESLSELFGA  109 (405)
T ss_pred             EEEECCCCCEEEEECCCEEEEEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             8995388885981389789750435---5358889999999999999986889876486414839999999999987398


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             331235655540356777665432001347860023435465654321234-5532113479998643332221002688
Q gi|254780432|r   90 DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATIS-AGGKLQYLEGFGPKIEGFDQAKFCDLQS  168 (392)
Q Consensus        90 ~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s-~s~~~~~~~~~~p~~~~~~~~~~~d~~~  168 (392)
                      + +.+.+||..||-..+-..-.-   .-..++..+|.++.--|-.    +. +.+.  ..     ....+...++||+++
T Consensus       110 e-al~f~sg~~An~g~i~~Lasg---~~~~~~~~~ii~D~~~HaS----l~~~~g~--~~-----s~a~~~~f~HnD~~~  174 (405)
T PRK07505        110 S-VLTFTSCSAAHLGILPLLASG---HLTGGKPPHMVFDKYAHAS----LAILKGI--CA-----DETEVETIDHNDLDA  174 (405)
T ss_pred             C-EEEECCHHHHHHHHHHHHHHC---CCCCCCCCEEEEECCCCCC----HHHHHHH--HC-----CCCCEEEECCCCHHH
T ss_conf             7-798732689999999999722---2248998789998764378----4556677--54-----899689867999999


Q ss_pred             HHHHCCC-CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCC-C-CCCCCCCCCCCCCCCCC---CEE-
Q ss_conf             7541012-332222333222211246210123221102234572131011003-4-44455531011124545---302-
Q gi|254780432|r  169 LKNQISN-DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQT-G-YGRTGKLFAYEWANVKP---DIM-  241 (392)
Q Consensus       169 l~~~~~~-~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~t-G-~GRtG~~f~~e~~gi~P---Di~-  241 (392)
                      |++.... +-..+++|.|.++ |.+.|    |+.+.++|++||++|++||--. | +|.+|+=+..++++..+   ||+ 
T Consensus       175 Le~~~~~~~~~~iV~EgVfSM-GdiAp----L~~l~~L~~~y~a~L~vDEAH~~Gv~G~~GrG~~~~~~~~~~~~~~i~~  249 (405)
T PRK07505        175 LEDICKTNKRVAYVADGVYSM-GGIAP----VKELVDLQDKYGLFVYIDDAHGLSIYGKNGEGYVRSELDYRLNERTIIA  249 (405)
T ss_pred             HHHHHHHCCCCEEEEEEEECC-CCHHH----HHHHHHHHHHCCEEEEEECCCEECCCCCCCCCCHHHHHCCCCCCEEEEE
T ss_conf             999874569948999842558-98345----9999999875676999965210012059997231687578888417998


Q ss_pred             -ECCCCCCC--CCCCCCCC-CCCCCCCCCCCC--CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHH
Q ss_conf             -10344444--43443210-001112222233--2234532111100123345543201222101121000026889999
Q gi|254780432|r  242 -TIAKGMGG--GFPIGACL-ATNEVAACMNQG--SHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAI  315 (392)
Q Consensus       242 -~~gK~l~g--G~P~sav~-~~~~i~~~~~~~--~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l  315 (392)
                       +|||++|+  ||    |+ +++++.+.+...  .+..|.+-+|..++++++.+++++.++..++.+++    .+..+-+
T Consensus       250 gTlsKA~Gs~GG~----V~~g~~~~~~~l~~~ar~~ifStal~p~~~aa~~as~~i~~~~e~~~~~~~L----~~ni~~~  321 (405)
T PRK07505        250 TSLGKAFGASGGV----IMLGYAEQIRLILRYAGPYAFSQPLNVAALGAISASAEIHLSSELDQLQQKL----HNNIALF  321 (405)
T ss_pred             EECCCHHCCCCEE----EEECCHHHHHHHHHHCCCHHCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHH----HHHHHHH
T ss_conf             0032100156159----9978599999999718411136644799999999999998575479999999----9999999


Q ss_pred             HHHCCCEEEEECCCE-EEEEEEECCC--HHHHHHHHHHCCEEEE-------ECCCCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             886797075504640-0999872499--8999999996898996-------26898899558986889999999999999
Q gi|254780432|r  316 KNRFPNMFLEVRGQG-LLIGLKTVFS--PALLAAKFRDECLLTA-------PSSDNVVRILPPLTITAEEIHEGLERIER  385 (392)
Q Consensus       316 ~~~~~~~v~~vRG~G-l~~~ie~~~~--~~~~~~~l~~~Gll~~-------~~~~~~irl~Ppl~it~~eid~~i~~l~~  385 (392)
                      .+..+.   +..+.. -+..+.+..+  ...+.+.|+++|+++.       |.+..+||++..-..|++|||++++.|++
T Consensus       322 ~~~l~~---~~~~s~~pI~~v~ig~~~~a~~~~~~L~e~Gi~v~~i~~PtVp~g~~rlRi~l~A~hT~edId~l~~~L~~  398 (405)
T PRK07505        322 DSLIPT---EQSGSFLPIRLIYIGDEDTAIKYAKQLKDAGFYTSPVFFPVVAKGNAGLRIMFRADHTNEEIKRLCSLLKE  398 (405)
T ss_pred             HHHCCC---CCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             974587---77899998799994999999999999997890187563883897982499874888999999999999999


Q ss_pred             HHHHHC
Q ss_conf             999852
Q gi|254780432|r  386 TAIKLS  391 (392)
Q Consensus       386 al~~L~  391 (392)
                      +++|..
T Consensus       399 v~~e~~  404 (405)
T PRK07505        399 ILADYN  404 (405)
T ss_pred             HHHHHC
T ss_conf             999855


No 94 
>PRK13393 5-aminolevulinate synthase; Provisional
Probab=99.95  E-value=1.9e-26  Score=193.37  Aligned_cols=342  Identities=15%  Similarity=0.143  Sum_probs=233.3

Q ss_pred             CCCCCEEEEEECCCEEEE-----CCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCCC---C--CCCHHHHHH
Q ss_conf             888874898501037996-----79976464102267435787-899999999999973145068---7--578189999
Q gi|254780432|r   11 YDQSDIRFEKGKGAWLFS-----ENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVSN---L--YQSTQQEIF   79 (392)
Q Consensus        11 ~~~~p~~i~~a~G~~i~d-----~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~~---~--~~~~~~~~l   79 (392)
                      .++.-..++|..|.+.+.     ..++++|+|.|+   .-||- +||+|++|..+++++......   .  ..++...+|
T Consensus        19 ~yr~~~~~~~~~~~~~~~~~~~~~g~r~~i~f~SN---dYLGL~~~p~v~~a~~~a~~~yG~gs~~Srl~~G~~~~h~~L   95 (404)
T PRK13393         19 RYRVFADLERQAGAFPRATHHGPDGPREVTVWCSN---DYLGMGQHPAVLAAMHEALDTCGAGAGGTRNISGTNHYHVLL   95 (404)
T ss_pred             CCCCCCCCCCCCCCCCEEEEECCCCCEEEEEEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHCCHHHHHHH
T ss_conf             98767422445789862487337897479987743---445767899999999999998689987660201887999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98652010133312356555403567776654320013478600234354656543212345532113479998643332
Q gi|254780432|r   80 ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFD  159 (392)
Q Consensus        80 a~~L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~  159 (392)
                      +++|.+..+.+.+.+.+||.-||-.++..-      .++.... +|-.+.--|-.-...+-+++            ..+.
T Consensus        96 E~~LA~~~g~e~allf~SGy~AN~g~i~aL------~~~~~~d-~i~~D~l~HaSi~dG~rls~------------a~~~  156 (404)
T PRK13393         96 EAELADLHGKEAALLFTSGYVSNWAALSTL------ASRLPGC-VILSDELNHASMIEGIRHSR------------AETR  156 (404)
T ss_pred             HHHHHHHHCCCCEEEECCHHHHHHHHHHHH------HCCCCCC-EEEEECCCCHHHHHHHHHCC------------CCEE
T ss_conf             999999869991999874488899999998------5789997-89998754598999888547------------9879


Q ss_pred             CCCCHHHHHHHHHCCC----CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCC---CCCCCCCCCC
Q ss_conf             2210026887541012----33222233322221124621012322110223457213101100344---4455531011
Q gi|254780432|r  160 QAKFCDLQSLKNQISN----DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGY---GRTGKLFAYE  232 (392)
Q Consensus       160 ~~~~~d~~~l~~~~~~----~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~---GRtG~~f~~e  232 (392)
                      ..++||+++|++.+..    ...-|++|.|.++.|++.|    |+.+.++|++||+.|++||- -||   |.+|.= ..+
T Consensus       157 ~f~HnD~~~Le~~L~~~~~~~~~lIv~egVfSMdGDiap----L~el~~L~~~y~a~L~VDeA-H~~Gv~G~~G~G-~~e  230 (404)
T PRK13393        157 IFRHNDPADLERKLSDLDPHAPKLVAFESVYSMDGDIAP----IAEICDVADKHGAMTYLDEV-HAVGLYGPRGGG-IAE  230 (404)
T ss_pred             EEECCCHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCC----HHHHHHHHHHCCCEEEEECC-CCCCCCCCCCCC-HHH
T ss_conf             982799999999998562248808999655355788568----99999999740949998443-200103689987-888


Q ss_pred             CCCC--CCCEE--ECCCCCCC--CCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCHHHHHHHHHHHHCCC-CCCHHHH
Q ss_conf             1245--45302--10344444--4344321000111222223322--3453211110012334554320122-2101121
Q gi|254780432|r  233 WANV--KPDIM--TIAKGMGG--GFPIGACLATNEVAACMNQGSH--GSTYGGNVLAMVLGEKVLNIIQSDG-FLENVIN  303 (392)
Q Consensus       233 ~~gi--~PDi~--~~gK~l~g--G~P~sav~~~~~i~~~~~~~~~--~~T~~gnpl~~aaa~a~L~~l~~~~-l~~~~~~  303 (392)
                      ++|+  ++||+  +|||++|+  ||    |++++++.+.+.....  ..|-+-.|..+++++++|++++++. ..++.++
T Consensus       231 ~~gl~~~vdi~~gTfsKA~Gs~Gg~----v~gs~~~id~L~~~ar~~IfStalpP~~~aa~~~al~~l~~~~~~r~~L~~  306 (404)
T PRK13393        231 RDGLADRLTIIEGTLAKAFGVVGGY----ITGSAALCDFIRSFASGFIFTTSLPPAVAAGALASIRHLKASSAERERHQD  306 (404)
T ss_pred             HCCCCCCCEEEEEECCCCCCCCCCE----EECCHHHHHHHHHHCHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             7389887628997177643357750----314768899999847286527798899999999999998619699999999


Q ss_pred             HCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHC-CEEEE-------ECCCCEEEECCCCCCCH
Q ss_conf             0000268899998867970755046400999872499--89999999968-98996-------26898899558986889
Q gi|254780432|r  304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDE-CLLTA-------PSSDNVVRILPPLTITA  373 (392)
Q Consensus       304 ~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~-Gll~~-------~~~~~~irl~Ppl~it~  373 (392)
                      +..+|+++|+++-  ++ +   .....-++-|....+  ...+.+.++++ |+++.       |.+..+||++..-..|+
T Consensus       307 n~~~~r~~L~~~G--~~-~---~~s~s~Iipi~ig~~~~a~~~~~~Ll~~~Gi~v~~i~~PtVP~g~~rLRi~lsA~ht~  380 (404)
T PRK13393        307 RVARLRARLDQAG--VP-H---MDNPSHIVPVMVGDAVLCKQISDLLLDRYGIYVQPINYPTVPRGTERLRITPSPLHTD  380 (404)
T ss_pred             HHHHHHHHHHHCC--CC-C---CCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEEEECCCCCH
T ss_conf             9999999999669--99-7---8999887999969999999999999861898999888985899973599876887999


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999985
Q gi|254780432|r  374 EEIHEGLERIERTAIKL  390 (392)
Q Consensus       374 ~eid~~i~~l~~al~~L  390 (392)
                      +|||++++.|+++.+++
T Consensus       381 ~did~l~~~L~~v~~~l  397 (404)
T PRK13393        381 ADIEHLVQALSEIWARL  397 (404)
T ss_pred             HHHHHHHHHHHHHHHHC
T ss_conf             99999999999999983


No 95 
>PRK09064 5-aminolevulinate synthase; Validated
Probab=99.95  E-value=1.9e-26  Score=193.36  Aligned_cols=337  Identities=16%  Similarity=0.174  Sum_probs=228.3

Q ss_pred             EEEEECC-----CEEEECCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCCC---C--CCCHHHHHHHHHHHH
Q ss_conf             8985010-----3799679976464102267435787-899999999999973145068---7--578189999986520
Q gi|254780432|r   17 RFEKGKG-----AWLFSENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVSN---L--YQSTQQEIFANHLIH   85 (392)
Q Consensus        17 ~i~~a~G-----~~i~d~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~~---~--~~~~~~~~la~~L~~   85 (392)
                      .+++..|     .|+....++++++|.|+   .-||- +||+|++|+.+++++......   +  ..++...+|+++|.+
T Consensus        25 ~~~~~~g~~~~~~~~~~~g~r~~~~FsSN---dYLGLs~~p~v~~a~~~a~~~~G~gs~gSrl~~G~~~~h~~LE~~LA~  101 (406)
T PRK09064         25 DLERQAGRFPYATWHGPDGAREVTVWCSN---DYLGMGQHPKVIEAMHEALDRCGAGAGGTRNISGTNHYHVELERELAD  101 (406)
T ss_pred             CCCCCCCCCCCCEEEECCCCEEEEEEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             02435578874257544798699984654---435777999999999999998489987777040587999999999999


Q ss_pred             HCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             10133312356555403567776654320013478600234354656543212345532113479998643332221002
Q gi|254780432|r   86 STFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCD  165 (392)
Q Consensus        86 ~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d  165 (392)
                      ..+.+.+...+||-.||-..+-..-      +......|++ +.--|-.-...+-+++-            .+...++||
T Consensus       102 ~~g~e~allf~SGy~AN~g~i~aL~------~~~p~~~i~~-D~l~HASiidG~rls~a------------~~~~f~HND  162 (406)
T PRK09064        102 LHGKEAALVFTSGYVSNDATLSTLA------KLIPGCVIFS-DELNHASMIEGIRRSGA------------EKHIFRHND  162 (406)
T ss_pred             HHCCCCEEEECCHHHHHHHHHHHHH------CCCCCCEEEE-ECCCCHHHHHHHHHCCC------------CEEEECCCC
T ss_conf             8588858997741788899999985------6799968998-14233248999875599------------589947999


Q ss_pred             HHHHHHHCCC----CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC---CCCCCCCCCCCCCC-
Q ss_conf             6887541012----332222333222211246210123221102234572131011003444---45553101112454-
Q gi|254780432|r  166 LQSLKNQISN----DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG---RTGKLFAYEWANVK-  237 (392)
Q Consensus       166 ~~~l~~~~~~----~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G---RtG~~f~~e~~gi~-  237 (392)
                      +++|++.+..    ..--|++|.|.++.|.+.|    |+.+.++|++||+.|++||- -|+|   .+|+= ..+++|+. 
T Consensus       163 ~~~Le~~L~~~~~~~~~iIvtEgVfSMdGDiap----L~~l~~l~~~y~a~L~VDeA-H~~Gv~G~~G~G-~~e~~g~~~  236 (406)
T PRK09064        163 VAHLEELLAAADPDRPKLIAFESVYSMDGDIAP----IAEICDLADKYNAMTYLDEV-HAVGMYGPRGGG-IAERDGLMD  236 (406)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCC----HHHHHHHHHHHCCEEEEECC-CCCCCCCCCCCC-HHHHCCCCC
T ss_conf             899999998377789709999700016787657----99999999860959999622-102203688877-398729866


Q ss_pred             -CCEE--ECCCCCCC--CCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHH
Q ss_conf             -5302--10344444--434432100011122222332--2345321111001233455432012-22101121000026
Q gi|254780432|r  238 -PDIM--TIAKGMGG--GFPIGACLATNEVAACMNQGS--HGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILF  309 (392)
Q Consensus       238 -PDi~--~~gK~l~g--G~P~sav~~~~~i~~~~~~~~--~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~  309 (392)
                       .|++  ||||++|+  ||    |++++++.+.+....  +.+|.+-.|..+++++++|++++++ ...++.+++.++|+
T Consensus       237 ~vdi~~gTfsKA~Gs~Ggf----v~gs~~~id~L~~~ar~~IfStalpp~~~aa~~~al~~l~~~~~~r~~L~~n~~~~r  312 (406)
T PRK09064        237 RIDIIEGTLAKAFGVMGGY----IAGSASLIDAVRSYAPGFIFTTSLPPAIAAAALASIRHLKESNEERERHQERAAKLK  312 (406)
T ss_pred             CCEEEEEECCCCCCCCCEE----ECCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             6707992166523577504----317889999998718530026789999999999999998709077899999999999


Q ss_pred             HHHHHHHHHCCCEEEEECCCEEEEEEEECCC--HHHHHHHHHHC-CEEEE-------ECCCCEEEECCCCCCCHHHHHHH
Q ss_conf             8899998867970755046400999872499--89999999968-98996-------26898899558986889999999
Q gi|254780432|r  310 EGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS--PALLAAKFRDE-CLLTA-------PSSDNVVRILPPLTITAEEIHEG  379 (392)
Q Consensus       310 ~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~--~~~~~~~l~~~-Gll~~-------~~~~~~irl~Ppl~it~~eid~~  379 (392)
                      ++|+++-  ++ +.   ....-++-+-+..+  ...+.+.++++ |+++.       |.+..+||++..-..|++|||++
T Consensus       313 ~~l~~~G--~~-~~---~s~spIipi~ig~~~~~~~~~~~Ll~~~Gi~v~~I~~PtVP~g~~rLRi~l~a~ht~edid~l  386 (406)
T PRK09064        313 ASLDAAG--IP-VM---PNPSHIVPVIVGDPEKCKKASDRLLEEHGIYVQPINYPTVPRGTERLRITPTPLHTDEMIDHL  386 (406)
T ss_pred             HHHHHCC--CC-CC---CCCCCEEEEEECCHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCEEEEEECCCCCHHHHHHH
T ss_conf             8677449--97-47---999987999959999999999999986898781088998899984699886866999999999


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999999852
Q gi|254780432|r  380 LERIERTAIKLS  391 (392)
Q Consensus       380 i~~l~~al~~L~  391 (392)
                      ++.|+++.+++-
T Consensus       387 ~~~L~ev~~~~g  398 (406)
T PRK09064        387 VEALVEVWARLG  398 (406)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999999809


No 96 
>PRK07179 hypothetical protein; Provisional
Probab=99.95  E-value=7.5e-27  Score=196.03  Aligned_cols=323  Identities=17%  Similarity=0.223  Sum_probs=226.3

Q ss_pred             CCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCC---CCC--CCHHHHHHHHHHHHHCCCCCCCCCCCCCCCH
Q ss_conf             79976464102267435787-89999999999997314506---875--7818999998652010133312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVS---NLY--QSTQQEIFANHLIHSTFADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~---~~~--~~~~~~~la~~L~~~~~~~~v~f~~SGseA~  102 (392)
                      .+|+++|+|.|+   .-||- +||+|++|..+++++.....   ..+  .+....+|+++|.+..+.+.+.+++||..||
T Consensus        51 ~~G~~~i~fsSN---dYLGLs~hp~v~~a~~~ai~~~G~g~~~Srl~~G~~~~h~~LE~~LA~~~g~e~allf~SGy~AN  127 (408)
T PRK07179         51 TPGPDAIILQSN---DYLNLSGHPDIIKAQIAALQEYGDGLVMSAVFLHDDSPKPQFEKKLAAFTGFESGLLCQSGWAAN  127 (408)
T ss_pred             CCCCCEEEEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHH
T ss_conf             899735685766---63478899999999999999849998746803167589999999999986899299987538999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCC-CCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123-32222
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND-TAAIL  181 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~-iAavi  181 (392)
                      -..+..-         .++..+|-.+.--|-.-...+.+++            ..+...++||+++|++.+... -.-|+
T Consensus       128 ~g~i~aL---------~~~~d~I~~D~~~HaSi~dG~rls~------------a~~~~f~HND~~~Le~~L~~~~~~iIv  186 (408)
T PRK07179        128 VGLLQTI---------ADPNTPVYIDFFAHMSLWEGVRAAG------------AQAHPFRHNDVDHLRRQIERHGPGIIV  186 (408)
T ss_pred             HHHHHHH---------CCCCCEEEEECCCCHHHHHHHHHCC------------CCEEEECCCCHHHHHHHHHHCCCCEEE
T ss_conf             9999996---------7999889998877888987676148------------857994799999999999846997799


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC---CCCCCCCCCCCCC--CCCEE--ECCCCCCC-CCCC
Q ss_conf             333222211246210123221102234572131011003444---4555310111245--45302--10344444-4344
Q gi|254780432|r  182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG---RTGKLFAYEWANV--KPDIM--TIAKGMGG-GFPI  253 (392)
Q Consensus       182 ~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G---RtG~~f~~e~~gi--~PDi~--~~gK~l~g-G~P~  253 (392)
                      +|.|.++.|.+.|    |+.+.++|++||++|++||-- |+|   .+|.= ..+++|+  .+||+  ++||++|+ |   
T Consensus       187 ~egVfSMdGDiap----L~~l~~la~~y~a~L~VDEAH-~~Gv~G~~G~G-~~~~~gl~~~vdi~~gTlsKA~G~~G---  257 (408)
T PRK07179        187 VDSVYSTTGTIAP----LVDIVDIAEEFGCVLVVDESH-SLGTHGPQGAG-LVAELGLTSRVHFITASLAKAFAGRA---  257 (408)
T ss_pred             EEECCCCCCCCCC----HHHHHHHHHHHCEEEEEECCC-EEEEECCCCCC-HHHHCCCCCCCEEEEEEHHHHHHHCC---
T ss_conf             9742357887668----999999998726798861435-05236799987-79984998787289937178676376---


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC--CCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEEC-CC
Q ss_conf             3210001112222233223453--21111001233455432012-22101121000026889999886797075504-64
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTY--GGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILFEGLTAIKNRFPNMFLEVR-GQ  329 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~--~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vR-G~  329 (392)
                      |.|++++++.+.+.....+..|  +..|..++++.++|++++++ +..++.+++.++|+++|+++--       ++. ..
T Consensus       258 Gfi~gs~~~id~L~~~ar~~IfStal~P~~~aa~~aal~ii~~~~~~r~~L~~n~~~~r~~L~~~G~-------~i~~s~  330 (408)
T PRK07179        258 GIITCPAELAEYFPFVSYPAIFSSTLLPHEIAGLEATLEVIESADERRARLHANARFLREGLSELGY-------NIRSSE  330 (408)
T ss_pred             CCEECCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCC-------CCCCCC
T ss_conf             6342379999999971877455666789999999999999862999999999999999999983799-------978999


Q ss_pred             EEEEEEEECCC--HHHHHHHHHHCCEEEE-------ECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             00999872499--8999999996898996-------26898899558986889999999999999999852
Q gi|254780432|r  330 GLLIGLKTVFS--PALLAAKFRDECLLTA-------PSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       330 Gl~~~ie~~~~--~~~~~~~l~~~Gll~~-------~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      .-+..+.+..+  ...+.+.|+++|+++.       |.+..+||++..-..|++|||+++++|+++-+++.
T Consensus       331 spIvpi~~G~~~~a~~~~~~L~~~Gi~v~~i~~PtVP~g~~rlRislsA~ht~~dId~ll~~l~~~~~e~~  401 (408)
T PRK07179        331 SQIIALETGSERNTEVLRDALEERNVFGAVFCAPATPKNRALIRLSLNADLTKSDLDRVLEVCREARDEVD  401 (408)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99799985999999999999997896284167998999981699874877999999999999999999809


No 97 
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase; InterPro: IPR010961   Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway . The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin .   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.   The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.   Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) .   This entry represents 5-aminoaevulinic acid (ALA) synthase (2.3.1.37 from EC), which catalyses the first stage of tetrapyrrole biosynthesis by the C4 pathway, namely the condensation of succinyl CoA and glycine. ALA synthase is a pyridoxal-phosphate-dependent enzyme. During catalysis, glycine initially binds to the enzyme cofactor, and after condensation with succinyl CoA, CoA, carbon dioxide and 5-aminolevulinic acid are produced .; GO: 0003870 5-aminolevulinate synthase activity, 0030170 pyridoxal phosphate binding, 0033014 tetrapyrrole biosynthetic process.
Probab=99.94  E-value=3.7e-26  Score=191.47  Aligned_cols=334  Identities=18%  Similarity=0.191  Sum_probs=224.0

Q ss_pred             EEEECCCE----EEECCC-CEEEECHHHHHHHCCCCC-CHHHHHHHHHHHHHCCCCC-----CCCCCHHHHHHHHHHHHH
Q ss_conf             98501037----996799-764641022674357878-9999999999997314506-----875781899999865201
Q gi|254780432|r   18 FEKGKGAW----LFSENG-IPFLDFASGIAVNSLGHS-HPELVAILKSQSEKLWHVS-----NLYQSTQQEIFANHLIHS   86 (392)
Q Consensus        18 i~~a~G~~----i~d~dG-~~yiD~~~g~~~~~lGh~-~p~i~~a~~~q~~~~~~~~-----~~~~~~~~~~la~~L~~~   86 (392)
                      ++|-+|.+    -.+.|| ++=+=.+|+  +=-||.+ ||+|++||++.+++..-..     -..++....+|+++|++.
T Consensus        26 l~R~ag~FP~A~~~~~~g~~~dVtVWCS--NDYLGMgqHp~Vl~Am~~~~~~~GaGaGGTRNIsGtn~~~v~LEaELAdL  103 (427)
T TIGR01821        26 LERLAGEFPFAQWHSPDGVKKDVTVWCS--NDYLGMGQHPKVLQAMHEALDKVGAGAGGTRNISGTNIYHVELEAELADL  103 (427)
T ss_pred             HHHHHCCCCCCEEECCCCCCEEEEEEEC--CCHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             3635178985134265778101788721--21320488654798899999963889987536566777899999999755


Q ss_pred             CCCCCCCCCCCCCCCHHHHHH-HHHHHHHCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             013331235655540356777-66543200134786002343546-5654321234553211347999864333222100
Q gi|254780432|r   87 TFADRVFFTNSGAESVECAIK-TARRYHYMAGKTNKFRIVTFEGA-FHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFC  164 (392)
Q Consensus        87 ~~~~~v~f~~SGseA~e~Aik-lar~~~~~~g~t~r~~ii~~~~~-yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~  164 (392)
                      .+.+-++..+||--||+++|- |+...      |+   ++-|+.+ =|    + .++-|-.+   .-.++    .-..+|
T Consensus       104 H~KE~ALvFtSgyVaNda~L~tL~k~~------P~---~~ifSD~LNH----A-SMI~GIr~---S~~~k----~iFrHN  162 (427)
T TIGR01821       104 HGKESALVFTSGYVANDATLATLAKII------PG---CVIFSDELNH----A-SMIEGIRR---SGAEK----FIFRHN  162 (427)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHC------CC---EEEEECCCCH----H-HHHHHHHH---CCCCE----EEEECC
T ss_conf             173113567788999999999999870------88---5898365563----5-69999874---78950----563059


Q ss_pred             HHHHHHHHCC-CCCC---CCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCC-CCCCCCCCCCC--CCCC---
Q ss_conf             2688754101-2332---22233322221124621012322110223457213101100-34444555310--1112---
Q gi|254780432|r  165 DLQSLKNQIS-NDTA---AILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQ-TGYGRTGKLFA--YEWA---  234 (392)
Q Consensus       165 d~~~l~~~~~-~~iA---avi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~-tG~GRtG~~f~--~e~~---  234 (392)
                      |+.+|++.+. .+++   -|-+|.|.++.|.+-|    ++++.++++|||+|.-+|||= .|+  .|.--|  .|+.   
T Consensus       163 D~~hLe~LL~~~d~~~PKiIAFESvYSMDGd~aP----i~eiCDlA~kYGALTy~DEVHAVGl--YGprGgGIaErddfe  236 (427)
T TIGR01821       163 DVAHLEKLLQSVDPNAPKIIAFESVYSMDGDIAP----IKEICDLADKYGALTYLDEVHAVGL--YGPRGGGIAERDDFE  236 (427)
T ss_pred             CHHHHHHHHHHCCCCCCCEEEEEEHCCCCCCCCC----HHHHHHHHHHHCCCCEECCEEEECC--CCCCCCCCCHHHHCC
T ss_conf             9789999986477998956886100016787266----7889668887188630011465336--588888512022110


Q ss_pred             -----C--------------C--CCCEE--ECCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCHHHHHH
Q ss_conf             -----4--------------5--45302--1034444--443443210001112222233223--453211110012334
Q gi|254780432|r  235 -----N--------------V--KPDIM--TIAKGMG--GGFPIGACLATNEVAACMNQGSHG--STYGGNVLAMVLGEK  287 (392)
Q Consensus       235 -----g--------------i--~PDi~--~~gK~l~--gG~P~sav~~~~~i~~~~~~~~~~--~T~~gnpl~~aaa~a  287 (392)
                           |              +  +=||+  ||||+.|  |||    |.++.+++|.+....-|  +|.+--|.-||+|++
T Consensus       237 shrasGiatPktndkGGakt~mhriDii~GTLaKAFG~~GGY----Ia~~~~L~D~~RS~ApGFIFTTsLPP~~~aGA~a  312 (427)
T TIGR01821       237 SHRASGIATPKTNDKGGAKTLMHRIDIIEGTLAKAFGVVGGY----IAASRKLIDAVRSYAPGFIFTTSLPPAIAAGALA  312 (427)
T ss_pred             HHCCCCCCCCCCCCCCCCEECCCCCCCCCCCCHHHCCCCCCE----EECCCCCEEEEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf             000157677765766652001110000016511223444530----2055221320000378421242155899999999


Q ss_pred             HHHHHHCC--C-CCCHHHHHCCHHHHHHHHHHH---HCCCEEEEECCCEEEEEEEECCCHHHHHHHHH-HCCEEE-----
Q ss_conf             55432012--2-210112100002688999988---67970755046400999872499899999999-689899-----
Q gi|254780432|r  288 VLNIIQSD--G-FLENVINIAKILFEGLTAIKN---RFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-DECLLT-----  355 (392)
Q Consensus       288 ~L~~l~~~--~-l~~~~~~~g~~l~~~L~~l~~---~~~~~v~~vRG~Gl~~~ie~~~~~~~~~~~l~-~~Gll~-----  355 (392)
                      ++++++++  . +..+=++.-+++++.|+++--   .+|+-|..|     ++|  ...-++.+...|+ +.||++     
T Consensus       313 sIRhLK~~eg~~lR~~hQ~~~~~lK~~L~~~GlPv~~~pSHIvPv-----~iG--dA~~~k~~SD~LL~~hGIYVQpINy  385 (427)
T TIGR01821       313 SIRHLKESEGQDLRRAHQERVKRLKKLLEALGLPVIDNPSHIVPV-----IIG--DAAKCKKVSDLLLNKHGIYVQPINY  385 (427)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEE-----EEC--CHHHHHHHHHHHHHHCCCEEECCCC
T ss_conf             999975137677899998999999999995777754887738876-----766--8688989989888717815712688


Q ss_pred             --EECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             --626898899558986889999999999999999852
Q gi|254780432|r  356 --APSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       356 --~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                        .|.|.+++||.|+=.-|+++||.++++|..+..+|.
T Consensus       386 PTVpRG~ERLRitPtP~H~~~~id~Lv~AL~~~w~~l~  423 (427)
T TIGR01821       386 PTVPRGTERLRITPTPVHTDKLIDDLVEALLLVWDRLG  423 (427)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             88988750244268889887789999999999988613


No 98 
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism]
Probab=99.93  E-value=5.2e-25  Score=184.00  Aligned_cols=330  Identities=18%  Similarity=0.195  Sum_probs=223.7

Q ss_pred             EEEEECCCEEEECCCCEEEECHHHHHHHCCCCC-CHHHHHHHHHHHHHCCCC--CC---CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             898501037996799764641022674357878-999999999999731450--68---757818999998652010133
Q gi|254780432|r   17 RFEKGKGAWLFSENGIPFLDFASGIAVNSLGHS-HPELVAILKSQSEKLWHV--SN---LYQSTQQEIFANHLIHSTFAD   90 (392)
Q Consensus        17 ~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~-~p~i~~a~~~q~~~~~~~--~~---~~~~~~~~~la~~L~~~~~~~   90 (392)
                      .+.+..+.+++ .+|++++||+|+   .-||-+ ||++++|+.+.+++....  ..   ...++...+|+++|++..+.+
T Consensus        25 ~~~~~~~~~~~-~~~~~~~nf~SN---dYLGLa~~~~~~~a~~~~~~~~g~g~~gsR~i~G~~~~h~~LE~~lA~f~g~e  100 (388)
T COG0156          25 ALDRRQGLAIR-ADGRKVLNFCSN---DYLGLASHPELIEAAKAAIRRYGVGAGGSRLISGTSDLHVELEEELADFLGAE  100 (388)
T ss_pred             HCCCCCCCCEE-CCCCEEEEEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             02445775332-178406764437---74352688789999999999819998976704478289999999999984998


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             31235655540356777665432001347860023435465654321234553211347999864333222100268875
Q gi|254780432|r   91 RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLK  170 (392)
Q Consensus        91 ~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~  170 (392)
                      .++..+||-.||.+.+-.-         .++..+|-.+.--|=.-.....+++            ..+....+||+++|+
T Consensus       101 ~al~f~SGy~AN~~~i~~l---------~~~~dli~~D~lnHASiidG~rls~------------a~~~~f~HnD~~~Le  159 (388)
T COG0156         101 AALLFSSGFVANLGLLSAL---------LKKGDLIFSDELNHASIIDGIRLSR------------AEVRRFKHNDLDHLE  159 (388)
T ss_pred             CEEEECCCCHHHHHHHHHH---------CCCCCEEEEECHHHHHHHHHHHHCC------------CCEEEECCCCHHHHH
T ss_conf             4899715311177788885---------6888689980102053998898578------------838982689999999


Q ss_pred             HHCCC------CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCC-CC-CCCCCCCCCCCCCCCCCC---
Q ss_conf             41012------33222233322221124621012322110223457213101100-34-444555310111245453---
Q gi|254780432|r  171 NQISN------DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQ-TG-YGRTGKLFAYEWANVKPD---  239 (392)
Q Consensus       171 ~~~~~------~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~-tG-~GRtG~~f~~e~~gi~PD---  239 (392)
                      +.+..      +-.-|++|.|.++.|++.|    |+.|.++|++|+++|++||.- +| +|.+|.= ..|++|+.|+   
T Consensus       160 ~~l~~~~~~~~~~~~IvtegVfSMdGdiAp----L~~l~~L~~ky~a~L~VDEAHa~Gv~G~~GrG-~~e~~g~~~~~vd  234 (388)
T COG0156         160 ALLEEARENGARRKLIVTEGVFSMDGDIAP----LPELVELAEKYGALLYVDEAHAVGVLGPNGRG-LAEHFGLEPEEVD  234 (388)
T ss_pred             HHHHHHHCCCCCCEEEEEECCCCCCCCCCC----HHHHHHHHHHHCCEEEEECCCCCCCCCCCCCC-HHHHHCCCCCCCE
T ss_conf             998762224787549998234218998577----89999999983958999852010243799861-7887388876514


Q ss_pred             EE--ECCCCCCC--CCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHCCHHHHHH
Q ss_conf             02--10344444--43443210001112222233--22345321111001233455432012-22101121000026889
Q gi|254780432|r  240 IM--TIAKGMGG--GFPIGACLATNEVAACMNQG--SHGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVINIAKILFEGL  312 (392)
Q Consensus       240 i~--~~gK~l~g--G~P~sav~~~~~i~~~~~~~--~~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~~~g~~l~~~L  312 (392)
                      |+  |+||+||+  ||    +.+++.+.+.+...  .+..|.+-.|..++++.++|+++++. +..++.+.+..+++..+
T Consensus       235 i~~gTlsKAlGs~Gg~----v~g~~~~~d~L~~~ar~~ifStalpP~~aaa~~~al~~l~~~~~~r~~L~~~~~~~~~~~  310 (388)
T COG0156         235 IIVGTLGKALGSSGGY----IAGSAALIDYLRNRARPFIFSTALPPAVAAAALAALRILEEGPERRERLQELAAFFRSLL  310 (388)
T ss_pred             EEEEECHHHHCCCCCE----EECCHHHHHHHHHHCCCEECCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHH
T ss_conf             9998750543226844----657599999999718652214778978899999999998758788999999999999888


Q ss_pred             HHHHHHCCCEEEEECCCEEEEEEEECC--CHHHHHHHHHHCCEEEE-------ECCCCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             999886797075504640099987249--98999999996898996-------268988995589868899999999999
Q gi|254780432|r  313 TAIKNRFPNMFLEVRGQGLLIGLKTVF--SPALLAAKFRDECLLTA-------PSSDNVVRILPPLTITAEEIHEGLERI  383 (392)
Q Consensus       313 ~~l~~~~~~~v~~vRG~Gl~~~ie~~~--~~~~~~~~l~~~Gll~~-------~~~~~~irl~Ppl~it~~eid~~i~~l  383 (392)
                      +...-...+..+      -+.-+.+..  ....+...++++|+++.       |.+..+||++|....|++||+.+++.|
T Consensus       311 ~~~~~~~~~s~s------~I~pv~~gd~~~a~~~s~~l~~~Gi~v~~i~~PTVp~gtarlRi~lta~ht~~~I~~l~~~l  384 (388)
T COG0156         311 KALGLVLLPSES------PIIPVILGDEERALEASRALLEEGIYVSAIRPPTVPKGTARLRITLTAAHTEEDIDRLAEAL  384 (388)
T ss_pred             HHCCCCCCCCCC------CEEEEEECCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             852976578889------86616968889999999999977925712368998999650898716779999999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780432|r  384 ERT  386 (392)
Q Consensus       384 ~~a  386 (392)
                      .+.
T Consensus       385 ~~~  387 (388)
T COG0156         385 SEV  387 (388)
T ss_pred             HHH
T ss_conf             852


No 99 
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative; InterPro: IPR010962    Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal). PLP is a versatile catalyst, acting as a coenzyme in a multitude of reactions, including decarboxylation, deamination and transamination , , . PLP-dependent enzymes are primarily involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and in the synthesis or catabolism of neurotransmitters; pyridoxal phosphate can also inhibit DNA polymerases and several steroid receptors . Inadequate levels of pyridoxal phosphate in the brain can cause neurological dysfunction, particularly epilepsy .   PLP enzymes exist in their resting state as a Schiff base, the aldehyde group of PLP forming a linkage with the epsilon-amino group of an active site lysine residue on the enzyme. The alpha-amino group of the substrate displaces the lysine epsilon-amino group, in the process forming a new aldimine with the substrate. This aldimine is the common central intermediate for all PLP-catalyzed reactions, enzymatic and non-enzymatic .   This entry contains a number of enzyme families:  Serine palmitoyltransferase Glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase) 5-aminolevulinic acid synthase 8-amino-7-oxononanoate synthase    All transfer the R-group (acetyl, succinyl, or 6-carboxyhexanoyl) from coenzyme A to an amino acid (Gly, Gly, Ala, respectively), with release of CO2 for the latter two reactions.; GO: 0016740 transferase activity, 0030170 pyridoxal phosphate binding.
Probab=99.92  E-value=9.9e-24  Score=175.62  Aligned_cols=333  Identities=17%  Similarity=0.243  Sum_probs=237.9

Q ss_pred             CCCEEEEEECCCEEEECCCCEEEECHHHHHHHCCCCC-CHHHHHHHHHHHHHCCCCCCC-----CCCHHHHHHHHHHHHH
Q ss_conf             8874898501037996799764641022674357878-999999999999731450687-----5781899999865201
Q gi|254780432|r   13 QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHS-HPELVAILKSQSEKLWHVSNL-----YQSTQQEIFANHLIHS   86 (392)
Q Consensus        13 ~~p~~i~~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~-~p~i~~a~~~q~~~~~~~~~~-----~~~~~~~~la~~L~~~   86 (392)
                      ..|-+++.+.|.++. .|||+||.++|   ++-||-. ||++++|.++++++..-....     .+-....+|+|+|++-
T Consensus        15 ~~i~~L~s~qGp~v~-vnG~~vinLsS---NNYLGlA~hp~Lk~aA~~a~~~yGvGAGAVRTIaGTl~lH~eLE~~LA~F   90 (392)
T TIGR01825        15 VEIRVLESAQGPEVK-VNGKKVINLSS---NNYLGLASHPRLKEAAKEAIQQYGVGAGAVRTIAGTLELHEELEEKLAKF   90 (392)
T ss_pred             CCCHHHCCCCCCEEE-ECCEEEEECCC---CCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             440532078888789-88857874043---55455468876899999999865962241210433778999999998755


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC--CCCCCCC
Q ss_conf             01333123565554035677766543200134786-0023435465654321234553211347999-864--3332221
Q gi|254780432|r   87 TFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK-FRIVTFEGAFHGRTLATISAGGKLQYLEGFG-PKI--EGFDQAK  162 (392)
Q Consensus        87 ~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r-~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~-p~~--~~~~~~~  162 (392)
                      -.-+-+....||-.+|-.||--..+       .+- --|||-                ..+|-+-.+ -++  ..-..+.
T Consensus        91 K~teAAl~fqSGF~~N~GvlSa~L~-------k~ddG~v~Sd----------------ELNHASIIDG~RLtkA~k~~y~  147 (392)
T TIGR01825        91 KKTEAALVFQSGFNTNQGVLSALLR-------KGDDGIVLSD----------------ELNHASIIDGLRLTKAKKKIYK  147 (392)
T ss_pred             CCCCEEEHHHCCHHHHHHHHHHHHC-------CCCCEEEEEC----------------CCCHHHHHHCCCCCCCCEEEEE
T ss_conf             3820110103122377999987623-------5887158720----------------0020345504223788568984


Q ss_pred             CHHHHHHHHHC----CC---CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-C-CCC
Q ss_conf             00268875410----12---332222333222211246210123221102234572131011003444455531-0-111
Q gi|254780432|r  163 FCDLQSLKNQI----SN---DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-A-YEW  233 (392)
Q Consensus       163 ~~d~~~l~~~~----~~---~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~-~e~  233 (392)
                      +-|.+.|++.+    ..   +---+|.+-|.++.|.+.|    |..|-|++++||++..+|+= -|-|=.|.-- | -+|
T Consensus       148 H~dm~DL~~~l~e~~~~Gqy~~~l~vTDGVFSMDGdvAp----Lp~iVE~Ae~Yda~~yVDDA-HGsGVlGe~GrGtV~H  222 (392)
T TIGR01825       148 HVDMDDLERVLRENVEEGQYKKKLIVTDGVFSMDGDVAP----LPEIVELAEKYDALVYVDDA-HGSGVLGEKGRGTVKH  222 (392)
T ss_pred             CCCHHHHHHHHHHCCCCCCCCCEEEEECCEEECCCCCCC----CCHHHHHHHHCCCEEEEECC-CCCCCCCCCCCCEEEC
T ss_conf             598458999997160337544368996650425678788----73233463245957998633-4664447788713530


Q ss_pred             CCCC-CC----EEECCCCCC--CCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCHHHHHHHHHHHHC-CCCCCHHH
Q ss_conf             2454-53----021034444--4434432100011122222332---234532111100123345543201-22210112
Q gi|254780432|r  234 ANVK-PD----IMTIAKGMG--GGFPIGACLATNEVAACMNQGS---HGSTYGGNVLAMVLGEKVLNIIQS-DGFLENVI  302 (392)
Q Consensus       234 ~gi~-PD----i~~~gK~l~--gG~P~sav~~~~~i~~~~~~~~---~~~T~~gnpl~~aaa~a~L~~l~~-~~l~~~~~  302 (392)
                      ||+. -+    |=|+||++|  |||    +++++++.|.+....   .+||-. +|-..+|..++++.+.+ +++.+|..
T Consensus       223 FGL~y~~v~~qvGTLSKA~GvvGGY----~AG~~~lidyL~~~aRPFLFSta~-~Pa~~~A~~~Av~~l~~~~~l~~kLW  297 (392)
T TIGR01825       223 FGLEYDKVDIQVGTLSKAIGVVGGY----VAGSKELIDYLKARARPFLFSTAL-PPAVVAALIEAVDVLQESPELMEKLW  297 (392)
T ss_pred             CCCCCCCEEEEECCHHHHHCCCCCC----CCCCHHHHHHHHHCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             3754164678855522322256642----348889999998628986012578-80789999999998707931477767


Q ss_pred             HHCCHHHHHHHHHH-----HHCCCEEEEECCCEEEEEEEECCCHHHHHHHHHHC-CEEE-------EECCCCEEEECCCC
Q ss_conf             10000268899998-----86797075504640099987249989999999968-9899-------62689889955898
Q gi|254780432|r  303 NIAKILFEGLTAIK-----NRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDE-CLLT-------APSSDNVVRILPPL  369 (392)
Q Consensus       303 ~~g~~l~~~L~~l~-----~~~~~~v~~vRG~Gl~~~ie~~~~~~~~~~~l~~~-Gll~-------~~~~~~~irl~Ppl  369 (392)
                      ...++|+++|.+|-     .++|  |..|     |++=|  ....++.++|+++ ||++       .|.+.-+||..|.-
T Consensus       298 ~Nt~ylk~~L~~LGydl~~S~tP--ItPv-----~~Gde--~~A~efS~rL~~~yGvFa~sivFPTVp~g~ARiR~~~tA  368 (392)
T TIGR01825       298 DNTRYLKAGLSKLGYDLGESETP--ITPV-----LIGDE--KVAQEFSRRLLDEYGVFAQSIVFPTVPRGTARIRNIPTA  368 (392)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCC--CCCE-----EECCC--HHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCH
T ss_conf             88999998767616411476686--1245-----87651--568999998777529089984216566988421246561


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             6889999999999999999852
Q gi|254780432|r  370 TITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       370 ~it~~eid~~i~~l~~al~~L~  391 (392)
                      -.|.++||+++++++++-+++.
T Consensus       369 ~HTkd~L~~al~aye~~Gk~l~  390 (392)
T TIGR01825       369 EHTKDDLDQALDAYEKVGKELG  390 (392)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHC
T ss_conf             3026679999999998678725


No 100
>PRK05937 8-amino-7-oxononanoate synthase; Provisional
Probab=99.91  E-value=2.9e-23  Score=172.53  Aligned_cols=318  Identities=16%  Similarity=0.172  Sum_probs=207.9

Q ss_pred             CCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCC---------C-CCC--CCCHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             9976464102267435787-899999999999973145---------0-687--57818999998652010133312356
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWH---------V-SNL--YQSTQQEIFANHLIHSTFADRVFFTN   96 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~---------~-~~~--~~~~~~~~la~~L~~~~~~~~v~f~~   96 (392)
                      .++.-|||.|+   .-||- +||++++|+.+++++...         . +..  ..+....+|+++|.+..+.+.+.+.+
T Consensus         2 ~~~~~lnFsSN---DYLGLs~~p~v~~a~~~a~~~y~~~~~~~g~Gs~gSrl~~G~~~~h~~LE~~lA~f~g~e~allf~   78 (370)
T PRK05937          2 KSSLSIDFVTN---DFLGFSRSTTLVHEVEKRYRLYCEQFPHAQLGYGGSRAILGPSSLLDDLEHKIAHFHGAPEAFIVP   78 (370)
T ss_pred             CCCEEEECCCC---CCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             97707824032---003878998999999999998731257898768687826278699999999999986999399987


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC-
Q ss_conf             5554035677766543200134786002343546565432123455321134799986433322210026887541012-
Q gi|254780432|r   97 SGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-  175 (392)
Q Consensus        97 SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~-  175 (392)
                      ||..||-..+...         .++..+|-.+.--|-.-...+.+++-            .+...++||+++|++.+.. 
T Consensus        79 sGy~AN~~~i~al---------~~~~d~i~~D~l~HaSi~dG~rls~a------------~~~~f~Hnd~~~Le~~L~~~  137 (370)
T PRK05937         79 SGYMANLGLCAHL---------SSVTDYVLWDEQVHISVVYSLSVISG------------KHQSFRHNDLDHLESLLESC  137 (370)
T ss_pred             CHHHHHHHHHHHC---------CCCCCEEEEECCCHHHHHHHHHHCCC------------CEEEECCCCHHHHHHHHHHH
T ss_conf             6688999999960---------89999899963061999999986499------------86996899989999999853


Q ss_pred             -----CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCC--C-EEECC
Q ss_conf             -----33222233322221124621012322110223457213101100344---4455531011124545--3-02103
Q gi|254780432|r  176 -----DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGY---GRTGKLFAYEWANVKP--D-IMTIA  244 (392)
Q Consensus       176 -----~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~---GRtG~~f~~e~~gi~P--D-i~~~g  244 (392)
                           +-.-|++|.|.++.|.+.|    |+.+.++|++|+.+||+||.- ||   |.+|+= ..+++|+..  + +.|+|
T Consensus       138 ~~~~~~~~~iv~egVfSMdGdiap----L~~l~~l~~~y~a~l~vDeAH-~~Gv~G~~GrG-~~e~~g~~~~~~i~~Tls  211 (370)
T PRK05937        138 RAVSFGRIFIFVCSVYSFKGTLAP----LEQIIALSKKYHAHLIVDEAH-AMGIFGDDGKG-FCHSLGYENFYAVLVTYS  211 (370)
T ss_pred             HHCCCCCEEEEEECCCCCCCCCCC----HHHHHHHHHHCCCEEEEECCH-HCCCCCCCCCC-HHHHCCCCCCCEEEEEHH
T ss_conf             311788559999405667787558----999999999819789973300-00433799975-788739988778981325


Q ss_pred             CCCCC-CCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCHHHHHHHHHHHHCCC-C-CCHHHHHCCHHHHHHHHHHHHC
Q ss_conf             44444-434432100011122222332--23453211110012334554320122-2-1011210000268899998867
Q gi|254780432|r  245 KGMGG-GFPIGACLATNEVAACMNQGS--HGSTYGGNVLAMVLGEKVLNIIQSDG-F-LENVINIAKILFEGLTAIKNRF  319 (392)
Q Consensus       245 K~l~g-G~P~sav~~~~~i~~~~~~~~--~~~T~~gnpl~~aaa~a~L~~l~~~~-l-~~~~~~~g~~l~~~L~~l~~~~  319 (392)
                      |++|+ |   +.+++++++.+.+....  +.+|-+-.|..++++.+.++++.++. . .++..++-++|++.+.   ...
T Consensus       212 KAlGs~G---gfv~~s~~~i~~l~~~ar~~IfStalpP~~~aa~~~al~~l~~e~~~~r~~l~~~~~~~~~~~~---~~~  285 (370)
T PRK05937        212 KALGSMG---AALLSSSEVKQDLMLNSPPLRYSTGLPPHALISIQVAYDFLSQEGELARKQLFRLKEYFAQKFS---SAA  285 (370)
T ss_pred             HHHHHCC---EEEECCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCC---CCC
T ss_conf             6621065---3898288999999983964003675589999999999999985959999999999999998506---678


Q ss_pred             CCEEEEECCCEEEEEEEECCCHHHHHHHHHHCCEEEEECC---CCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             9707550464009998724998999999996898996268---98899558986889999999999999999852
Q gi|254780432|r  320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSS---DNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       320 ~~~v~~vRG~Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~~---~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +..+..+     +  +. ......+.+.|+++|+++.+..   -..||+...-.-|++|||++++.|.++..+..
T Consensus       286 ~~~i~pI-----~--~~-~~~~~~~~~~L~~~Gi~v~~Ir~PtVPrLRi~l~A~HT~edId~Lv~~L~~~~~~~~  352 (370)
T PRK05937        286 PGCVQPI-----F--LP-DISEQELYSKLVETGIRVGVVCFPTKPFLRVNLHAFNTEDEVDILVSVLHSYLEKCQ  352 (370)
T ss_pred             CCCEEEE-----E--EC-CHHHHHHHHHHHHCCEEEEEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9974889-----8--08-389999999999789779868989988378861866699999999999999999986


No 101
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase; InterPro: IPR011282   This entry represents a narrowly defined clade of animal and bacterial (almost exclusively proteobacterial) 2-amino-3-ketobutyrate--CoA ligase. This enzyme can act in threonine catabolism. The closest homologue from Bacillus subtilis, and sequences like it, may be functionally equivalent but were not included in the model because of difficulty in finding reports of function.; GO: 0008890 glycine C-acetyltransferase activity.
Probab=99.91  E-value=3e-23  Score=172.48  Aligned_cols=332  Identities=19%  Similarity=0.251  Sum_probs=236.5

Q ss_pred             CCCEEEEEECCCEEEECCC--CEEEECHHHHHHHCCCCC-CHHHHHHHHHHHHHCCCCCC--C---CCCHHHHHHHHHHH
Q ss_conf             8874898501037996799--764641022674357878-99999999999973145068--7---57818999998652
Q gi|254780432|r   13 QSDIRFEKGKGAWLFSENG--IPFLDFASGIAVNSLGHS-HPELVAILKSQSEKLWHVSN--L---YQSTQQEIFANHLI   84 (392)
Q Consensus        13 ~~p~~i~~a~G~~i~d~dG--~~yiD~~~g~~~~~lGh~-~p~i~~a~~~q~~~~~~~~~--~---~~~~~~~~la~~L~   84 (392)
                      +.--+|.+.+++.|.-.||  ++.|.|+.+   +-||=+ ||+|++|.+++|++..+...  +   .+-....+|+++|.
T Consensus        19 K~ERiI~s~Q~a~irv~dGv~~~vlNfCAN---NYLGLs~HP~~I~AA~~Al~~~GfGlsSVRFICGTQd~HK~LE~~iA   95 (395)
T TIGR01822        19 KSERIITSPQGADIRVADGVSREVLNFCAN---NYLGLSDHPDVIQAAKDALDEHGFGLSSVRFICGTQDLHKELEAKIA   95 (395)
T ss_pred             EECCEEECCCCCCEEEECCCCCCHHHHHHH---CCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHH
T ss_conf             002067237987058855864231443100---00564675579999999887438951343212167435689999999


Q ss_pred             HHCCCC-CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC--CCC
Q ss_conf             010133-31235655540356777665432001347860023435465654321234553211347999-86433--322
Q gi|254780432|r   85 HSTFAD-RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFG-PKIEG--FDQ  160 (392)
Q Consensus        85 ~~~~~~-~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~-p~~~~--~~~  160 (392)
                      +-.+.+ -++| .|--+||----      -...  +..+-||                |+..+|-+-.+ -++..  --.
T Consensus        96 ~F~~~EDtILY-~scFDANgGlF------E~LL--g~eDAii----------------SDaLNHASIIDGvRLCKAkrYR  150 (395)
T TIGR01822        96 AFLGTEDTILY-ASCFDANGGLF------ETLL--GEEDAII----------------SDALNHASIIDGVRLCKAKRYR  150 (395)
T ss_pred             HHHCCCCHHHH-HHHHHCCCCCC------HHHC--CCCCCCH----------------HHHHCCCHHHHHHHHHHHHHHH
T ss_conf             97165304454-56663055422------0104--7544221----------------0222431023003542233432


Q ss_pred             CCCHHHHHHHHHCCC------CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC-CCCC-CCCCCCCCCC
Q ss_conf             210026887541012------3322223332222112462101232211022345721310110-0344-4455531011
Q gi|254780432|r  161 AKFCDLQSLKNQISN------DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV-QTGY-GRTGKLFAYE  232 (392)
Q Consensus       161 ~~~~d~~~l~~~~~~------~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV-~tG~-GRtG~~f~~e  232 (392)
                      ...+|++.|+..+.+      +.--|..+-|.++.|.+.+    |++++.||++||+|+.+||. .||| |-||+= ..|
T Consensus       151 Y~~~dm~dLe~~L~~A~~~Gar~~Li~tDGvFSMDG~iA~----L~~i~~LA~~Y~ALv~~DecHA~GflG~~GRG-~~E  225 (395)
T TIGR01822       151 YANNDMADLEAQLKEAQAAGARHRLIATDGVFSMDGTIAP----LDEICDLADKYDALVMVDECHATGFLGATGRG-TAE  225 (395)
T ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEEEECCEEECCCCEEC----HHHHHHHHHHCCCEEEEECCCCCCCCCCCCCC-HHH
T ss_conf             3058888999999999973895899864660206873107----67899999855987887443342332789986-142


Q ss_pred             CCCC--CCCEE--ECCCCCCC---CCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCHHHHHHHHHHHHCC-CCCCHHH
Q ss_conf             1245--45302--10344444---434432100011122222332--2345321111001233455432012-2210112
Q gi|254780432|r  233 WANV--KPDIM--TIAKGMGG---GFPIGACLATNEVAACMNQGS--HGSTYGGNVLAMVLGEKVLNIIQSD-GFLENVI  302 (392)
Q Consensus       233 ~~gi--~PDi~--~~gK~l~g---G~P~sav~~~~~i~~~~~~~~--~~~T~~gnpl~~aaa~a~L~~l~~~-~l~~~~~  302 (392)
                      ..|+  +=||+  |+||+|||   ||    +.+++||.+.+.+.+  |=...+-.|...+|+.++|++++.. +|.++..
T Consensus       226 ~~gv~g~vdI~tgTLGKAlGGA~GGf----Tta~~evv~lLRQRsRPYLFSNslpP~vvga~~~vl~~l~~s~~l~~~L~  301 (395)
T TIGR01822       226 LLGVMGRVDIITGTLGKALGGASGGF----TTARKEVVELLRQRSRPYLFSNSLPPAVVGASIKVLDMLEGSNELRDRLA  301 (395)
T ss_pred             HCCCCCCEEEEECCHHHHHCCCCCCC----CCCCHHHHHHHHHCCCCCCHHCCCCHHHHHHHHHHHHHHHCHHHHHHHHH
T ss_conf             13767525774054334511456764----37746799985312651100046306899999999999842057999999


Q ss_pred             HHCCHHHHHHHHHHHHCCCEEEEECCC-----EEEEEEEECCCHHHHHHHHHHCCEEEE-------ECCCCEEEECCCCC
Q ss_conf             100002688999988679707550464-----009998724998999999996898996-------26898899558986
Q gi|254780432|r  303 NIAKILFEGLTAIKNRFPNMFLEVRGQ-----GLLIGLKTVFSPALLAAKFRDECLLTA-------PSSDNVVRILPPLT  370 (392)
Q Consensus       303 ~~g~~l~~~L~~l~~~~~~~v~~vRG~-----Gl~~~ie~~~~~~~~~~~l~~~Gll~~-------~~~~~~irl~Ppl~  370 (392)
                      +.-++|+++|++.--       +|.+.     -.|++  ...-...+++.|+++||++.       |-|.-+||..-+-.
T Consensus       302 ~n~~~FR~~m~AaGF-------d~~p~~hpI~pvMly--DA~~Aq~~A~~Ll~~GiYv~GFfYPVVPKGqARIRvQ~SA~  372 (395)
T TIGR01822       302 ENTRYFRERMEAAGF-------DVKPAEHPIIPVMLY--DAKLAQRFAERLLEEGIYVIGFFYPVVPKGQARIRVQISAV  372 (395)
T ss_pred             HHHHHHHHHHHHCCC-------CCCCCCCCCEEEECC--CHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCEEEEEECCC
T ss_conf             999987875342474-------017898851023211--47899999999987792899745264378861244410256


Q ss_pred             CCHHHHHHHHHHHHHHHHHH
Q ss_conf             88999999999999999985
Q gi|254780432|r  371 ITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       371 it~~eid~~i~~l~~al~~L  390 (392)
                      .++++||+++++|.++=.+|
T Consensus       373 H~~e~l~~a~~AF~~~G~~l  392 (395)
T TIGR01822       373 HTEEQLDRAVEAFTRVGREL  392 (395)
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             89889999999999987862


No 102
>PRK06225 aspartate aminotransferase; Provisional
Probab=99.78  E-value=2.6e-17  Score=133.65  Aligned_cols=329  Identities=19%  Similarity=0.237  Sum_probs=204.2

Q ss_pred             EEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHH-HHHHHHHHHHHCCC--C-CCCCCCCCCCCHHHHHHH
Q ss_conf             6464102267435787899999999999973145068757818-99999865201013--3-312356555403567776
Q gi|254780432|r   33 PFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQ-QEIFANHLIHSTFA--D-RVFFTNSGAESVECAIKT  108 (392)
Q Consensus        33 ~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~-~~~la~~L~~~~~~--~-~v~f~~SGseA~e~Aikl  108 (392)
                      +.|++..|  -..+|= .|+|++|+.++++...+  +.|..+. ..+|-+.+++..+.  + .++.+++++||...+++.
T Consensus        23 diI~L~~~--e~~~~~-p~~v~~a~~~~~~~~~~--~~Y~~~~g~~~Lr~aia~~~~~~~~~ei~vt~G~~~~l~~~~~a   97 (375)
T PRK06225         23 ELIWLGQN--TNHLHP-HPEVRDAMIRAAKEGEY--NKYAPPEGFEELRELILADLGLDDDFDALVTAGATESLYLVIRA   97 (375)
T ss_pred             CEEECCCC--CCCCCC-CHHHHHHHHHHHCCCCC--CCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHH
T ss_conf             90689999--899885-79999999999648987--88799635899999999986889997499827889999999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCHHHHHHHHHCCCCCCCCCC-CCCC
Q ss_conf             65432001347860023435465654321234553211347999864-333222100268875410123322223-3322
Q gi|254780432|r  109 ARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKI-EGFDQAKFCDLQSLKNQISNDTAAILI-EPIQ  186 (392)
Q Consensus       109 ar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~-~~~~~~~~~d~~~l~~~~~~~iAavi~-Epv~  186 (392)
                      .-       .+| ..||..+.+|.+-...+.........    -|.. +...  ...|.+++++.+.+++..+++ -|= 
T Consensus        98 ~~-------~pG-D~vl~~~P~y~~y~~~~~~~g~~~~~----vpl~~~~~~--~~~d~d~l~~~i~~~tk~i~l~nPn-  162 (375)
T PRK06225         98 FL-------SPG-TNTVTSDPGYKIIDNFANRFGAEVIE----VPIYSEECD--YKLTPEALKENVDEETKLIVLIDPL-  162 (375)
T ss_pred             HC-------CCC-CEEEECCCCCHHHHHHHHHCCCEEEE----CCCCCCCCC--CCCCHHHHHHHCCCCCCEEEECCCC-
T ss_conf             77-------998-98998489833599999984990574----576685468--8789999996288888289982998-


Q ss_pred             CCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC--E--EECCCCCC-CCCCCCCCCCCCC
Q ss_conf             22112462101232211022345721310110034444555310111245453--0--21034444-4434432100011
Q gi|254780432|r  187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD--I--MTIAKGMG-GGFPIGACLATNE  261 (392)
Q Consensus       187 g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD--i--~~~gK~l~-gG~P~sav~~~~~  261 (392)
                      .--|. ..+++.++++.++|++|++++|.||+...|.. +......   ..||  |  -++||..+ .|+=+|.+++.++
T Consensus       163 NPTG~-v~s~~~l~~l~~~a~~~~i~ii~DE~Y~~f~~-~~~~~~~---~~~~~~iv~~S~SK~~~~~G~RiG~~i~~~~  237 (375)
T PRK06225        163 NPLGS-SYTREEIKEFAEIARDNDAYLVHDCTYRDFAR-EHTLAAE---YAPEGTVTIYSFSKIFGLAGLRIGAVVAAPD  237 (375)
T ss_pred             CCCCC-CCCHHHHHHHHHHHHHCCCCCCCHHHHHHCCC-CCCCHHH---HCCCCEEEECCCCHHCCCHHHHHHHHCCCHH
T ss_conf             99888-78899999999999862770000221332067-8872345---3778759982360513573440514107999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEE-CCCEEEEEEEECC-
Q ss_conf             12222233223453211110012334554320122210112100002688999988679707550-4640099987249-
Q gi|254780432|r  262 VAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEV-RGQGLLIGLKTVF-  339 (392)
Q Consensus       262 i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~v-RG~Gl~~~ie~~~-  339 (392)
                      +++.+.... .++++.|.++..+|.+.|+.  .+++.++.++.-..-++.+.+..++.+++...+ ...|.++-+++.. 
T Consensus       238 ~i~~l~~~~-~~~~~~~~~~q~aa~aal~~--~~~~~~~~~~~~~~~r~~~~~~l~~l~g~~~~~~p~~g~f~~~~~~~~  314 (375)
T PRK06225        238 LLEQVAKYV-VSDLGANVIAQEAAIAGLKV--KSEWIERIRREDFRNQALIKEAVDEIEGVFLPVYPSHANMLVIDTSEA  314 (375)
T ss_pred             HHHHHHHHH-CCCCCCCHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCEEEEEECCCC
T ss_conf             999999874-38788789999999999848--999999999999999999999985373885167079745999986688


Q ss_pred             --CHHHHHHHHHHCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             --9899999999689899626-------898899558986889999999999999999852
Q gi|254780432|r  340 --SPALLAAKFRDECLLTAPS-------SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       340 --~~~~~~~~l~~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                        ++..+.+.++++|+++.+.       |++.||++  +..++++|++++++|++++.+|-
T Consensus       315 g~~~~~~~~~l~e~gV~v~pG~~~~~~~g~~~iRis--~~~~~e~l~~a~~rl~~~l~~lr  373 (375)
T PRK06225        315 GIRPEDLVEYLLERKIFVRQGTYTSKRFGDRFIRVS--FSIPREWVERFCEEFPDVVATLR  373 (375)
T ss_pred             CCCHHHHHHHHHHCCEEEECCCCCCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHHH
T ss_conf             989999999999789099689867887899929999--70489999999999999999864


No 103
>PRK07212 consensus
Probab=99.77  E-value=6.9e-17  Score=130.87  Aligned_cols=330  Identities=17%  Similarity=0.202  Sum_probs=199.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731--450687578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~--~~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      .+|++.|++..|.-  .+. -.|.|++|+.+.++..  .++......+.+..+++.+.+..+    .+.++.++++++|.
T Consensus        28 ~~G~dvi~l~~g~p--df~-~p~~i~ea~~~~~~~~~~~Y~~~~G~~~lr~aia~~~~~~~g~~v~p~~I~vt~G~~~al  104 (378)
T PRK07212         28 AEGVDVISLSVGEP--DFD-TPKHICDAAIDAMDRGKTHYAPSNGIPELREAIAEKLRTENHIDVTPDDVIVTPGAKQAI  104 (378)
T ss_pred             HCCCCEEECCCCCC--CCC-CCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHEEEEECCHHHHH
T ss_conf             66998379989889--999-889999999999857999889999999999999999999848998733199947899999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.--       .+| +.|+..+.+|.+....+........ .-   |..+.  .  +...+.+++.+.+++.++++
T Consensus       105 ~~~~~~l~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v-~v---pl~~~--~--~~~~~~l~~~i~~~~k~i~l  168 (378)
T PRK07212        105 YEAMMAVL-------DDG-DEVILLDPAWVSYEACIKFAGGKPV-WV---PLNPE--D--FQLPDDLAEAITDKTKLIVV  168 (378)
T ss_pred             HHHHHHHC-------CCC-CEEEEECCCCCCHHHHHHHCCCEEE-EE---ECCCC--C--CCCHHHHHHHCCCCCEEEEE
T ss_conf             99999847-------998-9899817963425689997199699-98---35556--7--85289999856657829998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC-E---EECCCCCC-CCCCCCCC
Q ss_conf             -332222112462101232211022345721310110034444555310111245453-0---21034444-44344321
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD-I---MTIAKGMG-GGFPIGAC  256 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD-i---~~~gK~l~-gG~P~sav  256 (392)
                       -| +.-.|. ..+++.+++|.++|++||+++|.||+...+---++........-.+| .   -.+||.++ .|+-+|.+
T Consensus       169 ~~P-~NPtG~-v~s~~~l~~l~~la~~~~~~ii~DEiY~~l~~~~~~~~~~~l~~~~~~~i~~~S~SK~~~l~GlRvG~~  246 (378)
T PRK07212        169 NSP-SNPTGA-VFGKESLQGVADLAVDHDLYVLSDEIYEKIIYGKEHISLGSLDGMADRTITINGFSKAYAMTGWRLGYL  246 (378)
T ss_pred             CCC-CCCCCC-CCCCHHHHHHHHHHHHHCCEECCCCCHHHHHCCCCCCCHHHCCCCCCCCCEECCCCCCCCCCCEEEEEE
T ss_conf             899-799898-847176889999777424501330011544048877774334454555403335421367776048989


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEE-E
Q ss_conf             00011122222332234532111100123345543201--22210112100002688999988679707550464009-9
Q gi|254780432|r  257 LATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLL-I  333 (392)
Q Consensus       257 ~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~-~  333 (392)
                      ++.+++++.+.......+...+.++..++.+.++..++  +.+.++.++.-+.+.+.|+++     ++ .-....|.+ .
T Consensus       247 ~~~~~~i~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~l~~~~~~~~~~r~~l~~~L~~~-----g~-~~~~p~g~~~~  320 (378)
T PRK07212        247 TAPEEIIKQMGKVQSHSVSSATTFVQYGGVAALKGPQDCVEEMRDEFEARRDILIDGLADM-----GL-ECAPPDGAFYA  320 (378)
T ss_pred             ECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CC-EECCCCEEEEE
T ss_conf             7399999999999864557887699999999996877889999999999999999999976-----98-66268816999


Q ss_pred             EEEECCCHHHHHHHH-HHCCEEEEEC----CCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             987249989999999-9689899626----89889955898688999999999999999
Q gi|254780432|r  334 GLKTVFSPALLAAKF-RDECLLTAPS----SDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       334 ~ie~~~~~~~~~~~l-~~~Gll~~~~----~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      =+++..+...++.++ .+.||.+.|.    .++.+|+.  +..++++|++++++|+++|
T Consensus       321 ~~~~~~~~~~~~~~ll~~~gV~v~pG~~Fg~~g~iRl~--~a~~~e~l~eal~RL~~~L  377 (378)
T PRK07212        321 FPNVDGDDTAVAERLLKDAHVAVTPGSAFGAPGWIRIS--YATSMERLKEALERLEKVL  377 (378)
T ss_pred             EEECCCCHHHHHHHHHHHCCEEEEECCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHH
T ss_conf             99789999999999997098999817445999939999--8089999999999999985


No 104
>PRK05764 aspartate aminotransferase; Provisional
Probab=99.76  E-value=1.8e-16  Score=128.18  Aligned_cols=334  Identities=17%  Similarity=0.211  Sum_probs=202.1

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             7997646410226743578789999999999997314--50687578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW--HVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~--~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|.  -.+.- .|.|.+|+.+.++...  |.+.....+.+.++++.+.+..+    .|.+++++++++|.
T Consensus        28 ~~G~dvi~l~~g~--pd~~~-p~~i~~a~~~~~~~~~~~Y~~~~G~~~LR~aia~~~~~~~g~~v~~d~I~it~G~~~al  104 (389)
T PRK05764         28 AAGRDVISLGAGE--PDFDT-PEHIKEAAIAALDEGKTKYTPAAGIPELREAIAEKLKRDNGLDYEPDQIIVTTGAKQAL  104 (389)
T ss_pred             HCCCCEEECCCCC--CCCCC-CHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHHH
T ss_conf             7799827888978--99998-89999999999847999998998879999999999999868998579789888879999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++..-       .+| +.|+..+-+|.+.........+....    -|..+  ..-...|++++++.+.+++-++++
T Consensus       105 ~~~~~~l~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v~----vp~~~--~~~~~~d~~~l~~~~~~~~k~i~l  170 (389)
T PRK05764        105 YNAFMALL-------NPG-DEVIIPAPYWVSYPEMVKLAGGKPVF----VPTGE--ENGFKLTPEQLEAAITPKTKALIL  170 (389)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHCCCEEEE----ECCCH--HHCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999958-------999-98998578624589999964986555----04362--208768999999863846649998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC-------EEECCCCCC-CCCCC
Q ss_conf             -332222112462101232211022345721310110034444555310111245453-------021034444-44344
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD-------IMTIAKGMG-GGFPI  253 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD-------i~~~gK~l~-gG~P~  253 (392)
                       -| ..-.|. ..+++-+++|.++|++||+++|.||+...+--.|.-+-. ...+.||       +-.+||.++ .|+=+
T Consensus       171 ~~P-~NPtG~-v~s~~~l~~l~~~a~~~~i~ii~DEiY~~l~~~~~~~~~-~~~~~~~~~~~vi~~~S~SK~~~lpGlRi  247 (389)
T PRK05764        171 NSP-SNPTGA-VYSKEELEAIADVAVEHDIWVLSDEIYEKLVYDGFEFTS-IASLSPELFDRTITVNGFSKAYAMTGWRL  247 (389)
T ss_pred             CCC-CCCCCC-CCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCC-HHHHCCHHHCCCEEECCCCCCCCCCCCCE
T ss_conf             899-899886-757799999999988635327510134355568988888-77849012114314314430247866036


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHH----HHCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             3210001112222233223453211110012334554320122210112----100002688999988679707550464
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI----NIAKILFEGLTAIKNRFPNMFLEVRGQ  329 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~----~~g~~l~~~L~~l~~~~~~~v~~vRG~  329 (392)
                      |.+++.+++.+.+.......+.+.++++-.++.+.|+-  .++++++.+    ++-+.+.+.|    .++++ +.-.+..
T Consensus       248 G~~i~~~~li~~~~~~~~~~~~~~~~~~Q~aa~~al~~--~~~~~~~~~~~~~~rr~~l~~~l----~~~~g-~~~~~P~  320 (389)
T PRK05764        248 GYAAGPKELIKAMSKLQSQSTSNPTSIAQYAAIAALTG--PQDAVEEMRKAFEERRDLMVDGL----NEIPG-LECPKPE  320 (389)
T ss_pred             EEEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHHHHHHHH----HHCCC-CEECCCC
T ss_conf             99982999999999998541478986999999999859--78789999999999999999999----84899-8864788


Q ss_pred             EEEEE-EEEC---CCHHHHHHHHH-HCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             00999-8724---99899999999-6898996268----98899558986889999999999999999852
Q gi|254780432|r  330 GLLIG-LKTV---FSPALLAAKFR-DECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       330 Gl~~~-ie~~---~~~~~~~~~l~-~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      |.++. +++.   .+...+++.+. +.||.+.|..    ++.+|+.  +..++++|++++++|.+++++|.
T Consensus       321 G~~~~~~~~~~~~~~~~~~~~~ll~~~gV~~~PG~~Fg~~g~~Rl~--fa~~~e~l~ea~~RL~~~l~~lk  389 (389)
T PRK05764        321 GAFYVFPNVSKGITDSEDFAEALLEEAGVAVVPGIAFGAPGYVRLS--YATSLEDIEEALERIERFLKSLK  389 (389)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHCC
T ss_conf             1079958888889999999999998199999807324899849999--83889999999999999999758


No 105
>PRK07367 consensus
Probab=99.75  E-value=2.7e-16  Score=127.00  Aligned_cols=335  Identities=16%  Similarity=0.202  Sum_probs=203.3

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             7997646410226743578789999999999997314--50687578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW--HVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~--~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|--  .+. ..|.|++|+++.++...  |.......+.+..+++.+.+..+    .|.++.++++++|.
T Consensus        25 ~~G~dvi~l~~G~p--d~~-~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lR~aia~~~~~~~g~~~~~d~I~it~G~~~al  101 (385)
T PRK07367         25 AEGLDVCSFSAGEP--DFD-TPAHIKAAAKKALDEGKTRYGPAAGEPALREAIAHKLRRENGLDYQAENILVTNGGKQSL  101 (385)
T ss_pred             HCCCCCEECCCCCC--CCC-CCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHEEEECCCHHHHH
T ss_conf             77998178989999--998-789999999999865887779999989999999999999858999850499908989999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.--       .+| ++|+..+-+|.+.............. -   |..+  ..-...|.+.+++.+.+++.++++
T Consensus       102 ~~~~~~l~-------~pG-D~Vlv~~P~y~~y~~~~~~~g~~~v~-v---~~~~--~~~~~~d~~~l~~~~~~~~k~~il  167 (385)
T PRK07367        102 YNLMMALI-------DPG-DEVIIPAPYWLSYPEMVKLAGGTPVI-V---PTDA--ATGFKITPEQLRQAITPKTKLLVL  167 (385)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCCCCHHHHHHCCCEEEE-E---CCCC--CCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999974-------899-98999069877719999980985799-2---1362--127677999999737867749997


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC----E---EECCCCCC-CCCCC
Q ss_conf             -332222112462101232211022345721310110034444555310111245453----0---21034444-44344
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD----I---MTIAKGMG-GGFPI  253 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD----i---~~~gK~l~-gG~P~  253 (392)
                       -| ..--|. ..+++-++++.++|++||+++|.||+...+---|..+-+ ...+.||    .   -.+||.++ .|+=+
T Consensus       168 ~~P-~NPTG~-v~s~~~l~~l~~~a~~~~~~iIsDEiY~~l~f~~~~~~s-~~~~~~~~~~~~i~~~s~SK~~~~~G~Ri  244 (385)
T PRK07367        168 NSP-SNPTGM-VYTPEEIAALAEVIVEHDLYVVSDEIYEKILYDGAEHLS-IGSLGPEIFQRTIISNGFAKAYSMTGWRV  244 (385)
T ss_pred             CCC-CCCCCC-CCCHHHHHHHHHHHHHCCEEEEECCCCHHHCCCCCCCCC-HHHHCCCCCCCCHHHCCCCCCCCCCCCEE
T ss_conf             899-798785-665788889988887558699711321121058977778-88859420246401001000367761248


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEE
Q ss_conf             32100011122222332234532111100123345543201--2221011210000268899998867970755046400
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGL  331 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl  331 (392)
                      |.+++.+++++.+.......+...+.++-.++.+.|+--++  +++.+..++.-+.+.+.|++    .|+ +.-.+..|.
T Consensus       245 G~~~~~~~~i~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~~~~rr~~l~~~l~~----~~~-~~~~~P~G~  319 (385)
T PRK07367        245 GYLAGPVELIKAASSIQSHSTSNVCTFAQYGAIAALESPQDCVEEMRQAFAERRQLMLDGLNA----IPG-LSCPKPEGA  319 (385)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH----CCC-CEECCCCEE
T ss_conf             878568999999998542055545789999999999584989999999999999999999983----799-675588847


Q ss_pred             EEE-EEEC---CCHHHHHHHHH-HCCEEEEEC----CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999-8724---99899999999-689899626----89889955898688999999999999999985
Q gi|254780432|r  332 LIG-LKTV---FSPALLAAKFR-DECLLTAPS----SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       332 ~~~-ie~~---~~~~~~~~~l~-~~Gll~~~~----~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      |+. +++.   .+...+++++. +.||.+.|.    .++.+|+.  +..++++|++++++|.+.++.|
T Consensus       320 ~~~w~~l~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~~~~Rl~--~a~~~~~l~ea~~RL~~~l~~l  385 (385)
T PRK07367        320 FYVFVDISKTGLGSLEFCRQLLEEHHVAAIPGIAFGADDHIRLS--YATDLATIEKGLERLERFVRSL  385 (385)
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHC
T ss_conf             99978889989999999999999699999758746999939999--7098999999999999999849


No 106
>cd06453 SufS_like Cysteine desulfurase (SufS)-like. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to cysteine desulfurase (SufS) and selenocysteine lyase. SufS catalyzes the removal of elemental sulfur and selenium atoms from L-cysteine, L-cystine, L-selenocysteine, and L-selenocystine to produce L-alanine; and selenocysteine lyase catalyzes the decomposition of L-selenocysteine.
Probab=99.74  E-value=1.5e-16  Score=128.61  Aligned_cols=322  Identities=15%  Similarity=0.171  Sum_probs=191.5

Q ss_pred             EEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHH-------HHHHHHHHHCC---CCCCCCCCCCCCCHH
Q ss_conf             46410226743578789999999999997314506875781899-------99986520101---333123565554035
Q gi|254780432|r   34 FLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE-------IFANHLIHSTF---ADRVFFTNSGAESVE  103 (392)
Q Consensus        34 yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~-------~la~~L~~~~~---~~~v~f~~SGseA~e  103 (392)
                      |+|-.+.      +.-.|+++++|.+.++....-+....+....       +.-+++.+..+   .+.+.|+.|+|||+-
T Consensus         2 YlD~aat------t~~~~~V~~~~~~~~~~~~~np~~~~~~~~~~a~~~le~aR~~ia~~lg~~~~~eI~fts~aTea~n   75 (373)
T cd06453           2 YLDNAAT------SQKPQPVIDAIVDYYRHYNANVHRGVHELSARATDAYEAAREKVARFINAPSPDEIIFTRNTTEAIN   75 (373)
T ss_pred             CCCCCCC------CCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHH
T ss_conf             4548764------6899999999999999758998730509999999999999999999749699897999188679987


Q ss_pred             HHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             67776-65432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  104 CAIKT-ARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       104 ~Aikl-ar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      .+++- .+..     ++|. .||.-.--|+. ....+.   ....+.++.-..-++.....-|++++++.+.+++..|.+
T Consensus        76 ~~~~~l~~~~-----~~gd-~Vi~s~~EH~s-~~~p~~---~la~~~G~~v~~ip~~~~G~i~~~~l~~~i~~~T~lV~~  145 (373)
T cd06453          76 LVAYGLGRAN-----KPGD-EIVTSVMEHHS-NIVPWQ---QLAERTGAKLKVVPVDDDGQLDLEALEKLLTERTKLVAV  145 (373)
T ss_pred             HHHHHHHHCC-----CCCC-EEEECCCCCCC-HHHHHH---HHHHHCCCEEEEECCCCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             8865302026-----9999-89976011124-278999---998705958985078978858899999754589569999


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCCCCCCCCCCC
Q ss_conf             33222211246210123221102234572131011003444455531011124545302103--4444443443210001
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA--KGMGGGFPIGACLATN  260 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g--K~l~gG~P~sav~~~~  260 (392)
                      --+..+.|.+.|    ++.+.++|+++|+++++|=+|. +|..    -.+--.+.+|+++++  | +.|+.=+|++..++
T Consensus       146 ~~v~n~tG~~~p----i~~I~~~~~~~g~~~~vDa~Qa-~g~~----~idv~~~~~D~~~~s~hK-~~GP~G~G~Lyv~~  215 (373)
T cd06453         146 THVSNVLGTINP----VKEIGEIAHEAGVPVLVDGAQS-AGHM----PVDVQDLGCDFLAFSGHK-MLGPTGIGVLYGKE  215 (373)
T ss_pred             ECCCCCCCCCCC----HHHHHHHHHHCCCEEEEECCCC-CCCC----CCCHHHHHCCEEEEECHH-CCCCCCEEEEEECC
T ss_conf             785667760887----9999999987497699876212-4554----651777627738976101-15888349999860


Q ss_pred             CCCCCCCCCCCCCC---------------------CCCCCCCHHHHHHHHHHHHCC---CCCCHHHHHCCHHHHHHHHHH
Q ss_conf             11222223322345---------------------321111001233455432012---221011210000268899998
Q gi|254780432|r  261 EVAACMNQGSHGST---------------------YGGNVLAMVLGEKVLNIIQSD---GFLENVINIAKILFEGLTAIK  316 (392)
Q Consensus       261 ~i~~~~~~~~~~~T---------------------~~gnpl~~aaa~a~L~~l~~~---~l~~~~~~~g~~l~~~L~~l~  316 (392)
                      ++.+.+.+...+.+                     -+-|..++++..++|+++.+.   ++.++.+.+.+++.++|+++.
T Consensus       216 ~~~~~l~p~~~gg~~~~~~~~~~~~~~~~~~rfe~GT~n~~~i~~l~~al~~~~~~g~~~i~~~~~~L~~~l~~~L~~l~  295 (373)
T cd06453         216 ELLEEMPPYGGGGEMIEEVSFEETTYADLPHKFEAGTPNIAGAIGLGAAIDYLEKIGMEAIAAHEHELTAYALERLSEIP  295 (373)
T ss_pred             HHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             14524783316887533323432222555220255675588999999999999984899999999999999999996389


Q ss_pred             HHCCCEEEEECCCEEEEEEEEC-CCHHHHHHHHHHCCEEEEEC------------CCCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             8679707550464009998724-99899999999689899626------------8988995589868899999999999
Q gi|254780432|r  317 NRFPNMFLEVRGQGLLIGLKTV-FSPALLAAKFRDECLLTAPS------------SDNVVRILPPLTITAEEIHEGLERI  383 (392)
Q Consensus       317 ~~~~~~v~~vRG~Gl~~~ie~~-~~~~~~~~~l~~~Gll~~~~------------~~~~irl~Ppl~it~~eid~~i~~l  383 (392)
                      .  -.++.+...+.-++.+.+. .++..+...|.++|+.++..            -+..||++|...-|++|||++++.|
T Consensus       296 ~--v~i~~~~~~r~~ivsf~~~~~~~~~v~~~L~~~gI~vs~G~~Ca~~~~~~~g~~g~iRvS~~~ynt~~dId~li~al  373 (373)
T cd06453         296 G--VRVYGDAEDRAGVVSFNLEGIHPHDVATILDQYGIAVRAGHHCAQPLMRRLGVPGTVRASFGLYNTEEEIDALVEAL  373 (373)
T ss_pred             C--CEECCCCCCCCCEEEEEECCCCHHHHHHHHHHCCEEEECCCCCCHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHC
T ss_conf             9--76248845568889999699599999999967992997863324488997289987999688889999999999559


No 107
>PRK07324 transaminase; Validated
Probab=99.74  E-value=1.6e-16  Score=128.42  Aligned_cols=306  Identities=18%  Similarity=0.212  Sum_probs=190.5

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             14506875781899999865201013331235655540356777665432001347860023435465654321234553
Q gi|254780432|r   64 LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGG  143 (392)
Q Consensus        64 ~~~~~~~~~~~~~~~la~~L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~  143 (392)
                      +.+.......+.+.+.|+.. +...+|.+..++++++|+..+++..-       .+| +.||....+|++......+...
T Consensus        56 l~Y~~~~G~~~LR~~Ia~~y-~~v~~d~IlvT~Ga~~Al~l~~~~l~-------~pG-D~Viv~~P~Y~~~~~~~~~~G~  126 (373)
T PRK07324         56 LTYGWIEGSPEFKEAVASLY-QNVKPDNILQTNGATGANHLVLYALI-------EPG-DHVISVYPTYQQLYDIPESLGA  126 (373)
T ss_pred             CCCCCCCCCHHHHHHHHHHH-CCCCHHHEEECCCHHHHHHHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHCCC
T ss_conf             77788889899999999986-69986788986878999999999975-------999-9899889985779999998398


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCC
Q ss_conf             21134799986433322210026887541012332222333222211246210123221102234572131011003444
Q gi|254780432|r  144 KLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG  223 (392)
Q Consensus       144 ~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~G  223 (392)
                      ....    .|..+  ..-.-.|++++++.+.++.-.+++-.-+.-.|. ..+++-+++|.++|++||+.+|.|||..+|.
T Consensus       127 ~v~~----~~l~~--~~~~~~Dl~~l~~~i~~~tkliil~nP~NPTG~-v~s~e~l~~l~~la~~~~i~iisDEiY~~l~  199 (373)
T PRK07324        127 EVDY----WKLRE--ENGWLPDLDELKRLVRPNTKLICINNANNPTGA-LMDRAFLEEIVEIAKSVDAYVLSDEVYRPLD  199 (373)
T ss_pred             EEEE----CCCCC--CCCCCCCHHHHHHHCCCCCEEEEECCCCCCCCC-CCCHHHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             7654----07672--259887999999618878769997999798897-7889999999987541785998125542235


Q ss_pred             CCCCCCCCCCCCCCCC---EEECCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             4555310111245453---021034444-443443210001112222233223453211110012334554320122210
Q gi|254780432|r  224 RTGKLFAYEWANVKPD---IMTIAKGMG-GGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE  299 (392)
Q Consensus       224 RtG~~f~~e~~gi~PD---i~~~gK~l~-gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~  299 (392)
                      ..|.+-..  .++.+.   +-.+||.++ .|+-+|-+++.+++.+.+......+|.+.+.+.-.+|...++.  .+.+++
T Consensus       200 ~~~~~~s~--~~~~~~~I~~~S~SK~~~l~GlRiGwiv~~~~li~~~~~~~~~~~i~~~~~~~~~a~~al~~--~~~~l~  275 (373)
T PRK07324        200 EEGSFPSI--ADLYEKGISTNSLSKTYSLPGIRVGWIATNEEVIDIFRKYRDYTMICAGVFDDMLASLALEH--RDAILE  275 (373)
T ss_pred             CCCCCCHH--HHHHHCEEEECCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC--HHHHHH
T ss_conf             79750105--65755758971541125677743799966999999999998653556656999999999968--399999


Q ss_pred             HHHHHCCHHHHHHHHHHHHCCCEEEEECCCEE---EEEEEECCCHHHHHHHHH-HCCEEEEECC----CCEEEECCCCCC
Q ss_conf             11210000268899998867970755046400---999872499899999999-6898996268----988995589868
Q gi|254780432|r  300 NVINIAKILFEGLTAIKNRFPNMFLEVRGQGL---LIGLKTVFSPALLAAKFR-DECLLTAPSS----DNVVRILPPLTI  371 (392)
Q Consensus       300 ~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl---~~~ie~~~~~~~~~~~l~-~~Gll~~~~~----~~~irl~Ppl~i  371 (392)
                      +.++.-+.-++.+.++..+.|. +.-++-.|-   +.-++...+...++.++. +.||.+.|..    ++.+|+.  +..
T Consensus       276 ~~~~~~~~n~~~l~~~l~~~~~-~~~~~P~gg~~~~~~~~~~~~~~~~~~~ll~~~gV~v~PG~~F~~~g~~Ri~--fa~  352 (373)
T PRK07324        276 RNRKIVRTNLAILDEWVAKEPR-VSYVKPKAVSTSFIKLDVDMDSEEFCEKLLKETGVLLVPGNRFDLEGHVRIG--YCC  352 (373)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCC-CEEECCCCCEEEEEECCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--EEC
T ss_conf             9999999999999999973888-5376358614799878999899999999999689999748865899949999--819


Q ss_pred             CHHHHHHHHHHHHHHHHHHCC
Q ss_conf             899999999999999998529
Q gi|254780432|r  372 TAEEIHEGLERIERTAIKLSH  392 (392)
Q Consensus       372 t~~eid~~i~~l~~al~~L~~  392 (392)
                      ++++|.+++++|.+++++|.+
T Consensus       353 ~~~~l~egl~RL~~~l~~l~~  373 (373)
T PRK07324        353 DTKTLKKGLKKLSEFLRKLDS  373 (373)
T ss_pred             CHHHHHHHHHHHHHHHHHHCC
T ss_conf             899999999999999997369


No 108
>PRK05957 aspartate aminotransferase; Provisional
Probab=99.74  E-value=4.6e-16  Score=125.46  Aligned_cols=336  Identities=17%  Similarity=0.209  Sum_probs=200.6

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC---CCCCCCCCCHHHHHHHHHHHHHCC----CCC-CCCCCCCCC
Q ss_conf             799764641022674357878999999999999731---450687578189999986520101----333-123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL---WHVSNLYQSTQQEIFANHLIHSTF----ADR-VFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~---~~~~~~~~~~~~~~la~~L~~~~~----~~~-v~f~~SGse  100 (392)
                      .+|...|++.-|.  -.+ .-+|+|++|+.++++..   .|.......+.+..+|+.+....+    .+. ++.++++++
T Consensus        24 ~~~~~iI~l~~G~--pd~-~~p~~v~~a~~~al~~~~~~~Y~~~~G~~~LR~aia~~~~~~~g~~~~~~~~I~vt~Ga~~  100 (389)
T PRK05957         24 RENPGTISLGQGV--VSY-PPPPEAIEALNNFLANPENHLYQSVQGIPPLLEAITQKLQADNGIEINNENAIVVTAGSNM  100 (389)
T ss_pred             HCCCCCEECCCCC--CCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHH
T ss_conf             7599938899989--999-9889999999999828678868997574999999999999996899898988998878899


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |...+++.--       .+| +.|+..+-+|.+.........+++..    -|.    +.-...|.+.+++.+.+++-++
T Consensus       101 al~~~~~al~-------~pG-D~Vlv~~P~Y~~~~~~~~~~g~~~v~----vp~----d~~~~~~~~~l~~~i~~~~k~i  164 (389)
T PRK05957        101 AFMNAILAIT-------DPG-DEIILNTPYYFNHEMAITMAGCQPVL----VPT----DENYQLRPEAIEAAITPKTRAI  164 (389)
T ss_pred             HHHHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCCEEE----EEC----CCCCCCCHHHHHHHCCCCCEEE
T ss_conf             9999999975-------999-98997788776689999974993588----657----9988979999998451026278


Q ss_pred             CC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCC-CCCCC-CCCCCCC---EEECCCCCC-CCCCC
Q ss_conf             23-332222112462101232211022345721310110034444555-31011-1245453---021034444-44344
Q gi|254780432|r  181 LI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGK-LFAYE-WANVKPD---IMTIAKGMG-GGFPI  253 (392)
Q Consensus       181 i~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~-~f~~e-~~gi~PD---i~~~gK~l~-gG~P~  253 (392)
                      ++ -| ..-.|. ..+++.+++|.++|++||+++|.||+..-+--.|. .+... ..+...-   +-.+||.++ .|+-+
T Consensus       165 il~~P-~NPTG~-v~s~~~l~~l~~la~~~~~~ii~DE~Y~~l~~~~~~~~s~~~~~~~~~~vI~i~S~SK~~~~~G~Rv  242 (389)
T PRK05957        165 VTISP-NNPTGV-VYPEALLRAVNQICAEHGIYHISDEAYEYFTYDGVKHFSPGSIPGSGNHTISLYSLSKAYGFASWRI  242 (389)
T ss_pred             ECCCC-CCCCCC-CCCHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             61899-899898-8767789999987606781899898432134588666776544563454301344431244656434


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEE
Q ss_conf             32100011122222332234532111100123345543201--2221011210000268899998867970755046400
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGL  331 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl  331 (392)
                      |.+++.+++++.+.......+...+.++-.++.+.|+.-++  ++..++.++.-+.+.+.|++    +++.+.-....|.
T Consensus       243 G~~v~~~~l~~~~~~~~~~~~~~~~~~~Q~aa~~al~~~~~~~~~~~~~~~~~r~~~~~~l~~----~~~~~~~~~p~G~  318 (389)
T PRK05957        243 GYMVIPIHLLEAIKKIQDTILICPPVVSQYAALGALQVGKSYCQQHLPEIAQVRQILLKSLAQ----LQDWCFLHPANGA  318 (389)
T ss_pred             EEEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH----CCCCEEECCCCEE
T ss_conf             889838999999999985456785399999999999779999999999999999999999985----6897266079857


Q ss_pred             E-EEEEEC--CCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCC-CCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             9-998724--99899999999-689899626------89889955898-6889999999999999999852
Q gi|254780432|r  332 L-IGLKTV--FSPALLAAKFR-DECLLTAPS------SDNVVRILPPL-TITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       332 ~-~~ie~~--~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl-~it~~eid~~i~~l~~al~~L~  391 (392)
                      | +=+++.  .+...+.+++. +.||.+.|.      +++.+||+  | ..++++|++++++|.++|+++.
T Consensus       319 f~~~~~~~~~~~~~~~~~~ll~e~gV~v~PG~~Fg~~~~~~~Rls--f~~~~~e~l~eg~~RL~~alk~~~  387 (389)
T PRK05957        319 FYCFLKVNTDLNDFELVKQLIRDYRVAVIPGSTFGMKNGCYLRIA--YGALQKATAKEGIERLVQGLKTIV  387 (389)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             999897898969999999999979999978731088999989998--542999999999999999999997


No 109
>PRK08361 aspartate aminotransferase; Provisional
Probab=99.73  E-value=2.7e-16  Score=127.03  Aligned_cols=334  Identities=18%  Similarity=0.165  Sum_probs=196.9

Q ss_pred             CCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCC-CCCCCCHHHHHHHHHHHHHC----CCCCCCCCCCCCCCHHH
Q ss_conf             9764641022674357878999999999999731-450-68757818999998652010----13331235655540356
Q gi|254780432|r   31 GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHV-SNLYQSTQQEIFANHLIHST----FADRVFFTNSGAESVEC  104 (392)
Q Consensus        31 G~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~-~~~~~~~~~~~la~~L~~~~----~~~~v~f~~SGseA~e~  104 (392)
                      .+..|||..|.  ..+. -.+.|++|+++.++.. .++ ......+.+.++++.+.+..    ..|.++.++++++|...
T Consensus        31 ~~dvI~l~~G~--pd~~-~p~~i~~a~~~~l~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~v~~d~I~vt~G~~~al~~  107 (390)
T PRK08361         31 MENVISLGIGE--PDFD-TPKNIKEAAKRALDEGWTHYTPNAGIPELREAIAEYYKKFYGVDVDVDNVIVTAGAYEATYL  107 (390)
T ss_pred             CCCCEECCCCC--CCCC-CCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHEEEECCCHHHHHHH
T ss_conf             99938998998--9998-78999999999984688888998887999999999999987889882329987789999999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCC-
Q ss_conf             7776654320013478600234354656543212345532113479998643332221002688754101233222233-
Q gi|254780432|r  105 AIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE-  183 (392)
Q Consensus       105 Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~E-  183 (392)
                      +++.--       .+| ..|+..+-+|.+.............. -   |..+  +.-...|++++++.+.++.-++++- 
T Consensus       108 ~~~~l~-------~pG-D~Vli~~P~Y~~y~~~~~~~g~~~~~-v---pl~~--~~~~~~d~~~l~~~~~~~~k~ivl~~  173 (390)
T PRK08361        108 AFESLL-------EQG-DEVIIPDPAFVCYVEDAKIAEAKPIR-I---PLRE--ENNFQPDPDELLEAITKRTRMIVINY  173 (390)
T ss_pred             HHHHHC-------CCC-CEEEECCCCHHHHHHHHHHCCCEEEE-E---ECCC--CCCCCCCHHHHHHHCCCCCEEEEECC
T ss_conf             999965-------999-98998476077799999982997999-9---7158--78987799999973654675999889


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC----EEECCCCCC-CCCCCCCCCC
Q ss_conf             32222112462101232211022345721310110034444555310111245453----021034444-4434432100
Q gi|254780432|r  184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD----IMTIAKGMG-GGFPIGACLA  258 (392)
Q Consensus       184 pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD----i~~~gK~l~-gG~P~sav~~  258 (392)
                      | +.-.|. ..+++-+++|.++|++||+++|.||+...+---|.-+.. .....||    +-.+||.++ .|+=+|.+++
T Consensus       174 P-~NPTG~-v~s~e~l~~l~~la~~~~i~ii~DE~Y~~l~~~~~~~~~-~~~~~~~~~i~~~S~SK~~~~~G~RiG~~v~  250 (390)
T PRK08361        174 P-NNPTGA-VLDKETAKAIADIAEDYNIYILSDEPYEHFLYEDAKHYP-MIKFAPDNTILANSFSKTFAMTGWRLGFVIA  250 (390)
T ss_pred             C-CCCCCC-CCCHHHHHHHHHHHHHCCCEECCHHHHHHHHCCCCCCCC-HHHHCCCCEEEEECCHHHCCCCCCCEEEEEE
T ss_conf             9-897577-866788889999998639553470656876038875420-1131355289980252414787423799983


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHH---HHHHHHHCCCEEEEECCCEEEE-E
Q ss_conf             01112222233223453211110012334554320122210112100002688---9999886797075504640099-9
Q gi|254780432|r  259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEG---LTAIKNRFPNMFLEVRGQGLLI-G  334 (392)
Q Consensus       259 ~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~---L~~l~~~~~~~v~~vRG~Gl~~-~  334 (392)
                      .++++..+.......+.+.+.+.-.++.+.|   .+....+.++++-+.+.++   +.+...+.|+ +.-++..|-++ =
T Consensus       251 ~~~~i~~~~~~~~~~~~~~~~~~q~a~~~al---~~~~~~~~~~~~~~~~~~rr~~~~~~l~~~~g-~~~~~P~gg~~lw  326 (390)
T PRK08361        251 PTQVIREMIKLHAYVIGNVASFVQIAGIEAL---RSKESWKAVEEMRKEYNERRKLVLKRLNKMPH-ITVFEPKGAFYVF  326 (390)
T ss_pred             CHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH---HCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CEECCCCEEEEEE
T ss_conf             8999999999976602787689999999998---48504899999999999999999999985899-6866888666997


Q ss_pred             EEEC---CCHHHHHHHHHHC-CEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8724---9989999999968-9899626------89889955898688999999999999999985
Q gi|254780432|r  335 LKTV---FSPALLAAKFRDE-CLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       335 ie~~---~~~~~~~~~l~~~-Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +++.   .+...+++.+.++ ||.+.|.      +++.+|++  +..++++|.+++++|.+++.+|
T Consensus       327 ~~l~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~g~~~iRl~--f~~~~e~l~eal~Rl~~al~~L  390 (390)
T PRK08361        327 PKIDETDMSSEDFSEWLLEKARVVVIPGTAFGKMGEGYVRIS--YATSKEKLIEAMERMEKALSKL  390 (390)
T ss_pred             EECCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHC
T ss_conf             888888989999999999719999988732288999979999--7299999999999999999719


No 110
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA. Members of this protein family are CsdS. This protein, found Escherichia coli, Yersinia pestis, Photorhabdus luminescens, and related species, and related to SufS, works together with and physically interacts with CsdE (a paralog of SufE). CsdA has cysteine desulfurase activity that is enhanced by CsdE, a sulfur acceptor protein. This gene pair, although involved in FeS cluster biosynthesis, is not found next to other such genes as are its paralogs from the Suf or Isc systems.
Probab=99.73  E-value=5.5e-15  Score=118.43  Aligned_cols=333  Identities=14%  Similarity=0.132  Sum_probs=195.9

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHH------HHHH-HHHHHCC---CCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314506875781899------9998-6520101---3331235655
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE------IFAN-HLIHSTF---ADRVFFTNSG   98 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~------~la~-~L~~~~~---~~~v~f~~SG   98 (392)
                      .++.-|+|-.++      +.-.++|++|+.+.+...........+....      +-++ ++.+..+   .+.+.|+.|+
T Consensus        14 ~~~~iYlDnAat------t~~p~~V~~a~~~~~~~~~~n~~~s~~~~~~~~~~~~e~aR~~iA~~lga~~~~~Iifts~~   87 (398)
T TIGR03392        14 QDGTVYLDSAAT------ALKPQAVIDATQQFYRLSSGTVHRSQHQQAQSLTARYELARQQVARFLNAPDAENIVWTRGT   87 (398)
T ss_pred             CCCEEEEECCCC------CCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCH
T ss_conf             999088678632------68989999999999986348887514399999999999999999997095998979995877


Q ss_pred             CCCHHHHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             5403567776-654320013478600234354656543212345532113479998643332221002688754101233
Q gi|254780432|r   99 AESVECAIKT-ARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT  177 (392)
Q Consensus        99 seA~e~Aikl-ar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~i  177 (392)
                      ||++-.+++- ++..    -++| ..||+...-+|....-...+.    .+.++.-..-.+......|++.+++.+.+++
T Consensus        88 Te~~n~~~~~~~~~~----~~~g-d~ii~s~~EH~s~~~pw~~~~----~~~g~~v~~~~~~~~~~~d~~~l~~~i~~~T  158 (398)
T TIGR03392        88 TESINLVAQSYARPR----LQPG-DEIIVSEAEHHANLIPWLMVA----QQTGAKVVKLPIGADLLPDIRQLPELLTPRT  158 (398)
T ss_pred             HHHHHHHHHHHHHHH----CCCC-CEEEEECCCCCCCHHHHHHHH----HHCCCEEEEECCCCCCCCCHHHHHHHCCCCC
T ss_conf             999998987768872----3998-989982440034238999887----6448527996147889879999998525787


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCCCCCC
Q ss_conf             2222333222211246210123221102234572131011003444455531011124545302103--44444434432
Q gi|254780432|r  178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA--KGMGGGFPIGA  255 (392)
Q Consensus       178 Aavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g--K~l~gG~P~sa  255 (392)
                      ..|-+--+..+.|.+.|    ++++.++|+++|+++++|=+|. +|..  ..-.+.+  ..|+++++  | +.|-.=+|+
T Consensus       159 ~lVsi~~vsn~~G~i~p----i~~I~~~~~~~g~~~~vDa~Q~-~g~~--~idv~~~--~~D~~~~S~hK-l~GP~G~G~  228 (398)
T TIGR03392       159 RILALGQMSNVTGGCPD----LARAITLAHQYGAVVVVDGAQG-VVHG--PPDVQAL--DIDFYAFSGHK-LYGPTGIGV  228 (398)
T ss_pred             CEEEEECCCCCCCCCCC----HHHHHHHHHHCCCEEEEECCCC-CCCC--CCCCCCC--CCCEEEEECCC-CCCCCCEEE
T ss_conf             08998255567888587----9999999986597478633411-5620--3341026--78779986553-569984189


Q ss_pred             CCCCCCCCCCCCCCCCCCC------------------C---CCCCCCHHHHHHHHHHHHCCC---CCCHHHHHCCHHHHH
Q ss_conf             1000111222223322345------------------3---211110012334554320122---210112100002688
Q gi|254780432|r  256 CLATNEVAACMNQGSHGST------------------Y---GGNVLAMVLGEKVLNIIQSDG---FLENVINIAKILFEG  311 (392)
Q Consensus       256 v~~~~~i~~~~~~~~~~~T------------------~---~gnpl~~aaa~a~L~~l~~~~---l~~~~~~~g~~l~~~  311 (392)
                      +..++++.+.+.|...|..                  |   +-|..++++..++++++.+.+   +.++.+.+.+++.++
T Consensus       229 Ly~~~~~~~~l~p~~~Gg~~~~~~~~~~~~~~~~~~r~e~GT~n~~~i~gl~~al~~l~~~~~~~~~~~~~~L~~~~~~~  308 (398)
T TIGR03392       229 LYGKTELLEAMPPWQGGGKMLSHVSFDGFIPQAVPHRFEAGTPNIAGVIGLSAALEWLTDIDIAAAEAWSVSLADLAEER  308 (398)
T ss_pred             EEECCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             99841147437973579973443347776445550211468854878999999999999649999999999999999999


Q ss_pred             HHHHHHHCCCEEEEECCCE-EEEEEEECC-CHHHHHHHHHHCCEEEEECC------------CCEEEECCCCCCCHHHHH
Q ss_conf             9999886797075504640-099987249-98999999996898996268------------988995589868899999
Q gi|254780432|r  312 LTAIKNRFPNMFLEVRGQG-LLIGLKTVF-SPALLAAKFRDECLLTAPSS------------DNVVRILPPLTITAEEIH  377 (392)
Q Consensus       312 L~~l~~~~~~~v~~vRG~G-l~~~ie~~~-~~~~~~~~l~~~Gll~~~~~------------~~~irl~Ppl~it~~eid  377 (392)
                      |.+    .|++ ...|..+ -++++.+.. ....+...+.++|+.+....            +.+||+++...-|++|||
T Consensus       309 l~~----l~g~-~~~~~~~~~~~~f~~~~~~~~~l~~~L~~~gi~v~~G~~ca~~~l~a~g~~g~iRvS~~~ynT~edId  383 (398)
T TIGR03392       309 LAQ----LPGF-RSFRCPGSSLLAFDFAGVHHSDLAALLAESGIALRAGQHCAQPLMAALGVSGTLRASFAPYNTQQDVD  383 (398)
T ss_pred             HHH----CCCC-CCCCCCCCCEEEEEECCCCHHHHHHHHHHCCCEEECCCCCCHHHHHHHCCCCEEEEECCCCCCHHHHH
T ss_conf             863----8996-44579999679998799399999999977897996686654899998689987999678888999999


Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             99999999999852
Q gi|254780432|r  378 EGLERIERTAIKLS  391 (392)
Q Consensus       378 ~~i~~l~~al~~L~  391 (392)
                      +++++|++++..|.
T Consensus       384 ~li~aL~~~l~~l~  397 (398)
T TIGR03392       384 ALVDAVGAALELLN  397 (398)
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             99999999999843


No 111
>PRK06056 consensus
Probab=99.72  E-value=1.3e-15  Score=122.62  Aligned_cols=333  Identities=15%  Similarity=0.182  Sum_probs=198.2

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC---CCCCCCCCHHHHHHHHHHHHHC----CCCCCCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314---5068757818999998652010----13331235655540
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW---HVSNLYQSTQQEIFANHLIHST----FADRVFFTNSGAES  101 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~---~~~~~~~~~~~~~la~~L~~~~----~~~~v~f~~SGseA  101 (392)
                      ..|++.|++.-|.  -.+ .-++.+++|+.+++....   |.......+.+..+++++.+..    ..|.++.++++++|
T Consensus        31 ~~G~~vi~l~~G~--Pd~-~~p~~~~~a~~~a~~~~~~~~Y~~~~G~~eLR~aia~~~~~~~g~~~~~d~I~iT~G~~~a  107 (402)
T PRK06056         31 AAGRPVIGFGAGE--PDF-PTPDHIVEAAVAACRDPKNHRYTPAAGLPELREAIAAKTLRDSGYEVSPSQVLVTNGGKQA  107 (402)
T ss_pred             HCCCCCEECCCCC--CCC-CCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHEEEECCCHHH
T ss_conf             7799827888969--999-9889999999999759988857998681999999999999983899880237980681499


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             35677766543200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       102 ~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
                      ...+++.--       .+| +.|+..+-+|.+.........+.+..-    |.  ..+.-...|++++++.+.+++-+++
T Consensus       108 l~~~~~~l~-------~pG-D~Vlv~~P~y~~y~~~~~~~g~~~v~v----~~--~~~~~~~~d~~~le~~~~~~tk~ii  173 (402)
T PRK06056        108 VYEAFATLL-------DPG-DEVILPAPYWTTYPEAIRLAGGVPVEV----VA--GADQGYLVTVEQLEAARTERTKVLL  173 (402)
T ss_pred             HHHHHHHHC-------CCC-CEEEEECCCCCCCHHHHHHCCCCEEEE----CC--CCCCCCCCCHHHHHHHCCCCCEEEE
T ss_conf             999999857-------999-989981798756199999728970782----23--7333778799999963666873999


Q ss_pred             C-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC-------EEECCCCCC-CCCC
Q ss_conf             3-332222112462101232211022345721310110034444555310111245453-------021034444-4434
Q gi|254780432|r  182 I-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD-------IMTIAKGMG-GGFP  252 (392)
Q Consensus       182 ~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD-------i~~~gK~l~-gG~P  252 (392)
                      + -| ..--|. ..+++-+++|.++|++||+++|.||+...+--.|.-+.+- .-..||       +-.+||.++ .|+=
T Consensus       174 l~~P-~NPtG~-v~s~e~l~~l~~la~~~~i~ii~DEiY~~l~~~~~~~~s~-~~~~p~~~~~~i~~~S~SK~~~~~G~R  250 (402)
T PRK06056        174 FVSP-SNPTGA-VYSPEQVRAIGRWAAEHGIWVISDEIYEHLVYDGAVFTSI-PAAVPELADRCIVVNGVAKTYAMTGWR  250 (402)
T ss_pred             ECCC-CCCCCC-CCCHHHHHHHHHHHHHHCCCEECCHHHHHCCCCCCCCCCH-HHHHHHHHCCCEEEECCCCCCCCCCCE
T ss_conf             8489-798888-7427889999999997146155104432113589888888-886545414644752011335576530


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             432100011122222332234532111100123345543201222101----1210000268899998867970755046
Q gi|254780432|r  253 IGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRG  328 (392)
Q Consensus       253 ~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG  328 (392)
                      +|.+++.+++++.+.......+...+++.-.++.+.|+--  .+.+++    .+++-+.+.+.|+    +.+.+ .-..-
T Consensus       251 ~G~~v~~~~~i~~~~~~~~~~~~~~~~~~q~~a~~al~~~--~~~~~~~~~~~~~rr~~~~~~L~----~~~~~-~~~~P  323 (402)
T PRK06056        251 VGWMIGPADVIKAATNLQSHATSNVSNVSQRAALAAVSGP--LDAVAEMREAFDRRRRTIVRMLN----AIPGV-SCPTP  323 (402)
T ss_pred             EEEEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHH----HCCCC-EECCC
T ss_conf             7999708999999999986545774229999999998588--99999998789999999999998----67992-73588


Q ss_pred             CEEEEEE-EE------------CCCHHHHHHHHHH-CCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             4009998-72------------4998999999996-898996268----9889955898688999999999999999985
Q gi|254780432|r  329 QGLLIGL-KT------------VFSPALLAAKFRD-ECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       329 ~Gl~~~i-e~------------~~~~~~~~~~l~~-~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      .|.++.. ++            ..+...++.++.+ .||.+.|..    ++.+|++  +..++++|++++++|.+.+.+.
T Consensus       324 ~G~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~e~gV~v~PG~~Fg~~g~~Ris--fa~~~e~l~eal~RL~~~l~e~  401 (402)
T PRK06056        324 DGAFYAYPDVKALLGREIRGRRPQTSAELAALILEEAEVAVVPGEAFGTPGYLRLS--YALGDDDLVEGVRRLQELLSEA  401 (402)
T ss_pred             CEEEEEEEECHHHCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHC
T ss_conf             84469977554533632258998999999999997098999748444899839999--7089999999999999999956


No 112
>PRK10874 cysteine sulfinate desulfinase; Provisional
Probab=99.72  E-value=5.1e-15  Score=118.67  Aligned_cols=333  Identities=13%  Similarity=0.102  Sum_probs=195.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHH------HHH-HHHHHHCC---CCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314506875781899------999-86520101---3331235655
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE------IFA-NHLIHSTF---ADRVFFTNSG   98 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~------~la-~~L~~~~~---~~~v~f~~SG   98 (392)
                      .++.-|+|-.+      -+..++.|++||.+.++..........+....      +-+ +++.+..+   .+.+.|+.|+
T Consensus        17 ~~~~iYlD~Aa------tt~~p~~V~~a~~~~~~~~~~n~~~~~~~~~~~~~~~~e~aR~~iA~llga~~~~eI~fts~~   90 (401)
T PRK10874         17 QDAGVYLDSAA------TALKPQAVIEATQQFYSLSAGNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDAKNIVWTRGT   90 (401)
T ss_pred             CCCCEEEECCC------CCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCH
T ss_conf             99948974875------268999999999999986448988641089999999999999999998296998979997965


Q ss_pred             CCCHHHHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             5403567776-654320013478600234354656543212345532113479998643332221002688754101233
Q gi|254780432|r   99 AESVECAIKT-ARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT  177 (392)
Q Consensus        99 seA~e~Aikl-ar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~i  177 (392)
                      ||++-.+++- ++..    -++|. .||+...-+|....--+.+.    .+.++.-..-........|++.+++.+.+++
T Consensus        91 Te~~n~~~~~~~~~~----~~~gd-~vv~s~~Eh~s~~~pw~~~~----~~~g~~v~~~p~~~~g~~d~~~l~~~i~~~T  161 (401)
T PRK10874         91 TESINMVAQCYARPR----LQPGD-EIIVSEAEHHANLVPWLMVA----QQTGAKVVKLPLGADRLPDVDLLPELITPRS  161 (401)
T ss_pred             HHHHHHHHHHHHHHH----CCCCC-EEEEECCCCCCCHHHHHHHH----HHCCCEEEEECCCCCCCCCHHHHHHHHCCCC
T ss_conf             899999999999973----58998-38870441354158999999----8539636994158888759999999855896


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCCCCCC
Q ss_conf             2222333222211246210123221102234572131011003444455531011124545302103--44444434432
Q gi|254780432|r  178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA--KGMGGGFPIGA  255 (392)
Q Consensus       178 Aavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g--K~l~gG~P~sa  255 (392)
                      ..|.+--+....|.+.|    ++.+.++|+++|+++++|=+|+ +|..    -.+-..+..|+++++  | +.|-.=+|+
T Consensus       162 ~lVai~~vsn~~G~~~p----v~~I~~~~~~~g~~~~vDa~Q~-~g~~----~idv~~l~vD~l~~S~HK-l~GP~G~G~  231 (401)
T PRK10874        162 RILALGQMSNVTGGCPD----LARAITLAHQAGMVVMVDGAQG-AVHF----PADVQQLDIDFYAFSGHK-LYGPTGIGV  231 (401)
T ss_pred             EEEEEECCCCCCCCCCC----HHHHHHHHHHCCCEEEEECCCC-CCCC----CCCHHHHCCCEEEEECHH-CCCCCCEEE
T ss_conf             59999796678865576----9999999976497799753013-7742----546678439889987033-169981499


Q ss_pred             CCCCCCCCCCCCCCCCCCC------------------C---CCCCCCHHHHHHHHHHHHCCC---CCCHHHHHCCHHHHH
Q ss_conf             1000111222223322345------------------3---211110012334554320122---210112100002688
Q gi|254780432|r  256 CLATNEVAACMNQGSHGST------------------Y---GGNVLAMVLGEKVLNIIQSDG---FLENVINIAKILFEG  311 (392)
Q Consensus       256 v~~~~~i~~~~~~~~~~~T------------------~---~gnpl~~aaa~a~L~~l~~~~---l~~~~~~~g~~l~~~  311 (392)
                      +..++++.+.+.|...|.+                  |   +-|..++++..++++++.+.+   ..++.+.+.+++.++
T Consensus       232 Lyv~~~~~~~l~P~~~Gg~~~~~~~~~~~~~~~~~~r~e~GT~n~~~i~~l~aal~~l~~~~~~~~~~~~~~L~~~~~~~  311 (401)
T PRK10874        232 LYGKSELLEAMSPWLGGGKMLTEVSFDGFTPQSAPWRLEAGTPNVAGVIGLSAALEWLADIDIEQAESWSRSLATLAEDA  311 (401)
T ss_pred             EEECCCHHHHCCCEECCCCCCCCCCCCCCCCCCCCHHCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             99853036427865358754002346765425550002577832889999999999999639999999999999999999


Q ss_pred             HHHHHHHCCCEEEEECCCE-EEEEEEEC-CCHHHHHHHHHHCCEEEEECC------------CCEEEECCCCCCCHHHHH
Q ss_conf             9999886797075504640-09998724-998999999996898996268------------988995589868899999
Q gi|254780432|r  312 LTAIKNRFPNMFLEVRGQG-LLIGLKTV-FSPALLAAKFRDECLLTAPSS------------DNVVRILPPLTITAEEIH  377 (392)
Q Consensus       312 L~~l~~~~~~~v~~vRG~G-l~~~ie~~-~~~~~~~~~l~~~Gll~~~~~------------~~~irl~Ppl~it~~eid  377 (392)
                      |.+    .|++ ...|..+ -++.+.+. .....+...+.++|+.++...            +..||+++...-|++|||
T Consensus       312 L~~----~~g~-~~~~~~~~~i~sf~~~gi~~~~l~~~L~~~gi~v~~g~~ca~~~l~alg~~g~iRvS~~~ynT~~dId  386 (401)
T PRK10874        312 LAK----RPGF-RSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQPLLAALGVTGTLRASFAPYNTQSDVD  386 (401)
T ss_pred             HHH----CCCC-CCCCCCCCCEEEEEECCCCHHHHHHHHHHCCCEEECCCCCCHHHHHHHCCCCEEEEECCCCCCHHHHH
T ss_conf             852----8996-53479999889998799599999999977897896185342899998599997999658888999999


Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             99999999999852
Q gi|254780432|r  378 EGLERIERTAIKLS  391 (392)
Q Consensus       378 ~~i~~l~~al~~L~  391 (392)
                      ++++.|++++..|-
T Consensus       387 ~li~al~~~v~~lr  400 (401)
T PRK10874        387 ALVNAVDRALELLV  400 (401)
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             99999999999830


No 113
>PRK05794 consensus
Probab=99.72  E-value=9.2e-16  Score=123.53  Aligned_cols=332  Identities=17%  Similarity=0.217  Sum_probs=199.8

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCCCCC-CCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731-4506875-78189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVSNLY-QSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~~~~-~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|  --.+ ...|.|++|+.++++.. ..++... ..+.+.++++.+.+..+    .+.+..++++++|.
T Consensus        27 ~~G~dvi~l~iG--~pd~-~~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lReaia~~~~~~~g~~v~~~~I~it~G~~~al  103 (397)
T PRK05794         27 AEGIDVIGFGAG--EPDF-NTPENIKEAAIDAIEEGYTKYTPASGILELKQAICDKFKKDNGLNYEPSNIIVSNGAKQSL  103 (397)
T ss_pred             HCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHEEEECCCHHHHH
T ss_conf             779982789897--9999-9789999999999855899898997729999999999999858999800189878859999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.--       .+| +.|+..+.+|.+.....-...+.+...    +..+  ..-...|++++++.+.+++-++++
T Consensus       104 ~~~~~~l~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v~~----~~~~--~~~~~~d~~~l~~~~~~~~k~iil  169 (397)
T PRK05794        104 SNAFEAIL-------NPG-DEVIIPVPYWVSYPELVKLADGVPVFV----DTKE--ENDFKYTIEELENAITSKTKAIII  169 (397)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCCEEEE----ECCC--CCCCCCCHHHHHHHCCCCCCEEEE
T ss_conf             99999966-------998-989982687643499999718802996----5673--237777999999753335718997


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CCCCCCCCCC-------EEECCCCCC-CCCC
Q ss_conf             -33222211246210123221102234572131011003444455531-0111245453-------021034444-4434
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AYEWANVKPD-------IMTIAKGMG-GGFP  252 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~e~~gi~PD-------i~~~gK~l~-gG~P  252 (392)
                       -| ..-.|. ..+++-+++|.++|++||+++|.||+...+--.|.-+ ...  .+.||       +-.+||..+ .|+=
T Consensus       170 ~~P-~NPtG~-v~s~~~l~~l~~la~~~~i~visDEiY~~l~~~~~~~~s~~--~~~~~~~~~~i~~~S~SK~~~~~G~R  245 (397)
T PRK05794        170 NSP-NNPTGT-VYSKEELEEIAKFAKEHDLFIISDEIYEKLIYGEEEHISIA--SLSEDAFKRTVVINGMSKAYAMTGWR  245 (397)
T ss_pred             CCC-CCCCCC-CCCCHHHHHHHHHHHHCEEEEECHHHHHHHHCCCCCCCCHH--HHCHHHHCCCEECCCCCCCCCCCCCE
T ss_conf             899-898782-43506799999765410368843334577625898887889--95614320332026764444776522


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC----HHHHHCCHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             43210001112222233223453211110012334554320122210----11210000268899998867970755046
Q gi|254780432|r  253 IGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE----NVINIAKILFEGLTAIKNRFPNMFLEVRG  328 (392)
Q Consensus       253 ~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~----~~~~~g~~l~~~L~~l~~~~~~~v~~vRG  328 (392)
                      +|.+++.+++.+.+.......+...++++..++.+.|+--  ++.++    ..+++-+.+.+.|.    +.+++ .-++-
T Consensus       246 vG~~~~~~~~~~~~~~~~~~~~~~~~~~~q~a~~~al~~~--~~~~~~~~~~~~~rr~~l~~~l~----~~~g~-~~~~P  318 (397)
T PRK05794        246 IGYAASSLEIIKVMSNIQSHTTSNPNSIAQYASLEALNGD--QEQIKNMVEEFKKRRDYMVERIN----SIKGL-SCIKP  318 (397)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHH----HCCCC-EEECC
T ss_conf             5877558999999999998666897699999999998587--99999999999999999999986----07996-76068


Q ss_pred             CEEEEE-EEEC------------CCHHHHHHHHH-HCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             400999-8724------------99899999999-6898996268----9889955898688999999999999999985
Q gi|254780432|r  329 QGLLIG-LKTV------------FSPALLAAKFR-DECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       329 ~Gl~~~-ie~~------------~~~~~~~~~l~-~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      .|.++. +++.            .+...++..+. +.||.+.|..    ++.+|+.  +..++++|++++++|.+++.+|
T Consensus       319 ~g~~y~~~~~~~~~~~~~~~~~~~~~~~f~~~ll~~~gV~v~PG~~Fg~~~~vRl~--f~~~~e~l~eal~RL~~~l~~L  396 (397)
T PRK05794        319 KGAFYVMVNISKVIGKEIKGNTIKGSIDFANLLLEEENVAVVPGIAFGMDNYIRLS--YATSMENIEKGLDRIENFLNKL  396 (397)
T ss_pred             CEEEEEEEECHHHHCCCCCCCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHC
T ss_conf             81369958783442533468877899999999998499999818535899839999--8299999999999999999857


No 114
>KOG1359 consensus
Probab=99.72  E-value=3.4e-16  Score=126.32  Aligned_cols=331  Identities=18%  Similarity=0.230  Sum_probs=207.7

Q ss_pred             CEEEEEECCCEEEECCC--CEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCCCCC--CC---CCCHHHHHHHHHHHHH
Q ss_conf             74898501037996799--76464102267435787-89999999999997314506--87---5781899999865201
Q gi|254780432|r   15 DIRFEKGKGAWLFSENG--IPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLWHVS--NL---YQSTQQEIFANHLIHS   86 (392)
Q Consensus        15 p~~i~~a~G~~i~d~dG--~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~~~~--~~---~~~~~~~~la~~L~~~   86 (392)
                      --++++-.|..+. .+|  +++|.|+.   ++-||- +||+|++|-++++++.....  ..   .+......|..++.+.
T Consensus        49 erVi~s~q~p~i~-v~G~~k~ilnFca---NnYLGLsshPeii~a~~~aleeyGaGlssvrfIcGtq~iHk~LE~kiAqf  124 (417)
T KOG1359          49 ERVITSRQGPTIQ-VKGSDKKILNFCA---NNYLGLSSHPEIINAGQKALEEYGAGLSSVRFICGTQDIHKLLESKIAQF  124 (417)
T ss_pred             EEEEEECCCCEEE-EECCCCCEEEECC---CCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             0588614564499-8126655044224---54334457838889899999982878643168844557999999999987


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCHH
Q ss_conf             0133312356555403567776654320013478600234354656543212345532113479998643-332221002
Q gi|254780432|r   87 TFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIE-GFDQAKFCD  165 (392)
Q Consensus        87 ~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~-~~~~~~~~d  165 (392)
                      .+.+-...+.|+-+||-.++-..        .+.+.-|.+-+-. |-.    + +.|.         .+. ...++.-.|
T Consensus       125 h~rED~ilypscfdANag~feai--------l~pedAvfSDeLN-hAS----I-IdGi---------rLckry~h~dv~~  181 (417)
T KOG1359         125 HGREDTILYPSCFDANAGAFEAI--------LTPEDAVFSDELN-HAS----I-IDGI---------RLCKRYRHVDVFD  181 (417)
T ss_pred             HCCCCEEEECCCCCCCHHHHHHH--------CCHHHHHHCCCCC-CCH----H-HHHH---------HHHHHHCCCHHHH
T ss_conf             08775487331003443778774--------4825412100002-203----4-3246---------7776644512677


Q ss_pred             HHHHHH-HCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCC-CCCC-CCCCCCCCCCCCCC--CCCE
Q ss_conf             688754-10123322223332222112462101232211022345721310110-0344-44555310111245--4530
Q gi|254780432|r  166 LQSLKN-QISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV-QTGY-GRTGKLFAYEWANV--KPDI  240 (392)
Q Consensus       166 ~~~l~~-~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV-~tG~-GRtG~~f~~e~~gi--~PDi  240 (392)
                      +++... .-..+.--|..+.+.++.|++.|    |..+.+|.+|||.|+.+||. .||| |.||.- --|.+|+  .+||
T Consensus       182 l~~~l~~a~k~r~klv~TDg~FSMDGdiaP----l~ei~~La~kYgaLlfiDecHaTgf~G~tGrG-t~E~~~vm~~vdi  256 (417)
T KOG1359         182 LEHCLISACKMRLKLVVTDGVFSMDGDIAP----LEEISQLAKKYGALLFIDECHATGFFGETGRG-TAEEFGVMGDVDI  256 (417)
T ss_pred             HHHHHHHHHHHEEEEEEECCEECCCCCCCC----HHHHHHHHHHCCCEEEEEECCCCEEECCCCCC-HHHHHCCCCCCEE
T ss_conf             888777743321799985461214787333----89999999862937998604310565578887-3887377776402


Q ss_pred             E--ECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCHHHHHHHHHHHH-CCCCCCHHHHHCCHHHHHH
Q ss_conf             2--10344444---4344321000111222223322345321--1110012334554320-1222101121000026889
Q gi|254780432|r  241 M--TIAKGMGG---GFPIGACLATNEVAACMNQGSHGSTYGG--NVLAMVLGEKVLNIIQ-SDGFLENVINIAKILFEGL  312 (392)
Q Consensus       241 ~--~~gK~l~g---G~P~sav~~~~~i~~~~~~~~~~~T~~g--npl~~aaa~a~L~~l~-~~~l~~~~~~~g~~l~~~L  312 (392)
                      +  |+||+|||   ||    +.+..++.+.+++.+...-|+.  .|.....+.++++.+. ...++.+.+.+-++|++.+
T Consensus       257 insTLgKAlGga~GGy----ttgp~~li~llrqr~RpylFSnslppavV~~a~ka~dllm~s~~~i~~~~a~~qrfr~~m  332 (417)
T KOG1359         257 INSTLGKALGGASGGY----TTGPKPLISLLRQRSRPYLFSNSLPPAVVGMAAKAYDLLMVSSKEIQSRQANTQRFREFM  332 (417)
T ss_pred             HHHHHHHHHCCCCCCC----CCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             0424566624777887----468756899998528861421789805541569999999864799998988999999988


Q ss_pred             HHHHHHCCCEEEEECCC-----EEEEEEEECCCHHHHHHHHHHCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHH
Q ss_conf             99988679707550464-----00999872499899999999689899626-------8988995589868899999999
Q gi|254780432|r  313 TAIKNRFPNMFLEVRGQ-----GLLIGLKTVFSPALLAAKFRDECLLTAPS-------SDNVVRILPPLTITAEEIHEGL  380 (392)
Q Consensus       313 ~~l~~~~~~~v~~vRG~-----Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i  380 (392)
                      +.-     + + ++-|.     -+|+|  ...-.......++.+|+++.+.       +.-.||..-+-..|++|||+.+
T Consensus       333 e~a-----G-f-tIsg~~hPI~pv~lG--da~lA~~~ad~lLk~Gi~Vigfs~PvVP~gkariRVqiSAaHt~edid~~i  403 (417)
T KOG1359         333 EAA-----G-F-TISGASHPICPVMLG--DARLASKMADELLKRGIYVIGFSYPVVPKGKARIRVQISAAHTEEDIDRLI  403 (417)
T ss_pred             HHC-----C-C-EECCCCCCCCCEECC--CHHHHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEEEEEHHCCHHHHHHHH
T ss_conf             752-----8-2-431788874232316--388888889999855716986258767888447999970104788899999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999985
Q gi|254780432|r  381 ERIERTAIKL  390 (392)
Q Consensus       381 ~~l~~al~~L  390 (392)
                      ++|.++.+.+
T Consensus       404 ~Af~~vgr~~  413 (417)
T KOG1359         404 EAFSEVGRFL  413 (417)
T ss_pred             HHHHHHHHHH
T ss_conf             9999988752


No 115
>PRK07778 consensus
Probab=99.72  E-value=9e-16  Score=123.57  Aligned_cols=334  Identities=15%  Similarity=0.130  Sum_probs=197.4

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731--450687578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~--~~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.||+.-|-  -.+ -..+.|++|++++++..  .|+......+.+.++++.+.+..+    .+.++.++++++|.
T Consensus        27 ~~g~dvi~l~iG~--Pd~-~~P~~i~~a~~~a~~~~~~~Y~~~~G~p~LR~aia~~~~~~~g~~~~pe~I~vt~Ga~~al  103 (386)
T PRK07778         27 RTHGDLVNLSAGQ--PSA-GAPEPVRAAAAAALHRNQLGYTVALGIPELREAIAADYQRRHGITVEPDDVVVTTGSSGGF  103 (386)
T ss_pred             HCCCCEEECCCCC--CCC-CCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHHH
T ss_conf             6699907885989--999-8689999999998634999989997849999999999999868998855489817879999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++..-       .+| ..||..+-+|-+..............    -|..+.  .-...+++.+++ +.+++.++++
T Consensus       104 ~~~~~~l~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v~----vp~~~~--~~~~~~~~~l~~-~~~~~k~iil  168 (386)
T PRK07778        104 LLAFLACF-------DVG-DRVAMASPGYPCYRNILSALGCEVVE----IPCGPD--TRFQPTAAMLAE-LDPPVRGVIV  168 (386)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEE----CCCCCC--CCCCCHHHHHHH-CCCCCEEEEE
T ss_conf             99999964-------999-98998678651079999973982572----367744--566723889862-5866439998


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCCC
Q ss_conf             33222211246210123221102234572131011003444455531011124545302---1034444-4434432100
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GGFPIGACLA  258 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~  258 (392)
                      -.=+.--|. ..+++.+++|.++|++||+++|.||+...+--.|..+..-.++...+.+   .+||.++ .|+=+|.+++
T Consensus       169 ~~P~NPTG~-v~s~~~l~~l~~la~~~~i~iisDEiY~~l~~~~~~~~~~~~~~~~~~i~i~S~SK~~~~~G~RiG~~~~  247 (386)
T PRK07778        169 ASPANPTGT-VIAPEELAAIASWCEASGVRLISDEVYHGLVYEGAPPTSCAWETSREAVVVNSFSKYYAMTGWRLGWLLV  247 (386)
T ss_pred             CCCCCCCCC-CCHHHHHHHHHHHHHHCCEEEEECCCHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCEEEEEEE
T ss_conf             999898877-8507999999999853787999434325311589998643002478689993043112567760699984


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH---CCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEE-EE
Q ss_conf             01112222233223453211110012334554320---122210112100002688999988679707550464009-99
Q gi|254780432|r  259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQ---SDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLL-IG  334 (392)
Q Consensus       259 ~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~---~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~-~~  334 (392)
                      .+++++.+.......+...+.++-.++.+.+.--.   -+...++.++.-+.+.+.|+++     ++..-....|.+ +=
T Consensus       248 p~~l~~~~~~~~~~~~~~~~~~~Q~aa~~al~~~~~~~~~~~~~~~~~~r~~l~~~L~~~-----g~~~~~p~~G~fy~~  322 (386)
T PRK07778        248 PTELRRAVDRLTGNFTICPPALSQYAAVAAFTPEATAEADGHLAHYAENRRLLLDGLRAL-----GITRLAPADGAFYVY  322 (386)
T ss_pred             CHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CCCEECCCCEEEEEE
T ss_conf             899999999998507678778999999999560128999999999999999999999975-----995417998478997


Q ss_pred             EEEC---CCHHHHHHHHH-HCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8724---99899999999-689899626-------898899558986889999999999999999
Q gi|254780432|r  335 LKTV---FSPALLAAKFR-DECLLTAPS-------SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       335 ie~~---~~~~~~~~~l~-~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      +++.   .+...++.+|. +.||.+.|.       +++.|||+  +.-++++|++++++|++.++
T Consensus       323 ~~~~~~~~d~~~f~~~Ll~~~gV~v~PG~~Fg~~~g~~~vRls--f~~~~~~l~eal~RL~~~l~  385 (386)
T PRK07778        323 ADVSHLTDDSLAFCSKLLADTGVAIAPGIDFDTVRGNSFVRLS--FAGPTADIEEALRRIGSWLR  385 (386)
T ss_pred             EECCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHC
T ss_conf             8898889999999999998399999758566889999969999--83989999999999999965


No 116
>PRK05942 aspartate aminotransferase; Provisional
Probab=99.72  E-value=8e-16  Score=123.93  Aligned_cols=334  Identities=14%  Similarity=0.167  Sum_probs=196.5

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC---CCCCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314---50687578189999986520101----33-3123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW---HVSNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~---~~~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGse  100 (392)
                      .+|++.|++.-|  .-.+ .-++.|++|+.++++...   +.......+.+.++++.+.+..+    .+ .++.++++++
T Consensus        32 ~~G~~vi~L~iG--~Pd~-~~P~~v~~a~~~al~~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~~~p~~~v~vt~Ga~~  108 (394)
T PRK05942         32 EQGLDLIDLGMG--NPDG-AAPQPVIEAAIAALEDPQNHGYPPFEGTASFRQAITDWYHRRYGVELDPDSEALPLLGSKE  108 (394)
T ss_pred             HCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHH
T ss_conf             659981888598--9999-8889999999999838888898997685999999999999986898898875998888899


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |...+++..       -.+|. .||..+-+|................ -   |..  ...-...|++.+++.+.+++.++
T Consensus       109 al~~~~~al-------~~pGD-~Vlv~~P~Yp~y~~~~~~~g~~~~~-v---~l~--~~~~~~~d~~~l~~~i~~~tk~i  174 (394)
T PRK05942        109 GLTHLALAY-------VNPGD-VVLVPSPAYPAHFRGPLIAGAQIYP-I---ILK--PENDWLIDLSSIPEEVAQQAKIL  174 (394)
T ss_pred             HHHHHHHHH-------CCCCC-EEEECCCCCHHHHHHHHHCCCEEEE-E---EEC--CCCCCCCCHHHHHHHHHCCCCEE
T ss_conf             999999995-------79989-8997888867689999985998999-9---705--87688779999998611267089


Q ss_pred             CC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CCCCCCCCCCE----EECCCCCC-CCCCC
Q ss_conf             23-33222211246210123221102234572131011003444455531-01112454530----21034444-44344
Q gi|254780432|r  181 LI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AYEWANVKPDI----MTIAKGMG-GGFPI  253 (392)
Q Consensus       181 i~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~e~~gi~PDi----~~~gK~l~-gG~P~  253 (392)
                      ++ -| ..-.|. ..+++.+++|.++|++||+++|.||+...+---|.-+ +.-...-..|.    -.+||..+ .|+-+
T Consensus       175 il~~P-~NPTG~-v~~~e~l~~i~~~a~~~~i~vIsDEiY~~l~~dg~~~~s~~~~~~~~~~~i~~~S~SK~~~~~G~Ri  252 (394)
T PRK05942        175 YFNYP-SNPTTA-TAPREFFEEIVAFARKYEILLVHDLCYAELAFDGYQPTSLLEIPGAKDIGVEFHTLSKTYNMAGWRV  252 (394)
T ss_pred             EEECC-CCCCCH-HCCHHHHHHHHHHHHCCCCEEEECCCCCCEEECCCCCCCHHHCCCCCCCCEEECCCCCCCCCCCCCE
T ss_conf             99389-881012-2019999999998851786797037410025568766557655465344216603334567877425


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCE-
Q ss_conf             32100011122222332234532111100123345543201--222101121000026889999886797075504640-
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQG-  330 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G-  330 (392)
                      |.+++.+++++.+.......+++.+...-.++.+.|+.-++  +.+.++.+++-+.+.+.|.++     ++ .-....| 
T Consensus       253 G~ii~~~~~i~~l~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~~~~rrd~l~~~L~~~-----g~-~~~~p~g~  326 (394)
T PRK05942        253 GFVVGNRDIIQGLRTLKTNLDYGIFSALQKAAETALQLPDSYLQQVQERYRQRRDFLIQGLGEL-----GW-DIPPTKAT  326 (394)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CC-EECCCCEE
T ss_conf             9986799999999999985345767699999999985847789999999999999999989876-----96-75378858


Q ss_pred             EEEEEEEC--CCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             09998724--99899999999-689899626------8988995589868899999999999999998
Q gi|254780432|r  331 LLIGLKTV--FSPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       331 l~~~ie~~--~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      +++=+++.  .+...++.++. +.||.+.|.      +++.+||+  +..++++|++++++|++++.+
T Consensus       327 ~y~w~~~~~~~~~~~f~~~ll~~~gV~v~PG~~Fg~~g~~~iRls--f~~~~~~l~ea~~Rl~~a~~r  392 (394)
T PRK05942        327 MYLWVPCPVGMGSTDFALNVLQKTGVVVTPGNAFGEGGEGYVRIS--LIADCDRLGEALHRIKQAGIR  392 (394)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHH
T ss_conf             899886899979899999999849999988731178999879999--718899999999999999985


No 117
>PRK07683 aminotransferase A; Validated
Probab=99.72  E-value=1.9e-15  Score=121.43  Aligned_cols=334  Identities=14%  Similarity=0.142  Sum_probs=197.7

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCCCH
Q ss_conf             99764641022674357878999999999999731--450687578189999986520101----33-312356555403
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAESV  102 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~--~~~~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGseA~  102 (392)
                      ++...|++.-|  ...+ -..|.|++|+++.++..  .|.......+.+..+++.+.+..+    .+ .++.++++++|.
T Consensus        26 ~~~dvI~l~ig--~pdf-~~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lreaia~~~~~~~g~~~~~~~~I~it~G~~~al  102 (387)
T PRK07683         26 NYDNLISLTIG--QPDF-PTPSHVKEAAKRAIDENYTSYTHNAGLLELRKAACNFVKDKYDLHYSPESEIIVTIGASEAI  102 (387)
T ss_pred             CCCCEEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHH
T ss_conf             79991899999--8999-97899999999998579998899988799999999999998589989887599927829999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.--       .+| ..|+..+-+|.+...........+.+-    |..+   .-...|.+.+++.+.+++.++++
T Consensus       103 ~~~~~~~~-------~pG-D~Vlv~~P~Y~~~~~~~~~~g~~~v~v----~~~~---~~~~~d~~~le~~~~~~~k~iil  167 (387)
T PRK07683        103 DIAFRTIL-------EPG-TEVILPAPIYPGYEPIIRLCGATPVFI----DTRE---TGFRLTAEALENAITEKTRCVVL  167 (387)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEEC----CCCC---CCCCCCHHHHHHHCCCCCCEEEE
T ss_conf             99999976-------999-989983787665699999708723536----8786---78878999999735525757864


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCE----EECCCCCC-CCCCCCCCC
Q ss_conf             3322221124621012322110223457213101100344445553101112454530----21034444-443443210
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI----MTIAKGMG-GGFPIGACL  257 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi----~~~gK~l~-gG~P~sav~  257 (392)
                      -.-+.-.|. ..+.+.+++|.++|++||+++|.|||..-+---|.....-.+.-.+|-    -.+||..+ .|+-+|.++
T Consensus       168 ~~P~NPtG~-v~s~e~l~~i~~la~~~~i~ii~DEiY~~l~~~~~~~s~~~~~~~~~~~i~~~S~SK~~~~~G~RiG~i~  246 (387)
T PRK07683        168 PYPSNPTGV-TLSKEELKDIANVLKDKNIFVLSDEIYSELVYDQPHTSIAHFPEMREKTIVINGLSKSHSMTGWRIGFLF  246 (387)
T ss_pred             CCCCCCCCC-CCCHHHHHHHHHHHHCCCCEEECCCCHHHHHCCCCCCCHHHCCCCCCEEEEEECCCCCCCCCCCCEEEEE
T ss_conf             799598978-8789999999997613694475465135540699877643344555403675044101367652279997


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC--CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEE-
Q ss_conf             00111222223322345321111001233455432012--221011210000268899998867970755046400999-
Q gi|254780432|r  258 ATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD--GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG-  334 (392)
Q Consensus       258 ~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~--~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~-  334 (392)
                      +.+++++.+.......+...++++-.++.+.++.-.++  .+.++.++.-+.+.+.|.+.     ++ .-++..|.++. 
T Consensus       247 ~~~~~~~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~~~~r~~~~~~~L~~~-----g~-~~~~P~G~~~~w  320 (387)
T PRK07683        247 APSYLAKHILKVHQYNVTCASSISQYAALEALTAGKDDAKMMRHQYKKRRDYVYNRLISM-----GL-DVEKPTGAFYIF  320 (387)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CC-CEECCCEEEEEE
T ss_conf             599999999999975657886899999999997698899999999999999999999876-----99-556788127996


Q ss_pred             EEEC---CCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8724---99899999999-689899626------89889955898688999999999999999985
Q gi|254780432|r  335 LKTV---FSPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       335 ie~~---~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +++.   .+...++..+. +.||.+.|.      +++.+||+  +..++++|++++++|++++.+-
T Consensus       321 ~~~~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~g~g~~Rls--fa~~~e~l~eal~Rl~~~l~~~  384 (387)
T PRK07683        321 PSIGHFTMSSFDFALDLVEEAGLAVVPGSAFSEYGEGYVRLS--YAYSIETLKEGLDRLEAFLQKK  384 (387)
T ss_pred             EECCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHH
T ss_conf             787888999799999999839999987842288998869999--7199999999999999999987


No 118
>pfam00155 Aminotran_1_2 Aminotransferase class I and II.
Probab=99.72  E-value=5.1e-16  Score=125.19  Aligned_cols=323  Identities=19%  Similarity=0.214  Sum_probs=183.2

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCC-----HHHHHHHHHHHHHCC----CC-CCCCCCCCCCC
Q ss_conf             764641022674357878999999999999731450687578-----189999986520101----33-31235655540
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQS-----TQQEIFANHLIHSTF----AD-RVFFTNSGAES  101 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~-----~~~~~la~~L~~~~~----~~-~v~f~~SGseA  101 (392)
                      +++|+|.+|  . +++--+|+|++|++++++....  +.|.+     +.+..+|+.+....+    .+ .++++++.+++
T Consensus         1 ~d~i~l~~~--~-~~~~~~p~v~~A~~~a~~~~~~--~~Y~~~~G~~~LR~aia~~~~~~~~~~~~~e~~I~~t~G~~~~   75 (351)
T pfam00155         1 TDKINLGSN--E-YLGDTLPAVAKAEKDALAGGTR--NLYGPTDGLPELREALAKFLGRSPVLKLDREAAVVFGSGAGAN   75 (351)
T ss_pred             CCEEEEECC--C-CCCCCCHHHHHHHHHHHCCCCC--CCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCHHHH
T ss_conf             970893389--9-9999889999999999749999--8079818789999999998601029999947489981139999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             35677766543200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       102 ~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
                      ...+++.--       .+| +.|+..+.+|.+.............. -   |..+  ..-...|++.+++.+.+++.+++
T Consensus        76 l~~~~~~l~-------~~g-d~Vli~~P~y~~~~~~~~~~g~~~~~-~---~~~~--~~~~~~d~~~l~~~~~~~~~~i~  141 (351)
T pfam00155        76 IEALIFLLA-------NPG-DAILVPAPTYASYIRIARLAGGEVVR-Y---PLYD--SNDFHLDFDALEAALKEKPKVVL  141 (351)
T ss_pred             HHHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHCCCEEEE-E---ECCC--CCCCCCCHHHHHHHCCCCCEEEE
T ss_conf             999999966-------994-99998899868899999983997789-8---4564--34779899999975415986999


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-CC-CCCCCC-EE--ECCCCCC-CCCCCCC
Q ss_conf             33322221124621012322110223457213101100344445553101-11-245453-02--1034444-4434432
Q gi|254780432|r  182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-EW-ANVKPD-IM--TIAKGMG-GGFPIGA  255 (392)
Q Consensus       182 ~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~-~gi~PD-i~--~~gK~l~-gG~P~sa  255 (392)
                      +..-+.--|. ..+.+.+++|.++|++|++++|.||+...+...+.-+.. .. .+-.+. |+  .+||.++ .|+-+|.
T Consensus       142 i~~P~NPTG~-~~~~~~l~~l~~~a~~~~~~ii~DE~Y~~~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~~~~G~R~G~  220 (351)
T pfam00155       142 HESPHNPTGT-VAPLEELEKLLDLAKEHNILLLVDEAYAGFVFGSPDAVATRALLAEGPNLLVVGSFSKAFGLAGWRVGY  220 (351)
T ss_pred             ECCCCCCCCC-CCCHHHHHHHHHHHCCCCEEEEEECCCCCEECCCCCCCCHHHHCCCCCCEEEEECCHHHCCCCCCCEEE
T ss_conf             8899198777-768899999986530288899982663331527988861333114578679991361523793515599


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-HHC----CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCE
Q ss_conf             100011122222332234532111100123345543-201----222101121000026889999886797075504640
Q gi|254780432|r  256 CLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNI-IQS----DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQG  330 (392)
Q Consensus       256 v~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~-l~~----~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G  330 (392)
                      +++.+++++.+........ ..+|. ..++.+.+.- ...    +.+.++.++.-+++.+.|+++     ++ .-....|
T Consensus       221 i~~~~~~i~~l~~~~~~~~-~s~~~-~~~~~~~l~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~~-----g~-~~~~p~g  292 (351)
T pfam00155       221 ILGNAAVISQLRKLARPFY-SSTHL-QAAAAAALSDPLLVASELEEMRQRIKERRDYLRDGLEAA-----GL-SVLPSQA  292 (351)
T ss_pred             EEECHHHHHHHHHHHCCCC-CCHHH-HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CC-EECCCCC
T ss_conf             9989999999999716687-47899-999999995845568999999999999999999999878-----98-5727994


Q ss_pred             EEEE-EEEC-CCHHHHHHHHHH-CCEEEEEC----CCCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             0999-8724-998999999996-89899626----8988995589868899999999999
Q gi|254780432|r  331 LLIG-LKTV-FSPALLAAKFRD-ECLLTAPS----SDNVVRILPPLTITAEEIHEGLERI  383 (392)
Q Consensus       331 l~~~-ie~~-~~~~~~~~~l~~-~Gll~~~~----~~~~irl~Ppl~it~~eid~~i~~l  383 (392)
                      -++. +++. .....+..++++ .||.+.|.    .++.+|++-. ..|+++|++++++|
T Consensus       293 ~~~~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~fg~~~~iRis~a-~~s~e~i~~~~~rl  351 (351)
T pfam00155       293 GFFLLTGLDPETAKELAQVLLEEVGVYVTPGSSPGVPGWLRITVA-GGTEEELEELLEAI  351 (351)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHCCCEEEECCCCCCCCCEEEEEEC-CCCHHHHHHHHHHC
T ss_conf             499999787322999999999759899977888899990899817-89999999999419


No 119
>PRK08443 consensus
Probab=99.72  E-value=2.1e-15  Score=121.22  Aligned_cols=337  Identities=16%  Similarity=0.171  Sum_probs=197.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCC-CCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731-4506-87578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVS-NLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~-~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      .+|++.|++..|-  -.+. ..|.|++|+.+.++.- ..++ .....+.+..+++.+.+..+    .+.++.++++.+|.
T Consensus        26 ~~g~dvi~l~~G~--pd~~-~p~~i~~a~~~a~~~~~~~Y~~~~G~~~lr~aia~~~~~~~g~~~~pe~I~it~G~~~al  102 (388)
T PRK08443         26 AKGKDILSFSAGE--PDFD-TPQAIKDAAIKAIEKGFTKYTAVAGIPELLKAIATKLKKDNNLDYETNEIITSNGAKHSL  102 (388)
T ss_pred             HCCCCEEECCCCC--CCCC-CCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHEEEECCCHHHHH
T ss_conf             5699848898998--9998-799999999999855999889998879999999999999858998831299868879999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-
Q ss_conf             5677766543200134786002343546565432123455321134799986433322210026887541012332222-
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL-  181 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi-  181 (392)
                      ..+++.--       .+| ..|+..+.+|.+...........+..-    |..+  ..--..|.+.+++.+.+++-+++ 
T Consensus       103 ~~~~~al~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v~v----~~~~--~~~~~~d~~~l~~~i~~~~k~iil  168 (388)
T PRK08443        103 FNVFQALI-------EKG-DEVIIPSPYWVTYPELVKYSGGVPVFI----ETDE--ENGFKITAEQLKKAITPKTKVLVL  168 (388)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHHCCEEEEE----EECC--CCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999980-------999-989982687442399999808847998----6554--348677999999747878739998


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC-------EEECCCCCC-CCCCC
Q ss_conf             3332222112462101232211022345721310110034444555310111245453-------021034444-44344
Q gi|254780432|r  182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD-------IMTIAKGMG-GGFPI  253 (392)
Q Consensus       182 ~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD-------i~~~gK~l~-gG~P~  253 (392)
                      .-| +.-.|. ..+++-+++|.++|++||+++|.||+...+--.|++-..  ..+.||       +-.+||.++ .|+=+
T Consensus       169 ~~P-~NPTG~-v~s~~~l~~l~~~a~~~~~~ii~DE~Y~~l~~~~~~~~~--~~~~~~~~~~~I~i~S~SK~~~~~G~Ri  244 (388)
T PRK08443        169 NTP-SNPTGS-VYSKEELEAIAKVLKGTDIWVLSDEMYEKLVYDGEFVSV--ASVSEDMFKRTITINGLSKSVAMTGWRF  244 (388)
T ss_pred             CCC-CCCCCC-CCCHHHHHHHHHHHHCCCCEEECCHHHHHHCCCCCCCCH--HHHHCCCCCCEEEECCCCHHCCCCCCCE
T ss_conf             689-899884-764478999999862357567422012432269987888--9972224467899803432005865146


Q ss_pred             CCCCCC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEE
Q ss_conf             321000-1112222233223453211110012334554320122210112100002688999988679707550464009
Q gi|254780432|r  254 GACLAT-NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLL  332 (392)
Q Consensus       254 sav~~~-~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~  332 (392)
                      |.+++. +++.+.+.......+...+.+.-.++.+.++-- .++.+++.++.=+.-++.+.+..++.+++ .-++..|.+
T Consensus       245 G~~~~p~~~l~~~~~~~~~~~~~~~~~~~q~aa~~al~~~-~~~~~~~~~~~~~~~r~~~~~~l~~~~g~-~~~~P~g~~  322 (388)
T PRK08443        245 GYMASKNKKLIKAMKKLQSQSTSNINSITQKAAIPALNGE-CDKDIEKMRQAFEKRRDLAVDAINAIPGL-SVYKPDGAF  322 (388)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHHCCCC-EEECCCEEE
T ss_conf             9998186999999999974467870179999999998545-24789999999999999999998747896-761688347


Q ss_pred             -EEEEEC---CCHHHHHHHHH-HCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             -998724---99899999999-6898996268----9889955898688999999999999999985
Q gi|254780432|r  333 -IGLKTV---FSPALLAAKFR-DECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       333 -~~ie~~---~~~~~~~~~l~-~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                       +=+++.   .+...+++.+. +.||.+.|..    ++.+|++  +..++++|++++++|.+.+++.
T Consensus       323 ~~w~~~~~~~~d~~~f~~~ll~~~gV~v~PG~~Fg~~g~vRl~--~~~~~e~l~ea~~RL~~~l~~~  387 (388)
T PRK08443        323 YLFVNIKKIEKDSMKFCKKLLEQEGVAVVPGIGFGMEGYFRLS--FATSIESIKKGIERIANFVKSY  387 (388)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHC
T ss_conf             9978888889999999999998199999727435889859999--8288999999999999999964


No 120
>PRK06348 aspartate aminotransferase; Provisional
Probab=99.71  E-value=1.7e-15  Score=121.85  Aligned_cols=329  Identities=16%  Similarity=0.194  Sum_probs=196.7

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-C-CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCHHHH
Q ss_conf             764641022674357878999999999999731-4-50687578189999986520101----33312356555403567
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-W-HVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESVECA  105 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~-~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~e~A  105 (392)
                      ...|++.-|  .-.+ -..|+|++|+.+.++.. . |.......+.+..+++.+.+..+    .+.++.++++++|...+
T Consensus        29 pDvI~l~~g--~pdf-~~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lR~aia~~~~~~~g~~~~~~~I~it~G~~~al~~~  105 (383)
T PRK06348         29 PDIIDLSLG--DPDL-ITDESIIQAAFEDAKKGHTRYTDSTGDKELIEEIINYYKKDYNLSFKENEIMAVVGACHGMYLA  105 (383)
T ss_pred             CCEEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEEECCHHHHHHHH
T ss_conf             992889996--8899-9889999999999862899889986899999999999999878999767499948989999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-CC
Q ss_conf             77665432001347860023435465654321234553211347999864333222100268875410123322223-33
Q gi|254780432|r  106 IKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI-EP  184 (392)
Q Consensus       106 iklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~-Ep  184 (392)
                      ++.--       .+| +.|+..+-+|.+-........+....    -|..+.  .-...|++.+++.+.+++-++++ -|
T Consensus       106 ~~~l~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v~----~~~~~~--~~~~~d~~~le~~i~~~tk~iil~~P  171 (383)
T PRK06348        106 LQSIL-------DPG-DEVIIHEPYFTPYKDQVEMVGGKPII----FETYEE--DGFQINVDKLEALITSKTKAIILNSP  171 (383)
T ss_pred             HHHHC-------CCC-CEEEEECCCCCHHHHHHHHHCCCEEE----CCCCCC--CCCCCCHHHHHHHCCCCCEEEEECCC
T ss_conf             99965-------999-98998069860269999980886253----244566--68657968989856878729998999


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCE----EECCCCCC-CCCCCCCCCCC
Q ss_conf             22221124621012322110223457213101100344445553101112454530----21034444-44344321000
Q gi|254780432|r  185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI----MTIAKGMG-GGFPIGACLAT  259 (392)
Q Consensus       185 v~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi----~~~gK~l~-gG~P~sav~~~  259 (392)
                       ..-.|. ..+++.+++|.++|++||+++|.||+...+--.+.+-....+.-.+|-    -.+||..+ .|+-+|.+++.
T Consensus       172 -~NPTG~-v~~~e~l~~l~~la~~~~i~visDEiY~~l~~~~~~~p~~~~~~~~~~~I~~~S~SK~~~~~G~RiG~~i~p  249 (383)
T PRK06348        172 -NNPTGA-VFSKETLEEIAKVAIENDLVIISDEVYDGFTFYEDFCPMASLAGMKERTITFGSFSKDFAMTGWRIGYVIAP  249 (383)
T ss_pred             -CCCCCC-CCCHHHHHHHHHHHHHCCEEEEECCCHHHHCCCCCCCCHHHCCCCCCEEEEEECCHHHCCCCCCEEEEEEEC
T ss_conf             -798888-777789999997653068699851433442038999883222566651899921423115888607999827


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEE-EEEE
Q ss_conf             11122222332234532111100123345543201--22210112100002688999988679707550464009-9987
Q gi|254780432|r  260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLL-IGLK  336 (392)
Q Consensus       260 ~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~-~~ie  336 (392)
                      +++.+.+.....+.+++.+.++..++.+.|+.-++  +.+.+..+++-+++.+.|++    .|.+ .-....|-| +=++
T Consensus       250 ~~~~~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~~~~r~~~~~~~l~~----~~~~-~~~~p~G~~y~w~~  324 (383)
T PRK06348        250 DYIINTMKNINEGICFSAPTISQRAAIYALKHRDTIVPPIKEEFQKRMEYAYSRIES----IPKL-SLHPPKGSIYAFIN  324 (383)
T ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH----CCCC-EECCCCEEEEEEEE
T ss_conf             999999999973176668729999999998586999999999999999999999974----8995-76178816799788


Q ss_pred             EC---CCHHHHHHHHHH-CCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             24---998999999996-89899626------8988995589868899999999999999
Q gi|254780432|r  337 TV---FSPALLAAKFRD-ECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       337 ~~---~~~~~~~~~l~~-~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~a  386 (392)
                      +.   .++..+++++.+ .||.+.|.      +++.+|++  +..++++|++++++|++.
T Consensus       325 ~~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~g~~~iRls--~~~~~~~l~ea~~Rl~k~  382 (383)
T PRK06348        325 IKKTGLSSVEFCEYLLKEAHVLVIPGKAFGKSGEGYIRLA--CTVGLEELEEAFNRIEKM  382 (383)
T ss_pred             CCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHHC
T ss_conf             9999989999999999868999978545488999979999--848999999999999741


No 121
>PRK06375 consensus
Probab=99.71  E-value=1.7e-15  Score=121.77  Aligned_cols=334  Identities=16%  Similarity=0.194  Sum_probs=197.1

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-C-CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731-4-50687578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-W-HVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~-~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      .+|++.|++.-|  --.+ ..+|.|++|+.+.++.. . +++.....+.+..+++.+.+..+    .+.++.+ +|+++.
T Consensus        26 ~~G~dvi~l~iG--~pdf-~~P~~i~~a~~~~~~~~~~~Y~~~~G~~~lR~aia~~~~~~~g~~~~~~~i~vt-~~~~~l  101 (381)
T PRK06375         26 KQGKKLYNFGIG--EPDF-TTPDNIIKYAFEMAKSGKTHYTPSAGIPELREKIALKLKSRNNIDAVAKNVLVT-PTKFGI  101 (381)
T ss_pred             HCCCCCEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEE-CHHHHH
T ss_conf             779970773899--9999-868999999999973799888999986999999999999855999995769985-489999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++..-       .+| +.||..+-+|.+.........+++..    -+.    ......|++.+++.+.+++-++++
T Consensus       102 ~~~~~~l~-------~pG-D~Vii~~P~Y~~y~~~~~~~g~~~v~----~~~----~~~~~~d~~~l~~~i~~~tk~i~l  165 (381)
T PRK06375        102 NLAMMVIL-------NPG-DEVLIPSPYYVSYPDIVKLAGGKPVF----VDT----DDDYNIDIDNMRKAVTPKTRAIII  165 (381)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHHCCEEEE----EEC----CCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999866-------999-98998188876199999981997764----203----887797999999637867749998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC--EE--ECCCCCC-CCCCCCCC
Q ss_conf             -332222112462101232211022345721310110034444555310111245453--02--1034444-44344321
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD--IM--TIAKGMG-GGFPIGAC  256 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD--i~--~~gK~l~-gG~P~sav  256 (392)
                       -|- .--|. ..+++-+++|.++|++||+++|.|||...+--.|+.+..-...-..|  |+  .+||.++ .|+=+|.+
T Consensus       166 ~nP~-NPTG~-v~s~e~l~~i~~la~~~~i~iIsDEiY~~l~~~g~~~~~~~~~~~~~~~I~~~S~SK~~~~~G~RiG~~  243 (381)
T PRK06375        166 NNPV-NPTGK-VLSEKEIRELVDFALENNLYIVSDEIYEDLIYRGKLFSPASIPEAFDKTITLNGFSKGYAMTGWRIGYM  243 (381)
T ss_pred             CCCC-CCCCC-CCCHHHHHHHHHHHHHCEEEEEECCCHHHHCCCCCCCCHHHHHHHHCCEEEEEHHHHHHHCCCCCEEEE
T ss_conf             9997-98899-999999999999887565899813205755169987785340211065799841022433146555999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEE-
Q ss_conf             0001112222233223453211110012334554320122210112100002688999988679707550464009998-
Q gi|254780432|r  257 LATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL-  335 (392)
Q Consensus       257 ~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~i-  335 (392)
                      ++.+++++.+.......+...+.++-.++.+.++   +++..++.++.=+.-++.+.+..++.+++ .-.+-.|.++.+ 
T Consensus       244 i~~~~~i~~~~~~~~~~~~~~~~~~q~aa~~al~---~~~~~~~~~~~~~~rr~~~~~~l~~~~~~-~~~~P~G~~~~~~  319 (381)
T PRK06375        244 VAPEEIVEAANKIQQQTITCASSISQYAALRALD---DDESPKHMREEFEKRRDLVVSILKESDNL-HVYEPEGAFYVFP  319 (381)
T ss_pred             EECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC---CCHHHHHHHHHHHHHHHHHHHHHHHCCCC-EEECCCEEEEEEE
T ss_conf             8389999999999975446756299999999962---82779999999999999999998518997-7956781489956


Q ss_pred             EECC--CHHHHHHHH-HHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             7249--989999999-9689899626------89889955898688999999999999999985
Q gi|254780432|r  336 KTVF--SPALLAAKF-RDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       336 e~~~--~~~~~~~~l-~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      ++..  +...++..+ .+.||.+.|.      +++.+|+.  +..++++|++++++|.+.++.|
T Consensus       320 ~~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~g~~~~Ri~--~a~~~e~l~ea~~RL~~~~~~l  381 (381)
T PRK06375        320 GYESDIKSYKAAENLLENKNVVVTPGSAFGRQGEHHFRIS--FATSEDIIKEGIERIGKFFKSI  381 (381)
T ss_pred             ECCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHC
T ss_conf             0799989899999999859999978735488999979999--8199999999999999999859


No 122
>PRK08362 consensus
Probab=99.71  E-value=1.7e-15  Score=121.80  Aligned_cols=335  Identities=16%  Similarity=0.171  Sum_probs=194.3

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCC-CCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCCCH
Q ss_conf             99764641022674357878999999999999731-4506-87578189999986520101----33-312356555403
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVS-NLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAESV  102 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~-~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGseA~  102 (392)
                      ..++.|++.-|  -..+. ..|.|.+|+++.++.. .+++ +....+.+.++++.+.+..+    .+ .++.++++++|.
T Consensus        24 ~~~dvI~l~~g--~pd~~-~p~~i~~a~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g~~~~p~~~i~it~G~~~al  100 (389)
T PRK08362         24 GMKDVISLGIG--EPDFD-TPQHIKEYAKEALDKGLTHYGPNIGLPELREAIAEKLKKQNGIEADPKKEIMVLVGANQAF  100 (389)
T ss_pred             CCCCEEECCCC--CCCCC-CCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCHHHHH
T ss_conf             89980899999--79998-7899999999998558768899857099999999999884099999764399818869999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.--       .+| ..|+..+-+|.+.........+....    -|..+  +.--..|++.+++.+.+++-++++
T Consensus       101 ~~~~~~l~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v~----vp~~~--~~~~~~d~~~l~~~i~~~~k~iil  166 (389)
T PRK08362        101 LMGLATFL-------KDG-EEVLIPSPMFVSYAPAVILAGGKPVE----VPTYE--ENEFRLNVDDLKKYVTEKTRALII  166 (389)
T ss_pred             HHHHHHHC-------CCC-CEEEEECCCCCCHHHHHHHCCCEEEE----EECCC--CCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999975-------899-98998158654268999974998999----85457--778876999999745446829998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CCCCCCCCCC----EEECCCCCC-CCCCCCC
Q ss_conf             -33222211246210123221102234572131011003444455531-0111245453----021034444-4434432
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AYEWANVKPD----IMTIAKGMG-GGFPIGA  255 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~e~~gi~PD----i~~~gK~l~-gG~P~sa  255 (392)
                       -| +.-.|. ..+++-+++|.++|++||+++|.||+...+--.|.-+ .....+-.+|    +-.+||.++ .|+-+|.
T Consensus       167 ~~P-~NPtG~-v~s~~~l~~i~~~a~~~~~~ii~DEiY~~l~~~~~~~~s~~~~~~~~~~~i~~~S~SK~~~l~G~RiG~  244 (389)
T PRK08362        167 NSP-NNPTGS-VLTKKDLEEIADFAVEHDLMVISDEVYEHFIYDGVKHYSIASLDGMFERTITVNGFSKTFAMTGWRLGF  244 (389)
T ss_pred             CCC-CCCCCC-CCHHHHHHHHHHHHHHCCEEEEECCCHHHHCCCCCCCCCHHHCCCCCCCEEEECCCHHHCCCCCCCEEE
T ss_conf             489-898474-631999999999987549579814645641018977768666045445202303310101687653699


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHH---HHHCCCEEEEECCCEEE
Q ss_conf             100011122222332234532111100123345543201222101121000026889999---88679707550464009
Q gi|254780432|r  256 CLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAI---KNRFPNMFLEVRGQGLL  332 (392)
Q Consensus       256 v~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l---~~~~~~~v~~vRG~Gl~  332 (392)
                      +++.+++.+.+.......+...+.+.-.++.+.|+   +....+.+.++-+.+.++.+-+   ..++ + +..++..|.+
T Consensus       245 ~i~~~~~i~~~~~~~~~~~~~~~~~~q~a~~~al~---~~~~~~~~~~~~~~~~~~r~~~~~~l~~~-g-~~~~~P~g~~  319 (389)
T PRK08362        245 VAAPSWVIEKMVKFQMYNATCPVTFIQYAAAKALR---DERSWKAVEEMRKEYDRRRNLVWKRLNEM-G-LPTVKPKGAF  319 (389)
T ss_pred             EECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH---CCHHHHHHHHHHHHHHHHHHHHHHHHHHC-C-CCEECCCEEE
T ss_conf             98089999999999986047886599999999985---97047999998788999999999988875-9-9555788258


Q ss_pred             EE-EEEC---CCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99-8724---99899999999-689899626------89889955898688999999999999999985
Q gi|254780432|r  333 IG-LKTV---FSPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       333 ~~-ie~~---~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +. +++.   .+...+++.++ +.||.+.|.      +++.+|+.  +..++++|++++++|+++++|.
T Consensus       320 ~~w~~~~~~~~~~~~~~~~ll~e~gV~~~PG~~Fg~~~~~~~Rl~--~a~~~e~l~ea~~RL~~~l~e~  386 (389)
T PRK08362        320 YIFPRIRDTGLTSKEFSELMLKEAKVAVVPGSAFGKAGEGYIRIS--YATAYEKLEEAMDRMEKVLKEK  386 (389)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHC
T ss_conf             994788888989999999999829999986733388998979999--7199999999999999999855


No 123
>PRK03566 consensus
Probab=99.70  E-value=2e-15  Score=121.35  Aligned_cols=321  Identities=18%  Similarity=0.258  Sum_probs=203.9

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHH
Q ss_conf             764641022674357878999999999999731450687578189999986520101--333123565554035677766
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTA  109 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aikla  109 (392)
                      ++.||+.++  -+.+|-. |.+++|++++++.+.    .|..+...+|-+.|.+..+  .+.+..+++.+|+...+++..
T Consensus        32 ~~~i~l~~N--eNp~gp~-~~v~~a~~~~~~~~~----~YPd~~~~~Lr~aiA~~~gv~~~~I~v~~Gs~e~i~l~~~a~  104 (365)
T PRK03566         32 SDIVKLASN--ENPLGPS-PKALEAIRAALSELH----RYPDGNGFELKAALAEKLGVPPEQITLGNGSNDLLELLARAF  104 (365)
T ss_pred             CCEEEEECC--CCCCCCC-HHHHHHHHHHHHHCC----CCCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHHHH
T ss_conf             887882188--9998989-999999999888616----695966899999999997848667998778999999999985


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCCCCCC
Q ss_conf             543200134786002343546565432123455321134799986433322210026887541012332222-3332222
Q gi|254780432|r  110 RRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL-IEPIQGE  188 (392)
Q Consensus       110 r~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi-~Epv~g~  188 (392)
                      -       .+| +.|+..+.+|-.-...+......... -   |. .++    -.|++.+.+.+.++.-.++ ..|= .-
T Consensus       105 ~-------~pG-d~Vl~~~P~y~~Y~~~~~~~g~~~~~-v---p~-~~~----~~dl~~l~~~i~~~~klv~l~nPn-NP  166 (365)
T PRK03566        105 L-------GPG-DEIIYSQYAFAVYPLATQAVGARAVE-V---PA-KDY----GHDLEAMLAAITPKTRLVFIANPN-NP  166 (365)
T ss_pred             C-------CCC-CEEEECCCCHHHHHHHHHHCCCEEEE-E---CC-CCC----CCCHHHHHHHCCCCCCEEEECCCC-CC
T ss_conf             5-------899-87676688668999999981974899-6---17-676----769588998638888689977999-98


Q ss_pred             CCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CCCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             11246210123221102234572131011003444455531-011124545302---1034444-443443210001112
Q gi|254780432|r  189 GGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AYEWANVKPDIM---TIAKGMG-GGFPIGACLATNEVA  263 (392)
Q Consensus       189 ~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~i~  263 (392)
                      .|. ..+++-++++.+.|.++ +++|+||....|..-+... +....+--|.++   +|||..+ .|+-+|.+++++++.
T Consensus       167 TG~-~~~~~~l~~l~~~~~~~-~~vV~DEaY~ef~~~~~~~~~~~~~~~~~n~iv~rSfSK~~glaGlRiGy~ia~~~li  244 (365)
T PRK03566        167 TGT-FLSAAELEAFLAKVPPD-VLVVLDEAYTEYAAPEERPDSLAWLKKYPNLVVSRTFSKAYGLAGLRVGYAVSNPEIA  244 (365)
T ss_pred             CCC-CCCCHHHHHHHHHCCCC-CEEEEECCHHHHCCCCCCCCHHHHHHHCCCEEEEEECCHHCCCCCHHHEEEECCHHHH
T ss_conf             877-35706589999754567-4498524577750477777788876413772598545452057573014101699999


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCHHH
Q ss_conf             22223322345321111001233455432012221011210000268899998867970755046400999872499899
Q gi|254780432|r  264 ACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL  343 (392)
Q Consensus       264 ~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~~~  343 (392)
                      +.+....  ..|+-|.++..||.+.|+   +++++++..+.-+.-++.+.+..+++ ++ .-+-..|.++-+++..+...
T Consensus       245 ~~l~~~~--~p~~vn~~aq~aa~aaL~---~~~~~~~~~~~~~~~r~~l~~~L~~~-g~-~~~ps~~nF~l~~~~~~~~~  317 (365)
T PRK03566        245 DLLNRVR--QPFNVNSLALAAAVAALD---DDDFLAKSRELNRAGMQQLEAGFDAL-GL-EYIPSKGNFVTVDVGRDAAA  317 (365)
T ss_pred             HHHHHHC--CCCCCCHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCEEEEEECCCCHHH
T ss_conf             9999961--888977999999999958---99999999999998999999999978-79-88789980899978999999


Q ss_pred             HHHHHHHCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9999996898996268----988995589868899999999999999998
Q gi|254780432|r  344 LAAKFRDECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       344 ~~~~l~~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      +.++++++|+++++..    ++.+|++   +=|.+|.++++++|++.|.|
T Consensus       318 l~~~L~~~gV~Vrp~~~fgl~~~lRis---~g~~een~~l~~aL~~il~e  364 (365)
T PRK03566        318 IYQALLRQGVIVRPVAGYGMPNHLRVS---IGLPEENARFLAALKKVLAE  364 (365)
T ss_pred             HHHHHHHCCEEEEECCCCCCCCEEEEE---ECCHHHHHHHHHHHHHHHCC
T ss_conf             999999779189868989998979999---58999999999999998766


No 124
>PRK08069 consensus
Probab=99.70  E-value=3.1e-15  Score=120.06  Aligned_cols=333  Identities=15%  Similarity=0.171  Sum_probs=197.8

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731--450687578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~--~~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|.  -.+. ..|.|++|+.++++..  .|.......+.++.+++.+.+..+    .+.++.++++++|.
T Consensus        27 ~~g~~vi~l~~G~--pdf~-~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lreaia~~~~~~~g~~~~p~~V~it~G~~~al  103 (390)
T PRK08069         27 AEGHDVIGLGAGE--PDFN-TPEHIIDAAHKAMNEGHTKYTPSGGLQALKQEIVKKFKRDQGLAYDPSEIIVCTGAKHAL  103 (390)
T ss_pred             HCCCCEEECCCCC--CCCC-CCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHEEEECCCHHHHH
T ss_conf             7699847899978--9999-889999999999854899898996729999999999999868998811189878889999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.--       .+| +.||..+.+|.+.........+.+.+.    |..+.  .-...|++.+++.+.+++-++++
T Consensus       104 ~~~~~~l~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v~v----~~~~~--~~~~~d~~~l~~~i~~~~k~iil  169 (390)
T PRK08069        104 YTLFQVLL-------DEG-DEVIIPTPYWVSYPEQVKLAGGKPVYV----EGLED--NDFKITAEQLEEAITEKTKAVII  169 (390)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHHCCEEEEE----CCCCC--CCCCCCHHHHHHHCCCCCCEEEE
T ss_conf             99999727-------998-989980686642799999818804871----45666--78767999999854436858998


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC-------EEECCCCCC-CCCCCC
Q ss_conf             332222112462101232211022345721310110034444555310111245453-------021034444-443443
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD-------IMTIAKGMG-GGFPIG  254 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD-------i~~~gK~l~-gG~P~s  254 (392)
                      -.=..-.|. ..+++.+++|.++|++||+++|.||+...+--.|.-+-+ ...+.|+       +-.+||..+ .|+=+|
T Consensus       170 ~~P~NPTG~-v~s~e~l~~i~~la~~~~~~vi~DEiY~~l~~~~~~~~s-~~~~~~~~~~~~i~~~s~SK~~~~~G~RiG  247 (390)
T PRK08069        170 NSPSNPTGM-IYTKEELAALGEVCLEHDILIVSDEIYEKLIYGGAEHVS-IAQLSNELKEQTIIINGVSKSHSMTGWRIG  247 (390)
T ss_pred             CCCCCCCCC-CCCCHHHHHHHHHHHHCCEEEEEEHHHHHHCCCCCCCCC-HHHHCCCCCCCCCEECCCHHHCCCCCCCEE
T ss_conf             899698681-655068999999987563059853323654069989889-899495434564100353020377632358


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHH---HHCCCEEEEECCCEE
Q ss_conf             21000111222223322345321111001233455432012221011210000268899998---867970755046400
Q gi|254780432|r  255 ACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIK---NRFPNMFLEVRGQGL  331 (392)
Q Consensus       255 av~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~---~~~~~~v~~vRG~Gl  331 (392)
                      .+++.+++++.+.......+...++++-.++.+.++.  .++.+++.+   +.++++.+.+.   .+.|++ .-++-.|-
T Consensus       248 ~~~~~~~li~~~~~~~~~~~~~~~~~~q~aa~~a~~~--~~~~~~~~~---~~~~~r~~~~~~~l~~~~g~-~~~~P~Gg  321 (390)
T PRK08069        248 YAAGNKQIIKAMTNLASHSTSNPTSIAQYGAIAAYAG--SQEPVETMR---QAFEERLNIIYDKLIQIPGF-TCIKPQGA  321 (390)
T ss_pred             EEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHC--CHHHHHHHH---HHHHHHHHHHHHHHHHCCCC-CCCCCCEE
T ss_conf             8766999999999998653577763999999999868--868799999---99999999999998506688-51479803


Q ss_pred             EEE-EEEC--------CCHHHHHHHH-HHCCEEEEEC----CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             999-8724--------9989999999-9689899626----898899558986889999999999999999
Q gi|254780432|r  332 LIG-LKTV--------FSPALLAAKF-RDECLLTAPS----SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       332 ~~~-ie~~--------~~~~~~~~~l-~~~Gll~~~~----~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      ++. +++.        .+...+++++ .+.||.+.|.    .++.+|+.  +..++++|++++++|++.++
T Consensus       322 ~ylw~~~~~~~~~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~~~~Rl~--fa~~~~~l~eal~RL~~~l~  390 (390)
T PRK08069        322 FYLFPNVKEAAALSGFETVDEFVKALLEEEKVALVPGSGFGAPDNVRLS--YATSLELLEEAIERIHRFMK  390 (390)
T ss_pred             EEEEEECCHHHCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCCEEEE--EECCHHHHHHHHHHHHHHHC
T ss_conf             8997877311122678889999999998599999818767999838999--84999999999999999859


No 125
>PRK06107 aspartate aminotransferase; Provisional
Probab=99.69  E-value=8.9e-15  Score=117.08  Aligned_cols=333  Identities=12%  Similarity=0.144  Sum_probs=200.4

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCC-CCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731-4506-87578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVS-NLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~-~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|-  -.+ --.|.|++|++++++.. .+++ .....+.+.++++.+....+    .+.++.++++++|.
T Consensus        30 ~~G~dvi~L~iG~--pdf-~~p~~i~~a~~~al~~~~~~Y~~~~G~~eLReAia~~~~~~~g~~v~p~~I~vt~G~~~al  106 (402)
T PRK06107         30 AAGRSIVDLTVGE--PDF-DTPDHIKAAAVAAIERGETKYTLVNGTPALRKAIIAKMERRNGLHYADNEICVGGGAKQAI  106 (402)
T ss_pred             HCCCCEEECCCCC--CCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHH
T ss_conf             7799727788989--899-9789999999999855999996998889999999999999868999820499868889999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++..-       .+| ..||..+-.|.+.........+.+..    -|..+.  .-...|.+.+++.+.+++-++|+
T Consensus       107 ~~~~~al~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~~~----~p~~~~--~~~~~d~d~le~~~~~~tk~iil  172 (402)
T PRK06107        107 FLALMATL-------EEG-DEVIIPAPYWVSYPDMVLANDGTPVI----VPCPEE--DGFKLTAEALEAAITPRTRWLIL  172 (402)
T ss_pred             HHHHHHHC-------CCC-CEEEEECCCCCCHHHHHHHCCCCEEE----CCCCCC--CCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999957-------999-98998168665379999983995673----687823--48758999999745647669998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCC-CCEEEECCCCCCCCCCCCCCCCCCCCCCCC-----E--EECCCCCC-CCCC
Q ss_conf             -332222112462101232211022345-721310110034444555310111245453-----0--21034444-4434
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDI-DALLIFDEVQTGYGRTGKLFAYEWANVKPD-----I--MTIAKGMG-GGFP  252 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~-g~llI~DEV~tG~GRtG~~f~~e~~gi~PD-----i--~~~gK~l~-gG~P  252 (392)
                       -| ..-.|. ..+++-+++|.++|.+| ++++|.||+...+--.|..+.+ .....|+     |  -.+||..+ .|+=
T Consensus       173 ~~P-~NPTG~-v~s~~~l~~i~~i~~~~~~i~iisDEiY~~l~~~~~~~~~-~~~~~p~~~~~~i~i~s~SK~~~~~G~R  249 (402)
T PRK06107        173 NAP-SNPTGA-AYSRDELRALADVLLRHPHVLVLTDDIYDHIRFDDEPVTH-LLTAAPELRDRVLLTNGVSKTYAMTGWR  249 (402)
T ss_pred             CCC-CCCCCC-CCCHHHHHHHHHHHHHCCCCEEEEEHHHHHHEECCCCCCC-HHHHCHHHHCCCEEECCCCCCCCCCCCE
T ss_conf             899-898996-6534899999887752489328622202552218988886-8985824422544742453456776622


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             432100011122222332234532111100123345543201222101----1210000268899998867970755046
Q gi|254780432|r  253 IGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRG  328 (392)
Q Consensus       253 ~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG  328 (392)
                      +|.+++.+++++.+.......++..+++.-.++.+.|+.  .+++++.    .+++-+.+.+.|+    +.+++ .-++-
T Consensus       250 iG~~v~~~~li~~l~~~~~~~~~~~~~~~Q~aa~~aL~~--~~~~~~~~~~~y~~rrd~~~~~l~----~~~g~-~~~~P  322 (402)
T PRK06107        250 IGYAAGPADLIAAINKLQSQSSSCPSSISQAAAAAALNG--DQSFVAESVKVYKQRRDYALERLN----AIPGL-SCLVP  322 (402)
T ss_pred             EEEEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHHHHHHHHH----HCCCC-EECCC
T ss_conf             689985899999999996243468989999999999968--847899999999999999999887----57996-76279


Q ss_pred             CEEEEEE-EE-------------CCCHHHHHHHHH-HCCEEEEEC----CCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             4009998-72-------------499899999999-689899626----8988995589868899999999999999998
Q gi|254780432|r  329 QGLLIGL-KT-------------VFSPALLAAKFR-DECLLTAPS----SDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       329 ~Gl~~~i-e~-------------~~~~~~~~~~l~-~~Gll~~~~----~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      .|.++.+ ++             ..++..++.++. +.||.+.|.    .++.+||.  +..++++|++++++|++++.+
T Consensus       323 ~g~~y~~~d~~~~~~~~~p~~~~~~~~~~f~~~ll~~~gV~v~PG~~FG~~~~~Ri~--fa~~~e~L~ea~~Rl~~al~~  400 (402)
T PRK06107        323 DGAFYLYVNCAGLIGKTTPEGKVLETDTDVVLYLLDSVGVAVVQGTAYGLSPYFRMS--IATSLETLEAGCDRIERAVAA  400 (402)
T ss_pred             CEEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHH
T ss_conf             812798130510034458665665688999999998589999778533899829999--719999999999999999996


Q ss_pred             H
Q ss_conf             5
Q gi|254780432|r  390 L  390 (392)
Q Consensus       390 L  390 (392)
                      |
T Consensus       401 l  401 (402)
T PRK06107        401 L  401 (402)
T ss_pred             C
T ss_conf             4


No 126
>PRK02731 histidinol-phosphate aminotransferase; Validated
Probab=99.69  E-value=3.5e-15  Score=119.72  Aligned_cols=321  Identities=19%  Similarity=0.259  Sum_probs=204.1

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             76464102267435787899999999999973145068757818999998652010--1333123565554035677766
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHST--FADRVFFTNSGAESVECAIKTA  109 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~--~~~~v~f~~SGseA~e~Aikla  109 (392)
                      ++.||+.++  -+.+|-. |.+++|+.++++.+.    .|..+...+|-+.+.+..  ..+.+..+|+.+|+...+++.-
T Consensus        32 ~~ii~l~~N--enp~gp~-~~v~~ai~~~~~~~~----~YPd~~~~~Lr~aiA~~~~v~~~~Ilv~nGs~e~i~l~~~a~  104 (367)
T PRK02731         32 ADIIKLASN--ENPLGPS-PKAIEAIRAAADELH----RYPDGSGFELKAALAEKFGVDPEQIILGNGSDEILELLARAY  104 (367)
T ss_pred             CCEEEECCC--CCCCCCC-HHHHHHHHHHHHHHC----CCCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHHHH
T ss_conf             876881198--9999989-999999998775511----595987899999999997858111998578999999999998


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCCCCCC
Q ss_conf             543200134786002343546565432123455321134799986433322210026887541012332222-3332222
Q gi|254780432|r  110 RRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL-IEPIQGE  188 (392)
Q Consensus       110 r~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi-~Epv~g~  188 (392)
                      -       .+| +.|+..+.+|..-...+.........    -|. .++    ..|++++.+.+.+++..++ .-|=. -
T Consensus       105 ~-------~pg-d~Vl~~~P~f~~Y~~~a~~~G~~~~~----vp~-~~~----~~d~~~l~~~i~~~tklv~l~nPnN-P  166 (367)
T PRK02731        105 L-------GPG-DEVIYSEHAFAVYPIAAQAVGAKPVE----VPA-KDY----GHDLDAMLAAVTPRTKLVFIANPNN-P  166 (367)
T ss_pred             H-------CCC-CEEEECCCCHHHHHHHHHHCCCEEEE----ECC-CCC----CCCHHHHHHHCCCCCCEEEECCCCC-C
T ss_conf             4-------799-86444798626899999982988999----547-677----6596899985587886899828999-9


Q ss_pred             CCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCC-CCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             112462101232211022345721310110034444555310-11124545302---1034444-443443210001112
Q gi|254780432|r  189 GGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA-YEWANVKPDIM---TIAKGMG-GGFPIGACLATNEVA  263 (392)
Q Consensus       189 ~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~-~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~i~  263 (392)
                      -|. ..+.+-++++.+.|++ ++++|+||+..-|..-+.... .+..+--|.++   +|||..+ .|+=+|.+++.+++.
T Consensus       167 TG~-~~~~~~l~~l~~~~~~-~~~vviDEaY~ef~~~~~~~~~~~l~~~~~n~iv~rSfSK~~glaGlRlGy~ia~~~~i  244 (367)
T PRK02731        167 TGT-YLPAEEVERFLAGVPP-DVLVVLDEAYAEYVARKDYEDGIELVKEFPNVVVTRTFSKAYGLAGLRVGYGIAPPEII  244 (367)
T ss_pred             CCC-CCCHHHHHHHHHHCCC-CCEEEEEHHHHHHCCCCCCCCHHHHHHHCCCEEEEEECCHHHCCCCCCEEEEECCHHHH
T ss_conf             886-5756999999985455-76388411267642576665589997623764799746666516887058886699999


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEEC--CCH
Q ss_conf             222233223453211110012334554320122210112100002688999988679707550464009998724--998
Q gi|254780432|r  264 ACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV--FSP  341 (392)
Q Consensus       264 ~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~--~~~  341 (392)
                      +.+....  ..|+-|.++..+|.++|+   +++.+++..+.-+.-++.+.+...++ ++ .-....|.++-+++.  .+.
T Consensus       245 ~~l~~~~--~p~~v~~~aq~aa~aaL~---d~~~~~~~~~~~~~~r~~l~~~L~~~-g~-~~~ps~~nFil~~~~~~~~a  317 (367)
T PRK02731        245 DALNRVR--QPFNVNSLALAAAVAALD---DDAFVEKSRELNAKGMARLEEFLAEL-GL-EYIPSYGNFILVDFDDGKDA  317 (367)
T ss_pred             HHHHHHH--CCCCCCHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCEEEEEECCCCCCH
T ss_conf             9999984--766588999999999966---99999999999999999999999978-49-88789861899988999999


Q ss_pred             HHHHHHHHHCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999996898996268----988995589868899999999999999998
Q gi|254780432|r  342 ALLAAKFRDECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       342 ~~~~~~l~~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      ..+.++|.++|+++++..    ++.+|++   +=|.+|.++++++|++.|.|
T Consensus       318 ~~~~~~L~~~gI~vr~~~~fgl~~~~Ris---igt~een~~li~al~~~l~e  366 (367)
T PRK02731        318 AAIYEALLKRGVIVRPLAGYGLPNALRIT---IGTPEENRRFLAALKEFLAQ  366 (367)
T ss_pred             HHHHHHHHHCCEEEEECCCCCCCCEEEEE---ECCHHHHHHHHHHHHHHHHH
T ss_conf             99999999689389858888998969999---28999999999999999850


No 127
>PRK07337 aminotransferase; Validated
Probab=99.69  E-value=4.5e-15  Score=119.03  Aligned_cols=328  Identities=12%  Similarity=0.160  Sum_probs=197.3

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCCC-CCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731-45068-7578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVSN-LYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~~-~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|  -..+. ..|.|++|+++.++.. ..++. ....+.++.+++.+.+..+    .+.+++++++++|.
T Consensus        27 ~~G~dvi~l~~g--~pdf~-~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lreaia~~~~~~~g~~i~pe~I~it~G~~~al  103 (388)
T PRK07337         27 RAGRDIIHMGIG--EPDFT-APEPVVEAAARALRRGVTQYTSALGLAPLREAIAAHYARRFGLDVAPERIVVTAGASAAL  103 (388)
T ss_pred             HCCCCEEECCCC--CCCCC-CCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHHH
T ss_conf             779980899799--89998-799999999999846999889998879999999999999868999668879848759999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.--       .+| ..|+..+-+|...........+....-    |..+  ..--..|.+.+++.+.+++-++++
T Consensus       104 ~~~~~~l~-------~pG-D~Vlv~~P~Yp~~~~~~~~~g~~~~~v----p~~~--~~~~~~d~~~l~~~~~~~tk~iil  169 (388)
T PRK07337        104 LLACLALV-------ERG-DEVLMPDPSYPCNRHFVAAAEGRPVLV----PSGP--AERFQLTADDVRTHWGERTRGVLL  169 (388)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHCCCEEEEE----ECCC--CCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999966-------999-989985887365999999739889994----0371--006778979999857865539997


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCC
Q ss_conf             -33222211246210123221102234572131011003444455531011124545302---1034444-443443210
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GGFPIGACL  257 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~  257 (392)
                       -| +.-.|. ..+++-++++.++|++|++++|.|||...+.-.|.....  .....+.+   .+||.++ .|+=+|.++
T Consensus       170 ~nP-~NPtG~-v~s~~el~~i~~~a~~~~~~vIsDEiY~~l~~~~~~~~~--~~~~~~~i~~~S~SK~~~~~G~RiG~~i  245 (388)
T PRK07337        170 ASP-SNPTGT-SIEPDELRRIVEAVRARGGFTIVDEIYQGLSYDAAPVSA--LSLGDDVITINSFSKYFNMTGWRLGWLV  245 (388)
T ss_pred             CCC-CCCCCE-EEEHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCC--CCCCCCEEEECCCCCCCCCCCCCEEEEE
T ss_conf             899-798885-626777433554431458088457641001248998671--0057857998266545578661569999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCC------CCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEE
Q ss_conf             001112222233223453211110012334554320122------21011210000268899998867970755046400
Q gi|254780432|r  258 ATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDG------FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGL  331 (392)
Q Consensus       258 ~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~------l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl  331 (392)
                      +.+++.+.+.......+...+.++..++.+.++   .+.      ..+..+++-+.+.+.|+++    + ....++-.|.
T Consensus       246 ~p~~li~~~~~~~~~~~~~~~~~~q~aa~~~~~---~~~~~~~~~~~~~~~~~r~~~~~~l~~~----~-~~~~~~P~G~  317 (388)
T PRK07337        246 VPPALVGTFEKLAQNLFICASALAQHAALACFE---PDTLAIYERRRAEFKRRRDFIVPALESL----G-FKVPVMPDGA  317 (388)
T ss_pred             ECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC---CCHHHHHHHHHHHHHHHHHHHHHHHHHC----C-CCCCCCCCEE
T ss_conf             889999999999985458866999999999848---2247999999999999999999999975----9-9646578826


Q ss_pred             EEE-EEE-------CCCHHHHHHHHH-HCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             999-872-------499899999999-689899626-------89889955898688999999999999999
Q gi|254780432|r  332 LIG-LKT-------VFSPALLAAKFR-DECLLTAPS-------SDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       332 ~~~-ie~-------~~~~~~~~~~l~-~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      ++. +++       ..+...++..+. +.||.+.|.       +++.+||.  +..++++|++++++|.+.|
T Consensus       318 ~~~w~d~~~~~~~~~~d~~~~~~~ll~e~gV~v~PG~~Fg~~~~~~~iRl~--~a~~~~~l~eal~RL~~~l  387 (388)
T PRK07337        318 FYVYADCGGVAHPAAGDSAALTFAMLHDAGVVLVPGMDFGPHAPRDYIRLS--YATSYSRLEEAVARLGKLF  387 (388)
T ss_pred             EEEEEECHHHCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHH
T ss_conf             699478642169999999999999998599999776221899999979999--7199999999999999970


No 128
>PRK07550 hypothetical protein; Provisional
Probab=99.68  E-value=5.8e-15  Score=118.29  Aligned_cols=327  Identities=18%  Similarity=0.210  Sum_probs=198.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC---CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314---50687578189999986520101----3331235655540
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW---HVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAES  101 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~---~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA  101 (392)
                      ..|++.||+.-|  .-.+. ..|.|++|+.+.+..-.   |.......+.+..+++.+.+..+    .+.++.++++++|
T Consensus        27 ~~G~~vI~L~~G--~Pdf~-~p~~i~~a~~~a~~~~~~~~Y~~~~G~~~LR~aia~~~~~~~g~~~~pe~I~it~G~~~a  103 (387)
T PRK07550         27 PAGRPLIDLSQA--VPVYP-PPPELRRALAEAAGDPAAHLYGPVEGLPELREAYAAQYSRLYGAAINPGQVAITSGCNQA  103 (387)
T ss_pred             CCCCCEEECCCC--CCCCC-CCHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHH
T ss_conf             699971589898--89898-789999999999669888889898571999999999999986889967988987678999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             35677766543200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       102 ~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
                      ...+++.--       .+| +.|+..+-+|.+..............    -|..+  ..-...|++.+++.+.+++-+++
T Consensus       104 l~~~~~al~-------~pG-D~Vli~~P~Y~~y~~~~~~~G~~~~~----vp~~~--~~~~~~d~~~le~~~~~~tk~ii  169 (387)
T PRK07550        104 FWAAMVTLA-------GAG-DEVILPTPWYFNHKMWLDMLGIRAVL----VPLDT--GPGLLPDPEAAAALITPRTRAIV  169 (387)
T ss_pred             HHHHHHHHC-------CCC-CEEEEECCCCCCHHHHHHHCCCEEEE----CCCCC--CCCCCCCHHHHHHHCCCCCCEEE
T ss_conf             999999971-------898-98998279675379999976998973----47775--67987799999975565783770


Q ss_pred             C-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCC-CCCCCCCCCCCC-------EEECCCCCC-CCC
Q ss_conf             3-332222112462101232211022345721310110034444555-310111245453-------021034444-443
Q gi|254780432|r  182 I-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGK-LFAYEWANVKPD-------IMTIAKGMG-GGF  251 (392)
Q Consensus       182 ~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~-~f~~e~~gi~PD-------i~~~gK~l~-gG~  251 (392)
                      + -| ..--|. ..+++.+++|.++|++||+++|.||+...|-..+. ....  + -.||       +-.+||.++ .|+
T Consensus       170 l~~P-~NPtG~-v~s~e~l~~l~~la~~~~~~iI~DEiY~~~~~~~~~~~~~--~-~~~~~~~~vI~i~S~SK~~~~~G~  244 (387)
T PRK07550        170 LVTP-NNPTGV-VYPPELLHELYDLARRRGLALILDETYRDFDSRGGAPHDL--F-ADPDWGDTLVHLYSFSKAYRLTGH  244 (387)
T ss_pred             CCCC-CCCCCC-CCCHHHHHHHHHHCCCEEEEEEECCCHHHHHCCCCCCCCH--H-HCCCCCCEEEEECCCCCCCCCCCC
T ss_conf             3899-699885-1077985346543033158999417578753388777667--6-533667559997467644567542


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             4432100011122222332234532111100123345543201--22210112100002688999988679707550464
Q gi|254780432|r  252 PIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQ  329 (392)
Q Consensus       252 P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~  329 (392)
                      =+|.+++.+++++.+.......+...+.++-.++.+.|+...+  ++.....+++-+.+.+.|+    +.+..  .+...
T Consensus       245 RiG~i~~~~~~i~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~~~~rr~~l~~~l~----~~~~~--~~~~~  318 (387)
T PRK07550        245 RVGALAASPARLAEIEKFLDTMAICAPRIGQIAVLWGIRNLADWVAGNRAEILRRRDALRAGFS----RLPGW--ELLAS  318 (387)
T ss_pred             EEEEEEECHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHH----HCCCC--EECCC
T ss_conf             1799983999999999999760367877999999999863099999999999999999999886----46896--54788


Q ss_pred             EEEEE-EEE---CCCHHHHHHHH-HHCCEEEEEC------CCCEEEECCCCC-CCHHHHHHHHHHHHH
Q ss_conf             00999-872---49989999999-9689899626------898899558986-889999999999999
Q gi|254780432|r  330 GLLIG-LKT---VFSPALLAAKF-RDECLLTAPS------SDNVVRILPPLT-ITAEEIHEGLERIER  385 (392)
Q Consensus       330 Gl~~~-ie~---~~~~~~~~~~l-~~~Gll~~~~------~~~~irl~Ppl~-it~~eid~~i~~l~~  385 (392)
                      |.++. +++   ..+...++.++ .+.||.+.|.      +.+.+|++  +. .++++|++++++|++
T Consensus       319 G~~f~w~~~~~~~~~~~~~~~~ll~e~gV~v~PG~~Fg~~g~~~vRls--fa~~~~~~i~ea~~RL~~  384 (387)
T PRK07550        319 GAYFAYVRHPFPDASSDEVARRLAKEAGILCLPGTMFGPGGERYLRLA--FANIDVAGIAELVERLRG  384 (387)
T ss_pred             CEEEEEEECCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCCHHHHHHHHHHHHH
T ss_conf             347998837889989999999999869999978753388998979999--467999999999999986


No 129
>PRK06108 aspartate aminotransferase; Provisional
Probab=99.68  E-value=6e-15  Score=118.21  Aligned_cols=335  Identities=17%  Similarity=0.169  Sum_probs=198.5

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCHH
Q ss_conf             99764641022674357878999999999999731--450687578189999986520101----333123565554035
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESVE  103 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~--~~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~e  103 (392)
                      .++..|++.-|  -..+ -..|.|++|+++.++..  .+.......+.+..+++.+.+..+    .|.++.++++++|..
T Consensus        22 ~~~dvi~l~vg--dpDf-~~p~~i~~a~~~~~~~g~~~Y~~~~G~~~lreaia~~~~~~~g~~v~~d~I~it~G~~~al~   98 (382)
T PRK06108         22 GREDVLPFWFG--ESDL-PTPDFIRDAAAAALADGETFYTHNLGIPELREALARYVSRLHGATTPPERIAVTSSGVQALM   98 (382)
T ss_pred             CCCCCEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHHHH
T ss_conf             89991788898--9899-98899999999998479983799988699999999999998788986684998078999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-
Q ss_conf             6777665432001347860023435465654321234553211347999864333222100268875410123322223-
Q gi|254780432|r  104 CAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI-  182 (392)
Q Consensus       104 ~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~-  182 (392)
                      .+++.--       .+| ..|+..+-+|.+..............    -|.... ..-..-|++.+++.+.+++-++++ 
T Consensus        99 ~~~~~~~-------~pG-D~Vlv~~P~Y~~~~~~~~~~g~~~~~----vpl~~~-~~~~~~d~~~le~~~~~~~k~iil~  165 (382)
T PRK06108         99 LAAQALV-------GPG-DEVVAVTPAWPNLVAAPKILGARVVC----VPLQYG-GGGWQLDVDRLLAAITPRTRALFIN  165 (382)
T ss_pred             HHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEE----CCCCCC-CCCCCCCHHHHHHHCCCCCEEEEEC
T ss_conf             9999966-------999-98998168786569999973882785----345666-7886679999996457566499988


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCC--C-CCCCCCCCE---EECCCCCC-CCCCCCC
Q ss_conf             332222112462101232211022345721310110034444555310--1-112454530---21034444-4434432
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA--Y-EWANVKPDI---MTIAKGMG-GGFPIGA  255 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~--~-e~~gi~PDi---~~~gK~l~-gG~P~sa  255 (392)
                      -| ..-.|. ..+++-+++|.++|++||+.+|.|||..-+--.|....  + +..+...-+   ..+||..+ .|+=+|.
T Consensus       166 ~P-~NPtG~-v~s~e~l~~l~~la~~~~v~iisDEiY~~l~f~~~~~~ps~~~~~~~~~~~i~~~S~SK~f~~~G~RiG~  243 (382)
T PRK06108        166 SP-NNPTGW-TASRDDQQAILAHCRRHGLWIVADEVYERLYYGGGGRAPSFLDIAEPDDRIIFVNSFSKNWAMTGWRLGW  243 (382)
T ss_pred             CC-CCCCCH-HCCHHHHHHHHHHHHCCCCEEECHHHHHHHCCCCCCCCCHHHHHCCCCCEEEEEECCCHHCCCCCCEEEE
T ss_conf             99-699662-0447889999998762697535334333301389988834665236676499980430310476761799


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEE
Q ss_conf             100011122222332234532111100123345543201--222101121000026889999886797075504640099
Q gi|254780432|r  256 CLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLI  333 (392)
Q Consensus       256 v~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~  333 (392)
                      +++.+++.+.+.......+...+.+.-.++.+.++.-++  +++.++.++.-+.+.+.|++    .|++ .-+.-.|.++
T Consensus       244 ii~~~~~~~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~~~~~r~~l~~~l~~----~~~~-~~~~P~g~~y  318 (382)
T PRK06108        244 LVAPPSLGQDLEKLIEYNTSCVPQFVQRAAVAALDEGEDFVAQLVARLRRARDHLVDALRA----LPGV-EVPKPDGAMY  318 (382)
T ss_pred             EEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH----CCCC-EECCCCEEEE
T ss_conf             9979999999999998703777689999999999686265899999999999999999973----7996-8737882799


Q ss_pred             -EEEEC--CCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             -98724--99899999999-689899626------8988995589868899999999999999998
Q gi|254780432|r  334 -GLKTV--FSPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       334 -~ie~~--~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                       =+++.  .+...++.++. +.||.+.|.      +.+.+||.  |..++++|++++++|++.+.+
T Consensus       319 ~w~~~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~g~~~iRl~--~a~~~~~l~eal~RL~~~l~k  382 (382)
T PRK06108        319 AFFRLDGATDSLALAKRLVDEAGLGLAPGTAFGPGGEGFLRWC--FARDPARLDEGVERLRRFLAR  382 (382)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHCC
T ss_conf             9887999999999999999969999987841188999979999--629999999999999999667


No 130
>KOG1360 consensus
Probab=99.68  E-value=1.4e-15  Score=122.30  Aligned_cols=310  Identities=18%  Similarity=0.224  Sum_probs=199.3

Q ss_pred             CCCCC-CHHHHHHHHHHHHHCCCCC-----CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHH-HHHHHHHCCC
Q ss_conf             57878-9999999999997314506-----875781899999865201013331235655540356777-6654320013
Q gi|254780432|r   45 SLGHS-HPELVAILKSQSEKLWHVS-----NLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIK-TARRYHYMAG  117 (392)
Q Consensus        45 ~lGh~-~p~i~~a~~~q~~~~~~~~-----~~~~~~~~~~la~~L~~~~~~~~v~f~~SGseA~e~Aik-lar~~~~~~g  117 (392)
                      -||.+ ||+|.+|+++.+++..-..     ...++...++|.++|.+....+-++...|=--|||+.+- +++..     
T Consensus       181 YLgms~Hp~V~~A~~~tl~~hG~GAGGTRNIsG~s~~hv~LE~eLA~LHqK~aALlFsSCfVANDstLftLak~l-----  255 (570)
T KOG1360         181 YLGMSRHPEVLDAMHDTLDRHGAGAGGTRNISGHSKHHVRLEAELADLHQKEAALLFSSCFVANDSTLFTLAKKL-----  255 (570)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEECCCHHHHHHHHHC-----
T ss_conf             213347827999999999971888677654677871355599999988467610355421341645899999778-----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHC---CCCCCCCC-CCCCCCCCCCCC
Q ss_conf             47860023435465654321234553211347999864333222100268875410---12332222-333222211246
Q gi|254780432|r  118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI---SNDTAAIL-IEPIQGEGGVRK  193 (392)
Q Consensus       118 ~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~---~~~iAavi-~Epv~g~~G~~~  193 (392)
                       ++ ..|.+-++. |-    + ++.|..+-      ..+. ....+||+++|++.+   +..+.-+| +|+|.++.|.+-
T Consensus       256 -pg-cei~SD~gN-HA----S-MI~GIrns------~v~K-~IFrHND~~hL~~lL~~~~~svPKivAFEtVhSM~Gavc  320 (570)
T KOG1360         256 -PG-CEIFSDEGN-HA----S-MIQGIRNS------RVPK-HIFRHNDLDHLEQLLQSSPKSVPKIVAFETVHSMDGAVC  320 (570)
T ss_pred             -CC-CEEECCCCC-HH----H-HHHHHHHC------CCCC-EEECCCCHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCC
T ss_conf             -99-688536653-38----8-88776515------9752-242469989999999757988882688766402677757


Q ss_pred             CCHHHHHHHHCCCCCCCCEEEECCCCC-CCCCCCCCC-CC-CCCCC--CCCEE--ECCCCCCC--CCCCCCCCCCCCCCC
Q ss_conf             210123221102234572131011003-444455531-01-11245--45302--10344444--434432100011122
Q gi|254780432|r  194 VPEEFLQQLRKICDDIDALLIFDEVQT-GYGRTGKLF-AY-EWANV--KPDIM--TIAKGMGG--GFPIGACLATNEVAA  264 (392)
Q Consensus       194 ~~~~~l~~l~~lc~~~g~llI~DEV~t-G~GRtG~~f-~~-e~~gi--~PDi~--~~gK~l~g--G~P~sav~~~~~i~~  264 (392)
                      |    +++|.++.++||++.-+|||-. |+  .|.-- +. |..|+  +-||+  |+||+.|+  ||    +..++++.|
T Consensus       321 p----leelcDvah~yGAiTFlDEVHAVGl--YG~rGaGvgerdGvm~kvDiIsGTLgKafGcVGGY----IAat~~LvD  390 (570)
T KOG1360         321 P----LEELCDVAHKYGAITFLDEVHAVGL--YGPRGAGVGERDGVMHKVDIISGTLGKAFGCVGGY----IAATRKLVD  390 (570)
T ss_pred             C----HHHHHHHHHHHCCEEEEEHHHHHCC--CCCCCCCCCCCCCCCHHHHHCCCCHHHHCCCCCCE----EHHHHHHHH
T ss_conf             7----8999778877175453101231002--15777876656775203220014045541665423----300446999


Q ss_pred             CCCCCCCC--CCCCCCCCCHHHHHHHHHHHHCC--CCCCHHHHH-CCHHHHHHHHHHH---HCCCEEEEECCCEEEEEEE
Q ss_conf             22233223--45321111001233455432012--221011210-0002688999988---6797075504640099987
Q gi|254780432|r  265 CMNQGSHG--STYGGNVLAMVLGEKVLNIIQSD--GFLENVINI-AKILFEGLTAIKN---RFPNMFLEVRGQGLLIGLK  336 (392)
Q Consensus       265 ~~~~~~~~--~T~~gnpl~~aaa~a~L~~l~~~--~l~~~~~~~-g~~l~~~L~~l~~---~~~~~v~~vRG~Gl~~~ie  336 (392)
                      .+....-|  .|.+-.|..++-|++++++++.+  ..+.+.++. -+++++-|.++--   ..|.-|..||     .|  
T Consensus       391 miRSyAaGFIFTTSLPP~vl~GAleaVr~lk~~eg~~lR~~hqrnv~~~kq~l~~~GiPVi~~pSHIiPv~-----vg--  463 (570)
T KOG1360         391 MIRSYAAGFIFTTSLPPMVLAGALEAVRILKSEEGRVLRRQHQRNVKYVKQLLMELGIPVIPNPSHIIPVR-----VG--  463 (570)
T ss_pred             HHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEE-----CC--
T ss_conf             99974686687337982888728999999863254789999999999999999874986347886533355-----06--


Q ss_pred             ECCCHHHHHHH-HHHCCEEE-------EECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             24998999999-99689899-------626898899558986889999999999999999852
Q gi|254780432|r  337 TVFSPALLAAK-FRDECLLT-------APSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       337 ~~~~~~~~~~~-l~~~Gll~-------~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      ...-....... +-++++++       .+.|.+.+|++|.---|++-++.+++.+..+..++.
T Consensus       464 da~l~~~~sd~Li~~h~iYvQaINyPTV~rG~E~LRiaPTP~HT~~mm~~lv~~l~~vw~~v~  526 (570)
T KOG1360         464 DAALAKQASDILISKHNIYVQAINYPTVARGTERLRIAPTPHHTPQMMNILVNALLDVWNEVG  526 (570)
T ss_pred             CHHHHHHHHHHHHHHCCEEEEECCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             777777778998875275788526874566601342179998878999999999999999729


No 131
>PRK07682 hypothetical protein; Validated
Probab=99.68  E-value=4.3e-15  Score=119.14  Aligned_cols=335  Identities=13%  Similarity=0.170  Sum_probs=193.4

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHHCC-----CCCCCCCCCCCCCH
Q ss_conf             99764641022674357878999999999999731--450687578189999986520101-----33312356555403
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQEIFANHLIHSTF-----ADRVFFTNSGAESV  102 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~--~~~~~~~~~~~~~~la~~L~~~~~-----~~~v~f~~SGseA~  102 (392)
                      .++..|++.-|  -..+ -..|+|++|+.++++..  .|.......+.+..+++.+.+..+     .+.+++++++++|.
T Consensus        18 ~~~dvi~l~vg--dpdf-~~p~~i~ea~~~~~~~g~~~Y~~~~G~~~lreaia~~~~~r~g~~~~p~~~i~vt~G~~~al   94 (378)
T PRK07682         18 NMEGVISLGVG--EPDF-VTPWNVREASIRSLEQGYTSYTANAGLLELRQEIAKYLKKRFAVSYDPNDEIIVTVGASQAL   94 (378)
T ss_pred             CCCCCEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHH
T ss_conf             89982889999--8999-87899999999998569999899988899999999999998489999777599907859999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.--       .+| +.|+..+-.|...... ....|....     |.......-..-|.+.+++.+.+++-++++
T Consensus        95 ~~~~~~l~-------~pG-D~Vlv~~P~Y~~y~~~-~~~~g~~~v-----~~~~~~~~~~~~d~~~le~~~~~~~k~iil  160 (378)
T PRK07682         95 DVAMRAII-------NPG-DEVLIVEPSFVSYAPL-VTLAGGVPV-----PVATSLENEFKVQPAQIEAAITAKTKAILL  160 (378)
T ss_pred             HHHHHHHC-------CCC-CEEEEECCCHHHHHHH-HHHHCCEEE-----EECCCCCCCCCCCHHHHHHHCCCCCCEEEE
T ss_conf             99999965-------999-9899925850527999-998188569-----940265458637999999736526838998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCC-CCCCCCCE---EECCCCCC-CCCCCCCC
Q ss_conf             -33222211246210123221102234572131011003444455531011-12454530---21034444-44344321
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYE-WANVKPDI---MTIAKGMG-GGFPIGAC  256 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e-~~gi~PDi---~~~gK~l~-gG~P~sav  256 (392)
                       -| ..-.| ...+++-+++|.++|++||+++|.|||...+---|.+-... ..+.....   ..+||.++ .|+-+|.+
T Consensus       161 ~~P-~NPtG-~v~s~~el~~l~~la~~~~i~iisDEiY~~l~~~~~~~~~~~~~~~~~~~i~~~s~SK~f~l~G~R~G~~  238 (378)
T PRK07682        161 CSP-NNPTG-AVLNKSELEEIAVIVEKHNLIVLSDEIYAELTYDEAYTSFASIKGMRERTILISGFSKGFAMTGWRLGMI  238 (378)
T ss_pred             CCC-CCCCC-CCCCHHHHHHHHHHHHHCCEEEECCCHHHHHCCCCCCCCHHHCCCCCCCCCCCCCCHHHCCCCCCCEEEE
T ss_conf             289-79888-8889999999999764459679522014653069876776552564445420234124207857306989


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEE
Q ss_conf             00011122222332234532111100123345543201--2221011210000268899998867970755046400999
Q gi|254780432|r  257 LATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG  334 (392)
Q Consensus       257 ~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~  334 (392)
                      ++.+++.+.+.......++..+.+.-.++.+.++.-.+  +++.+..++.-+.+.+.|+++     ++ .-....|.++.
T Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~~~~~r~~~~~~l~~~-----g~-~~~~P~g~~~~  312 (378)
T PRK07682        239 AAPVYFSEAMLKIHQYSMMCAPTMAQFAALEALRNGNDDVERMRDSYRKRRNFFVTSLNEI-----GL-TCHVPGGAFYA  312 (378)
T ss_pred             EECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CC-EECCCCEEEEE
T ss_conf             7089999999999975567798489999999997576879999999999999999999975-----98-22068867899


Q ss_pred             -EEEC---CCHHHHHHH-HHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             -8724---998999999-99689899626------898899558986889999999999999999852
Q gi|254780432|r  335 -LKTV---FSPALLAAK-FRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       335 -ie~~---~~~~~~~~~-l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                       +++.   .+...++++ +.+.||.+.|.      +++.+||.  +..++++|++++++|++++.+..
T Consensus       313 ~~~~~~~~~~~~~~~~~ll~~~~V~v~PG~~Fg~~g~~~iRl~--~a~~~e~l~eal~Rl~~~l~~~k  378 (378)
T PRK07682        313 FPSISSTGLSSEEFAEQLLLEEKVAVVPGSVFGESGEGFIRCS--YATSLEQLQEAMKRMKRFVENKK  378 (378)
T ss_pred             EEECCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHCC
T ss_conf             5787888989999999999969999988622289998979999--61999999999999999998469


No 132
>PRK03321 putative aminotransferase; Provisional
Probab=99.68  E-value=5.6e-15  Score=118.37  Aligned_cols=318  Identities=18%  Similarity=0.207  Sum_probs=199.6

Q ss_pred             EEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             6464102267435787899999999999973145068757818999998652010--13331235655540356777665
Q gi|254780432|r   33 PFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHST--FADRVFFTNSGAESVECAIKTAR  110 (392)
Q Consensus        33 ~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~--~~~~v~f~~SGseA~e~Aiklar  110 (392)
                      ..|||.++  -+.+|- .|.+++|+.++++.+..    |..+...+|-+.|.+..  ..+.+..+|+.+|+...+++...
T Consensus        23 ~~i~ls~N--enp~gp-~p~v~~ai~~~~~~~~~----YPd~~~~~Lr~aiA~~~~v~~~~I~v~nGs~e~i~~~~~~~~   95 (352)
T PRK03321         23 GAIKLSSN--ETPFGP-LPSVRAAIAEATDGLNR----YPDNGAVELRAALAEHLGVAPEHVAVGCGSVALCQQLVQATA   95 (352)
T ss_pred             CCEECCCC--CCCCCC-CHHHHHHHHHHHHHCCC----CCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHHHHH
T ss_conf             93780296--999998-89999999986530677----989986999999999878785879987469999999999981


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCCCCCCC
Q ss_conf             43200134786002343546565432123455321134799986433322210026887541012332222-33322221
Q gi|254780432|r  111 RYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL-IEPIQGEG  189 (392)
Q Consensus       111 ~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi-~Epv~g~~  189 (392)
                             .+| .+|+..+.+|-.-...+. +.|-....-   |..+++    ..|++++.+.+.++.-+++ .-|= .-.
T Consensus        96 -------~~g-d~Vl~p~P~f~~Y~~~~~-~~G~~~~~v---~l~~~~----~~dl~~l~~~i~~~~~lv~l~nPn-NPT  158 (352)
T PRK03321         96 -------GPG-DEVVFAWRSFEAYPILVQ-VAGATPVQV---PLTDDH----THDLDAMAAAITDRTRLIFVCNPN-NPT  158 (352)
T ss_pred             -------CCC-CEEEECCCCHHHHHHHHH-HCCCEEEEE---ECCCCC----CCCHHHHHHHCCCCCCEEEECCCC-CCC
T ss_conf             -------797-989988885326899999-809879998---667555----788378998658887589984999-973


Q ss_pred             CCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CCCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCCCCC
Q ss_conf             1246210123221102234572131011003444455531-011124545302---1034444-4434432100011122
Q gi|254780432|r  190 GVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AYEWANVKPDIM---TIAKGMG-GGFPIGACLATNEVAA  264 (392)
Q Consensus       190 G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~i~~  264 (392)
                      |. ..+++.++++.+.|++ ++++|+||....|..-+... +.+...-.|.++   +|||..+ .|+=+|.+++++++.+
T Consensus       159 G~-~~~~~~l~~l~~~~~~-~~~vvvDEaY~~f~~~~~~~~~~~~~~~~~nlivlrSfSK~~glaGlRlGy~ia~~~~i~  236 (352)
T PRK03321        159 GT-VVTPAALARFVAAVPA-DVLVVLDEAYVEYIRDGDVPDGLELVRDHPNVVVLRTFSKAYGLAGLRVGYAVGHPEVIT  236 (352)
T ss_pred             CC-CCCCHHHHHHHHHCCC-CCEEEEHHHHHHHHHCCCCCCHHHHHHHCCEEEEECCCCCCCCCCCCCCEEEECCHHHHH
T ss_conf             01-3683758999975547-847972240898842778762788752045255402544133789885332028999999


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHH---CCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH
Q ss_conf             2223322345321111001233455432012221011210---0002688999988679707550464009998724998
Q gi|254780432|r  265 CMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI---AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP  341 (392)
Q Consensus       265 ~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~---g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~  341 (392)
                      .+....  ..|+-|.++.++|.++|+-  ++.+.++++..   -+++.+.|++    . ++ .-....|-++-+....+.
T Consensus       237 ~l~~~~--~p~~v~~~aq~aa~aaL~~--~~~~~~~~~~~~~~R~~l~~~L~~----~-g~-~v~ps~anFi~~~~~~~~  306 (352)
T PRK03321        237 ALRKVA--VPFSVNSLAQAAAIASLEA--ADELLERVDAVVAERDRVSAALRA----A-GW-TVPPSQANFVWLPLGERT  306 (352)
T ss_pred             HHHHHC--CCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHHH----C-CC-EECCCCCEEEEEECCCCH
T ss_conf             999845--8988559999999999649--299999999999999999999997----8-58-588998749999518999


Q ss_pred             HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999996898996268988995589868899999999999999998
Q gi|254780432|r  342 ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       342 ~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      ..+++.|.++|+++++.+++.+|++   +=|++|-++++++|++-+.-
T Consensus       307 ~~~~~~L~~~GIlVR~~~~~~~RIs---vgt~een~~ll~Alk~~~~g  351 (352)
T PRK03321        307 ADFAAAAAEAGVVVRPFGGEGVRVT---VGAPEENDAFLRAARAWRAG  351 (352)
T ss_pred             HHHHHHHHHCCEEEEECCCCEEEEE---ECCHHHHHHHHHHHHHHHCC
T ss_conf             9999999819939986699918998---09999999999999999724


No 133
>TIGR03537 DapC succinyldiaminopimelate transaminase. Note: the detailed information included in the EC:2.6.1.17 record includes the assertions that the enzyme uses the pyridoxal pyrophosphate cofactor, which is consistent with the pfam00155 family, and the assertion that the amino group donor is L-glutamate, which is undetermined for the sequences in this clade.
Probab=99.68  E-value=1.2e-14  Score=116.29  Aligned_cols=329  Identities=15%  Similarity=0.174  Sum_probs=185.9

Q ss_pred             EEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCC-HHHHHHHHHHHHHCC----CC-CCCCCCCCCCCHHHHH
Q ss_conf             64641022674357878999999999999731450687578-189999986520101----33-3123565554035677
Q gi|254780432|r   33 PFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQS-TQQEIFANHLIHSTF----AD-RVFFTNSGAESVECAI  106 (392)
Q Consensus        33 ~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~-~~~~~la~~L~~~~~----~~-~v~f~~SGseA~e~Ai  106 (392)
                      +.|||.-|   ..-.=..|.+.+|+++.+.....+++.... +.+..+++.+.+..+    .| .++.+++..||+..++
T Consensus         1 ~ii~l~~g---~P~~p~P~~i~~al~~a~~~~~~Y~~~~G~~~lR~aia~~~~~~~g~~~~~d~~I~~t~Ga~~al~~~~   77 (350)
T TIGR03537         1 RLFDFGTG---DPKEPTPPIIRNALKNAVPEVSQYPSAAGTKALRDAISGWFERRFGVKLDPDAQVLPSAGSKEAIFHFP   77 (350)
T ss_pred             CEEECCCC---CCCCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHH
T ss_conf             95787698---999998799999999960215899898474999999999999986899897877998788389999999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-CCC
Q ss_conf             7665432001347860023435465654321234553211347999864333222100268875410123322223-332
Q gi|254780432|r  107 KTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI-EPI  185 (392)
Q Consensus       107 klar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~-Epv  185 (392)
                      +....    .|.. .++|+..+-+|.+....+.....+...    -|..+  ..-...|++++++.+.++.-++++ -| 
T Consensus        78 ~~~~~----~gd~-~~~Vlv~~P~y~~y~~~~~~~g~~~~~----v~l~~--~~g~~~d~e~l~~~~~~~~~~i~l~nP-  145 (350)
T TIGR03537        78 LVFID----PEED-RRRVIFGTPGYPVYERGALFAGGEPTP----VKLKE--EDGFLLRLEKVDKEILKETKIVWINYP-  145 (350)
T ss_pred             HHHCC----CCCC-CCEEEEECCCCCCHHHHHHHCCCEEEE----EECCC--CCCCCCCHHHHHHHCCCCCEEEEECCC-
T ss_conf             99738----8877-876999469873069999976998999----75355--448877999999746668719998999-


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC----EEECCCCCC-CCCCCCCCCCCC
Q ss_conf             222112462101232211022345721310110034444555310111245453----021034444-443443210001
Q gi|254780432|r  186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD----IMTIAKGMG-GGFPIGACLATN  260 (392)
Q Consensus       186 ~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PD----i~~~gK~l~-gG~P~sav~~~~  260 (392)
                      +.-.|. ..+.+-++++.++|++||+++|.||+..-+--.+.....  .....|    +-.++|..+ .|+=+|.+++.+
T Consensus       146 ~NPTG~-v~s~~~l~~l~~~a~~~~~~vi~DE~Y~~l~~~~~~~~~--~~~~~~~~i~~~S~SK~~~~pGlR~G~~~~~~  222 (350)
T TIGR03537       146 HNPTGA-VAPRSYLEETIAICQEHNIILCSDECYTEIYFGEPPHSA--LEVGMENVLAFHSLSKRSGMTGYRSGFVAGDE  222 (350)
T ss_pred             CCCCCC-CCCHHHHHHHHHHHHCCCEEEEEEHHHHHHHCCCCCCCH--HHHCCCCEEEEECCCCCCCCCCCEEEEEECCH
T ss_conf             898364-769999999998632369079843122455348998775--56346877999667545046775599997899


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEEC--
Q ss_conf             112222233223453211110012334554320122210112100002688999988679707550464009998724--
Q gi|254780432|r  261 EVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV--  338 (392)
Q Consensus       261 ~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~--  338 (392)
                      ++.+.+.........+...+..+++.+.+   .++..++..++.=+.-++.+.+...+. ++....-.-|+++=+++.  
T Consensus       223 ~li~~~~~~~~~~~~~~~~~~q~a~~~~~---~~~~~~~~~~~~~~~~r~~~~~~l~~~-g~~~~~p~g~~~~w~~~~~~  298 (350)
T TIGR03537       223 KLISFLKKLRANFGVASPDFVQAAAKAAW---SDDSHVIERRKIFRRKRDLFLEFFNKK-GLEYLYPDATFYLWVKVPNG  298 (350)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHH---CCHHHHHHHHHHHHHHHHHHHHHHHHC-CCEEECCCCEEEEEEECCCC
T ss_conf             99999999862067772899999999995---680999999999999999999998648-98882688225998979999


Q ss_pred             CCHHHHHHHHHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             99899999999689899626------898899558986889999999999999
Q gi|254780432|r  339 FSPALLAAKFRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIER  385 (392)
Q Consensus       339 ~~~~~~~~~l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~  385 (392)
                      .+...+++++.++||.+.+.      +++.+|++  +..+.++|++++++|++
T Consensus       299 ~~~~~~~~~ll~~gV~v~pG~~Fg~~~~~~~Rl~--~~~~~e~l~ealrrl~~  349 (350)
T TIGR03537       299 ISSKDYALRLLENGIVVAPGENFGSGEEGYVRVA--LVPTLEECEEALRIWES  349 (350)
T ss_pred             CCHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHC
T ss_conf             8999999999979989976731189999869999--72899999999999861


No 134
>PRK09276 aspartate aminotransferase; Provisional
Probab=99.68  E-value=3.3e-15  Score=119.89  Aligned_cols=329  Identities=17%  Similarity=0.218  Sum_probs=190.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC---CCCCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314---50687578189999986520101----33-3123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW---HVSNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~---~~~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGse  100 (392)
                      ..|++.|++.-|  -..+ -..|.|++|+.+.++...   +.......+.+..+++.+.+..+    .+ .+..++++++
T Consensus        28 ~~G~dvi~l~~G--~pd~-~~p~~i~~al~~a~~~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~~~p~~~vv~t~Ga~~  104 (385)
T PRK09276         28 ARGVDVISLGIG--DPDM-PTPKHIVEAMKKAAEDPANHQYPSYEGMLEFRKAVADWYKRRFGVELDPETEVISLIGSKE  104 (385)
T ss_pred             HCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCHH
T ss_conf             479981889799--8999-9899999999999808777665997271999999999999982987686776998788449


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |...+++.--       .+| +.||..+-+|.+....+.........    -|..+  +.-...|++.+++.+.++..++
T Consensus       105 al~~~~~~l~-------~pG-D~Vli~~P~Y~~y~~~~~~~g~~~v~----vp~~~--~~~~~~d~~~l~~~~~~~~k~i  170 (385)
T PRK09276        105 GIAHIPLAFV-------NPG-DYVLVPDPGYPVYAIGTIFAGGEPYF----MPLKE--ENGFLPDLDAIPEDVARKAKLM  170 (385)
T ss_pred             HHHHHHHHHC-------CCC-CEEEECCCCCCHHHHHHHHCCCEEEE----CCCCC--CCCCCCCHHHHHHHHCCCCEEE
T ss_conf             9999999973-------999-98998888662059999986997850----68666--6798579999997510167299


Q ss_pred             CCC-CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CCCCCCCCCCE----EECCCCCC-CCCCC
Q ss_conf             233-3222211246210123221102234572131011003444455531-01112454530----21034444-44344
Q gi|254780432|r  181 LIE-PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AYEWANVKPDI----MTIAKGMG-GGFPI  253 (392)
Q Consensus       181 i~E-pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~e~~gi~PDi----~~~gK~l~-gG~P~  253 (392)
                      ++- | +.--|. ..+.+-+++|.++|++||+.+|.|||...+---|... ..-...-..|.    -.+||.++ .|+=+
T Consensus       171 il~~P-~NPTG~-v~s~~~l~~l~~la~~~~i~ii~DEiY~~l~~~~~~~~s~~~~~~~~~~~i~~~S~SK~~~~~G~Rv  248 (385)
T PRK09276        171 FINYP-NNPTGA-VADLEFFEKVVDFAKKYDIIVCHDNAYSEIAYDGYKPPSFLEVPGAKDVGIEFHSLSKTYNMTGWRI  248 (385)
T ss_pred             EECCC-CCCCCC-HHHHHHHHHHHHHHCCCCCEEEEHHHHHHHCCCCCCCCCHHHCCCCCCCCCEECCCCCCCCCCCCEE
T ss_conf             98999-898551-1118899999876325575697544422210388888776553454244303046545568876207


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             32100011122222332234532111100123345543201222101----12100002688999988679707550464
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRGQ  329 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG~  329 (392)
                      |.+++++++++.+.......+.+.+...-.++.+.++.-  ++++++    .+++-+.+.+.|+++     ++ .-.+..
T Consensus       249 G~~~~~~~~~~~l~~~~~~~~~~~~~~~q~a~~~al~~~--~~~~~~~~~~~~~rr~~~~~~L~~~-----g~-~~~~p~  320 (385)
T PRK09276        249 GFAVGNADLIAGLGKVKSNVDSGVFQAIQEAAIAALNGP--QDVVEELRAIYQERRDILVEGLNSL-----GW-EVEKPK  320 (385)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHHHC-----CC-EEECCC
T ss_conf             999759999999999997655771099999999998486--9999999999899999999999876-----98-662688


Q ss_pred             EEE-EEEEEC--CCHHHHHHHHHH-CCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             009-998724--998999999996-89899626------8988995589868899999999999999
Q gi|254780432|r  330 GLL-IGLKTV--FSPALLAAKFRD-ECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       330 Gl~-~~ie~~--~~~~~~~~~l~~-~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~a  386 (392)
                      |-+ .=+++.  .+...++.++++ .||.+.|.      +.+.+||.  +..++++|++++++|++.
T Consensus       321 gg~~~w~~l~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~g~~~iRl~--~a~~~e~l~eal~Rl~kl  385 (385)
T PRK09276        321 ATFYVWAPVPKGYTSAEFATLLLDKAGIVVTPGNGFGTAGEGYFRIA--LTVPDERIEEAVERIKKL  385 (385)
T ss_pred             EEEEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHCC
T ss_conf             57799788999989899999999819999988742188998869999--759999999999998429


No 135
>PRK07568 aspartate aminotransferase; Provisional
Probab=99.68  E-value=1e-14  Score=116.74  Aligned_cols=338  Identities=19%  Similarity=0.236  Sum_probs=193.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCCCCCCCHHHHHHHHHHHHH---CCCCCCCCCCCCCCCHHH
Q ss_conf             799764641022674357878999999999999731-4506875781899999865201---013331235655540356
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVSNLYQSTQQEIFANHLIHS---TFADRVFFTNSGAESVEC  104 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~~~~~~~~~~~la~~L~~~---~~~~~v~f~~SGseA~e~  104 (392)
                      ..|++.|++.-|  .-.+- -++.+++|+++..+.. .|.+.....+.++.+++.+...   ...|.++.++++++|...
T Consensus        27 ~~G~~vi~l~iG--~Pd~~-~P~~~~~a~~~~~~~~~~Y~~~~G~~~LReaia~~~~~~g~~~~~d~I~iT~Ga~~al~~  103 (396)
T PRK07568         27 KRGIKVYHLNIG--QPDIK-TPEVFFEAIRNYDEEVLAYSHSAGIDSLREAFSKYYKRFNIDFDKDEIIVTNGGSEAILF  103 (396)
T ss_pred             HCCCCEEECCCC--CCCCC-CCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHEEEECCCHHHHHHH
T ss_conf             779980888798--89998-769999999850737898899867199999999999986889882228985780699999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             77766543200134786002343546565432123455321134799986433322210026887541012332222333
Q gi|254780432|r  105 AIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP  184 (392)
Q Consensus       105 Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~Ep  184 (392)
                      +++.--       .+| +.|+..+-+|.+....+.....+...   + |..+. .....++++.+++.+.+++-++++-.
T Consensus       104 ~~~~l~-------~pG-D~Vlv~~P~y~~y~~~~~~~g~~~v~---v-~~~~e-~g~~lp~~~~l~~~~~~~tk~ii~~~  170 (396)
T PRK07568        104 ALMAIC-------DPG-DEIIVPEPFYANYNGFATSAGVKIVP---V-TTKIE-EGFHLPKKEEIEKLITDKTKAILISN  170 (396)
T ss_pred             HHHHHC-------CCC-CEEEEECCCCCCHHHHHHHCCCEEEE---C-CCCHH-HCCCCCCHHHHHHHCCCCCEEEEECC
T ss_conf             999727-------998-98999389753259999984987851---6-76721-18878969999974776574998589


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC--CCCCCCCCE---EECCCCCCC-CCCCCCCCC
Q ss_conf             22221124621012322110223457213101100344445553101--112454530---210344444-434432100
Q gi|254780432|r  185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY--EWANVKPDI---MTIAKGMGG-GFPIGACLA  258 (392)
Q Consensus       185 v~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~--e~~gi~PDi---~~~gK~l~g-G~P~sav~~  258 (392)
                      =+.-.|. ..+.+.+++|.++|++||+++|.||+...+.-.|.-+-+  +..+...-+   -.+||.++- |+=+|.+++
T Consensus       171 P~NPTG~-v~s~~~~~~l~~la~~~~~~ii~De~Y~~l~y~g~~~~s~~~~~~~~~~vI~i~S~SK~~~~~G~RiG~~v~  249 (396)
T PRK07568        171 PGNPTGV-VYTKEELRQLADIAKEHDLFLISDEVYREFTYDGLKYTSAMNIEGIEDRVIIIDSVSKRYSACGARIGSLIT  249 (396)
T ss_pred             CCCCCCC-CCCHHHHHHHHHHHHHHCEEEECCCCHHHHEECCCCCCCHHCCCCCCCCEEEECCCCCCCCCCHHHEEEEEC
T ss_conf             9298875-401578999999998710667424535552208987757200556544225640455665784054355530


Q ss_pred             C-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEE-E
Q ss_conf             0-11122222332234532111100123345543201--222101121000026889999886797075504640099-9
Q gi|254780432|r  259 T-NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLI-G  334 (392)
Q Consensus       259 ~-~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~-~  334 (392)
                      . +++.+.+..... .+.+.+.+.-.++.+.|+.-++  +++.+..+++-+.+.+.|+    +++++ .-.+..|-|+ =
T Consensus       250 ~~~~~~~~~~~~~~-~~~~~~~~~Q~aa~~~l~~~~~~~~~~~~~y~~rrd~~~~~L~----~~~g~-~~~~P~Ggfyl~  323 (396)
T PRK07568        250 KNKELIKQAMKLCQ-ARLCPPTLEQIGAAALLNTPESYFKEVREEYEKRRDILYEGLN----KIPGV-VCEKPTGAFYII  323 (396)
T ss_pred             CCHHHHHHHHHHHH-CCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH----HCCCC-EECCCCEEEEEE
T ss_conf             99999999999712-1478977999999999858779999999999999999999997----07997-867888578999


Q ss_pred             EEEC-CCHHHHHHHHHH------CCEEEEEC---------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             8724-998999999996------89899626---------898899558986889999999999999999852
Q gi|254780432|r  335 LKTV-FSPALLAAKFRD------ECLLTAPS---------SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       335 ie~~-~~~~~~~~~l~~------~Gll~~~~---------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      +++. .+...++.++.+      +||.+.|.         |.+.|||+  +..++++|++++++|.++|.+-+
T Consensus       324 ~~lp~~~~~~f~~~ll~~~~~~~~~V~v~PG~~F~~~~g~g~~~iRls--~~~~~e~l~ea~~Rl~~~l~~~~  394 (396)
T PRK07568        324 AKLPVDDAEDFAKWMLTDFEYNGETVMVAPASGFYATPGLGKDEIRIA--YVLEKEDLRRAMEILKKALEAYN  394 (396)
T ss_pred             EECCCCCHHHHHHHHHHHHHHCCCEEEEECCHHHCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             958999999999999996212488699977634168998999969999--71999999999999999999852


No 136
>PRK06575 consensus
Probab=99.68  E-value=1.6e-14  Score=115.49  Aligned_cols=333  Identities=14%  Similarity=0.157  Sum_probs=195.6

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCC-CCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731-4506-87578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVS-NLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~-~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|-  -.+ -..|.|++|+.++++.. ..++ .....+.+..+++.+....+    .|.+..++++++|.
T Consensus        28 ~~G~dvi~L~iG~--pdf-~~p~~i~~a~~~a~~~g~~~Y~~~~G~~~Lr~aia~~~~~~~~~~~~~d~i~vt~G~~~al  104 (399)
T PRK06575         28 KAGVDIIALGAGE--PDF-DTPDNIKEAAIKAIKDGFTKYTNVEGMPLLKQAIKDKFKRENNIDYELDEIIVSTGGKQVI  104 (399)
T ss_pred             HCCCCEEECCCCC--CCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHEEEEECCCCHHH
T ss_conf             7799837788958--999-9699999999999855999889987839999999999999858999843199948952899


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.-       -.+| .+||..+-+|...........+.+...    +.  +...-...|++++++.+.+++-++++
T Consensus       105 ~~~~~~l-------~~pG-D~Vli~~P~y~~y~~~~~~~~~~~v~~----~~--~~e~~~~~d~e~l~~~~~~~~k~iil  170 (399)
T PRK06575        105 YNLFMAS-------LDKG-DEVIIPAPYWVSYPDMVALSTGTPVFV----NC--GIENNFKLSAEALERSITDKTKWLII  170 (399)
T ss_pred             HHHHHHH-------CCCC-CEEEECCCCCCCHHHHHHHHCCEEEEE----CC--CCCCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             9999986-------5899-989974785323589999828856994----15--75546555899998644447679998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCC-CCEEEECCCCCCCCCCCCCCCCCCCCCCCCE-------EECCCCCC-CCCC
Q ss_conf             -332222112462101232211022345-7213101100344445553101112454530-------21034444-4434
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDI-DALLIFDEVQTGYGRTGKLFAYEWANVKPDI-------MTIAKGMG-GGFP  252 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~-g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi-------~~~gK~l~-gG~P  252 (392)
                       -|= .-.| ...+++.|+++.++|++| ++++|.|||...+--.|.-+-+ ...+.||+       -.+||..+ .|+=
T Consensus       171 ~nP~-NPTG-~v~~~eel~~i~~~~~k~~~v~iisDEiY~~~~~~~~~~~s-~~~~~~~~~~~~i~~~s~SK~~~~~G~R  247 (399)
T PRK06575        171 NSPS-NPTG-ASYNFEELENIAKVLRKYPHVNVMSDDIYEHITFDDFKFYT-LAQIAPDLKERIFTVNGVSKAYSMTGWR  247 (399)
T ss_pred             CCCC-CCCC-CCCCHHHHHHHHHHHHHCCCEEEECHHHHHHHCCCCCCCCC-HHHHCCCCCCCEEEECCCCCCCCCCCCC
T ss_conf             9999-9988-87889999999999874587378421356664168987741-1330765422325741421014787723


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             432100011122222332234532111100123345543201222101----1210000268899998867970755046
Q gi|254780432|r  253 IGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRG  328 (392)
Q Consensus       253 ~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG  328 (392)
                      +|.+++.+++++.+.......+...+.++..++.+.|+..  ++.++.    .+++-+.+.+.|+    +.+. +.-.+.
T Consensus       248 iG~~~~~~~~i~~~~~~~~~~~~~~~~~~q~aa~~al~~~--~~~~~~~~~~~~~~r~~~~~~l~----~~~~-~~~~~P  320 (399)
T PRK06575        248 IGYGAGSKALIKAMTIIQSQSTSNPCSISQMAAIEALNGP--QDYIKPNALNFQKKRDLALSILK----RVKY-FECYKP  320 (399)
T ss_pred             EEEEECCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHH----HCCC-CEEECC
T ss_conf             3753087999999999996156786689999999998584--77899999999999999999986----4798-446179


Q ss_pred             CEEEEE-EEEC-------------CCHHHHHHHHHH-CCEEEEEC----CCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             400999-8724-------------998999999996-89899626----8988995589868899999999999999998
Q gi|254780432|r  329 QGLLIG-LKTV-------------FSPALLAAKFRD-ECLLTAPS----SDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       329 ~Gl~~~-ie~~-------------~~~~~~~~~l~~-~Gll~~~~----~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      .|.+.. +++.             .+...+++++.+ .||.+.|.    .++.+|+.  +..++++|++++++|++++..
T Consensus       321 ~G~~yl~~~~~~~~~~~~~~~~~~~~~~~f~~~Ll~e~~V~v~PG~~FG~~g~~Rl~--~a~~~e~l~ea~~Rl~~a~~~  398 (399)
T PRK06575        321 EGAFYLFVKCDKIFGHKTKSGKIIANSNDFAEYLLEEAKVAVVPGIAFGLEGYFRIS--YATSMEELEEACIRIERACNV  398 (399)
T ss_pred             CCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHH
T ss_conf             923799577730015444346767899999999997299999848555899839999--739899999999999999974


Q ss_pred             H
Q ss_conf             5
Q gi|254780432|r  390 L  390 (392)
Q Consensus       390 L  390 (392)
                      |
T Consensus       399 L  399 (399)
T PRK06575        399 L  399 (399)
T ss_pred             C
T ss_conf             9


No 137
>PRK07681 aspartate aminotransferase; Provisional
Probab=99.67  E-value=5.7e-15  Score=118.32  Aligned_cols=329  Identities=14%  Similarity=0.185  Sum_probs=196.4

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCCCC-CCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCCC
Q ss_conf             799764641022674357878999999999999731-450687-578189999986520101----33-31235655540
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVSNL-YQSTQQEIFANHLIHSTF----AD-RVFFTNSGAES  101 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~~~-~~~~~~~~la~~L~~~~~----~~-~v~f~~SGseA  101 (392)
                      ..|++.|++.-|.-  .+ --.|.+++|+.+.++.. .+..+. ...+.+..+++.+.+..+    .| .++.++++++|
T Consensus        29 ~~g~~vI~l~iG~P--d~-~~p~~i~~a~~~~~~~~~~~~y~~~G~~eLReaia~~~~~~~g~~~~pd~~I~vt~G~~~a  105 (399)
T PRK07681         29 AAGHKMIDLSIGNP--DM-PPADFVREEMVHTANEKESYGYTLSGIQEFHEAVTEYYNNTHNVILNADKEVLLLMGSQDG  105 (399)
T ss_pred             HCCCCEEECCCCCC--CC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHH
T ss_conf             67998388989889--99-8789999999999718776888988739999999999999868998988849986888999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             35677766543200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       102 ~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
                      ...+++.--       .+| ..|+..+.+|.+...........+..    -|..+  +.-...|++.+++.+.+++.+++
T Consensus       106 l~~~~~al~-------~pG-D~Vli~~P~Y~~y~~~~~~~g~~~v~----vpl~~--e~~~~~d~~~l~~~i~~~tk~ii  171 (399)
T PRK07681        106 LVHLPMVYA-------NPG-DIILVPDPGYTAYETGIQMAGATSYY----MPLKK--ENDFLPDLELIPEEIADKAKMMI  171 (399)
T ss_pred             HHHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEE----EECCC--CCCCHHHHHHHHHHCCCCCEEEE
T ss_conf             999999967-------999-98997568744279999876998999----50576--66743689999985322555999


Q ss_pred             CC-CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CC-CCCCCCC---CEEECCCCCC-CCCCCC
Q ss_conf             33-3222211246210123221102234572131011003444455531-01-1124545---3021034444-443443
Q gi|254780432|r  182 IE-PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AY-EWANVKP---DIMTIAKGMG-GGFPIG  254 (392)
Q Consensus       182 ~E-pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~-e~~gi~P---Di~~~gK~l~-gG~P~s  254 (392)
                      +- |= .-.|. ..+++.+++|.++|++||+++|.||+...+--.|.-+ .+ ...+...   -+-.+||..+ .|+=+|
T Consensus       172 l~~P~-NPTG~-v~s~e~l~~l~~la~~~~i~iIsDEiY~~l~~~~~~~~s~~~~~~~~~~~I~i~S~SK~~~~~G~RiG  249 (399)
T PRK07681        172 LNFPG-NPVPA-MAHEDFFKEVIAFAKKHNIIVVHDFAYAEFYFDGNKPISFLSVPGAKEVGVEINSLSKSYSLAGSRIG  249 (399)
T ss_pred             ECCCC-CCCCC-CCCHHHHHHHHHHHHHCCCEEECCCCCCCEEECCCCCCCHHHCCCCCCCCCEECCCCCCCCCCCCCEE
T ss_conf             76998-98887-78999999999985313633431255111031798875764433541345253221345556532169


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECCCE
Q ss_conf             2100011122222332234532111100123345543201222101----121000026889999886797075504640
Q gi|254780432|r  255 ACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRGQG  330 (392)
Q Consensus       255 av~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G  330 (392)
                      .+++.+++++.+.......+++.+...-.++.+.|+.-  +.++++    .+++-+.+.+.|+++     ++. -.+..|
T Consensus       250 ~~i~~~~~i~~~~~~~~~~~~~~~~~~q~aa~~al~~~--~~~~~~~r~~~~~rr~~l~~~L~~~-----g~~-~~~P~G  321 (399)
T PRK07681        250 YMIGNEEIVRALTQFKSNTDYGVFLPIQKAACAALRNG--AAFCEKNREIYQERRDTLVDGFRTF-----GWN-VDKPAG  321 (399)
T ss_pred             EEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHHHC-----CCE-ECCCCC
T ss_conf             99709999999999998665674539999999999687--4789999999999999999999875-----986-337880


Q ss_pred             -EEEEEEEC--CCHHHHHHHHHH-CCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             -09998724--998999999996-89899626------8988995589868899999999999999
Q gi|254780432|r  331 -LLIGLKTV--FSPALLAAKFRD-ECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       331 -l~~~ie~~--~~~~~~~~~l~~-~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~a  386 (392)
                       ++.=+++.  .+...++.++.+ .||.+.|.      +.+.+||.  |..++++|++++++|+++
T Consensus       322 g~y~w~~l~~~~d~~~f~~~Ll~~~gV~v~PG~~Fg~~g~g~iRl~--f~~~~e~l~eal~RLk~a  385 (399)
T PRK07681        322 SMFVWAEIPDGWTSLDFAYALMDRANVVVTPGHAFGPHGEGFVRIA--LVQDKEVLQQVVENIRNS  385 (399)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHHC
T ss_conf             0289688999999799999999829999988646589998869999--718899999999999888


No 138
>PRK07543 consensus
Probab=99.67  E-value=5.2e-15  Score=118.59  Aligned_cols=333  Identities=13%  Similarity=0.120  Sum_probs=197.2

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731--450687578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~--~~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|-  -.+. -+|.|.+|++++++..  .|.......+.+..+++.+.+..+    .|.+..++++++|.
T Consensus        28 ~~G~dii~l~~G~--pdf~-~p~~i~~a~~~al~~~~~~Y~~~~G~~eLR~aia~~~~~~~g~~~~pd~V~vt~G~~~al  104 (400)
T PRK07543         28 AAGRDVIGLGAGE--PDFD-TPDNIKQAAIAAINAGKTKYTAVDGIPELKQAICAKFKRENGLDYKPEQVIVGTGGKQIL  104 (400)
T ss_pred             HCCCCEEECCCCC--CCCC-CCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCHHHH
T ss_conf             7799807899979--9999-799999999999845999898998809999999999999848998804289927826999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++..-       .+| ++||..+-+|...........+.+...    +..  ...-...|.+.+++.+.+++-++|+
T Consensus       105 ~~~~~al~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v~v----~~~--~e~~~~~d~~~le~~i~~~~k~iil  170 (400)
T PRK07543        105 YNALMATL-------NPG-DEVIIPAPYWVSYPEMVALAGGTPVFV----ETT--AEFGFKLTPEALEAAITPKTKWFIF  170 (400)
T ss_pred             HHHHHHHC-------CCC-CEEEEECCCCCCCHHHHHHHCCEEEEE----ECC--CCCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999857-------999-989982786655368999808835995----246--3337543847789747866719998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCC-CCEEEECCCCCCCCCCCCCCCCCCCCCCCC-------EEECCCCCC-CCCC
Q ss_conf             -332222112462101232211022345-721310110034444555310111245453-------021034444-4434
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDI-DALLIFDEVQTGYGRTGKLFAYEWANVKPD-------IMTIAKGMG-GGFP  252 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~-g~llI~DEV~tG~GRtG~~f~~e~~gi~PD-------i~~~gK~l~-gG~P  252 (392)
                       -| ..-.|. ..+.+.+++|.++|.+| ++++|.||+...+--.|.-|.. -..+.|+       +-.+||..+ .|+=
T Consensus       171 ~~P-~NPTG~-v~s~~~l~~l~~~~~~~~~v~iisDEiY~~l~~~~~~~~~-~~~~~p~~~~~~i~~~s~SK~~~~~G~R  247 (400)
T PRK07543        171 NSP-SNPTGA-AYTRAELKALTDVLVKHPHVWVLTDDMYEHLVYDDFVFTT-PAQVEPSLYDRTLTMNGVSKAYAMTGWR  247 (400)
T ss_pred             CCC-CCCCCC-CCCHHHHHHHHHHHHHHCCCEECCHHHHHHHHCCCCCCCC-HHHCCHHHHCCCCCCCCCCHHCCCCCCC
T ss_conf             799-898883-7641678999998887538603131245664148978899-6782902210342037740520683430


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             432100011122222332234532111100123345543201222101----1210000268899998867970755046
Q gi|254780432|r  253 IGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRG  328 (392)
Q Consensus       253 ~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG  328 (392)
                      +|.+++.+++.+.+.......+++.+.++-.+|.+.|+.-  +++++.    .+++-+.+.+.|++    .+++ .-...
T Consensus       248 iG~~~~p~~li~~~~~~~~~~~~~~~~~~Q~aa~~al~~~--~~~~~~~~~~~~~rrd~~~~~L~~----~~g~-~~~~P  320 (400)
T PRK07543        248 IGYAAGPAELIKAMDTIQSQSTSNPCSIAQWAAVEALNGP--QDFIPANKKIFQERRDLVVSMLNQ----AKGI-DCPTP  320 (400)
T ss_pred             EEEEECCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHHH----CCCC-CCCCC
T ss_conf             4888678999999999997504676609999999998585--999999999999999999999986----7798-46799


Q ss_pred             CEEEEEE-EE-------------CCCHHHHHHHHH-HCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             4009998-72-------------499899999999-6898996268----988995589868899999999999999998
Q gi|254780432|r  329 QGLLIGL-KT-------------VFSPALLAAKFR-DECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       329 ~Gl~~~i-e~-------------~~~~~~~~~~l~-~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      .|.++.. ++             ..++..++.++. +.||.+.|..    ++.+||+  +..+++.|++++++|++.+.+
T Consensus       321 ~g~fy~~~~~~~~~~~~~p~~~~~~~~~~f~~~ll~~~gV~v~PG~~FG~~~~~Ri~--~a~~~e~l~ea~~Rl~~f~~~  398 (400)
T PRK07543        321 EGAFYVYPSCAGLIGKTTPSGKVIETDEDFVTELLETEGVAVVHGSAFGLGPNFRIS--YATSDELLEEACKRIQRFCAS  398 (400)
T ss_pred             CEEEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCCEEEE--ECCCHHHHHHHHHHHHHHHHH
T ss_conf             866898211032320037556767999999999998499999847010899998999--759899999999999999996


Q ss_pred             H
Q ss_conf             5
Q gi|254780432|r  390 L  390 (392)
Q Consensus       390 L  390 (392)
                      |
T Consensus       399 l  399 (400)
T PRK07543        399 L  399 (400)
T ss_pred             C
T ss_conf             5


No 139
>PRK07366 succinyldiaminopimelate transaminase; Validated
Probab=99.67  E-value=7.2e-15  Score=117.69  Aligned_cols=332  Identities=13%  Similarity=0.116  Sum_probs=191.5

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-C--CCCCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCC
Q ss_conf             799764641022674357878999999999999731-4--50687578189999986520101----33-3123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-W--HVSNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~--~~~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGse  100 (392)
                      ..|++.|++.-|  --.+ ...+.|++|++++++.. .  |+......+.+..+++.+.+..+    .+ .++.++++++
T Consensus        27 ~~G~~vi~l~iG--~pdf-~~P~~i~~a~~~a~~~~~~~gY~~~~G~~~lR~aIa~~~~~~~g~~~~pe~~V~~t~G~~~  103 (388)
T PRK07366         27 AAGKEVIDLSLG--SSDL-PAPAHALEAIAQSLQDPSTHGYLLFHGTLPFREAAAAWYEQRFGLAVDPETEVLPLIGSQE  103 (388)
T ss_pred             HCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHH
T ss_conf             589984987086--8999-9889999999999809767678987578999999999999997898898873998478899


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |...+++..       -.+| +.||..+-+|...........+....    -|..+  +.-...|++++++.+.++.-++
T Consensus       104 al~~~~~al-------~~pG-D~Vli~~P~Y~~y~~~~~~~G~~~~~----vpl~~--~~~~~~d~~~l~~~i~~~tk~i  169 (388)
T PRK07366        104 GTAHLPLAL-------LNPG-DFALLLDPGYPSHAGGVYLAGGQIYP----MPLRA--ENDFLPVFADIPTEVLAQARLM  169 (388)
T ss_pred             HHHHHHHHH-------CCCC-CEEEEECCCCCCHHHHHHHCCCEEEE----EECCC--CCCCCCCHHHHHHHHHHCCCEE
T ss_conf             999999996-------6999-98998258776518999985985799----75466--6798479999987404228299


Q ss_pred             CC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCC--CCCCCCCE--E--ECCCCCC-CCCC
Q ss_conf             23-33222211246210123221102234572131011003444455531011--12454530--2--1034444-4434
Q gi|254780432|r  181 LI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYE--WANVKPDI--M--TIAKGMG-GGFP  252 (392)
Q Consensus       181 i~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e--~~gi~PDi--~--~~gK~l~-gG~P  252 (392)
                      |+ -| +.--|. ..+++-++++.++|++||+++|.|||...+--.|......  ..+...+.  .  .+||..+ .|+=
T Consensus       170 il~~P-~NPTG~-v~s~~~l~~i~~~a~~~~i~lisDEiY~~l~~~~~~~~p~~~~~~~~~~~~i~~~S~SK~f~~~G~R  247 (388)
T PRK07366        170 VLSYP-HNPTTA-IAPLSFFQEAVAFCQQHDLVLVHDFPYVDLVFDGEVEPPSILQADPEKSVSIEFFTLSKSYNMGGFR  247 (388)
T ss_pred             EECCC-CCCCCE-EEEHHHHHHHHHHHHHCCEEEECCCEEEEEEECCCCCCCHHHHCCCCCCEEEEEECCCCCCCCCCCE
T ss_conf             98589-898466-8038888889998740550786220214458668766613542572206179973353257887651


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCE
Q ss_conf             432100011122222332234532111100123345543201--222101121000026889999886797075504640
Q gi|254780432|r  253 IGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQG  330 (392)
Q Consensus       253 ~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G  330 (392)
                      +|.+++.+++++.+.......++...+..+.+|.+.++.-++  +++.+..+++-+.+.+.|+++     ++. -.+-.|
T Consensus       248 iG~~i~~~~li~~~~~~~~~~~~~~~~~~~~~a~~al~~~~~~~~~~~~~~~~rr~~~~~~L~~~-----g~~-~~~P~g  321 (388)
T PRK07366        248 IGFAIGNAQLIAALRQIKAVVDFNQYRGILNGAIAALTGPQACVQQTVQIFRQRRDAFINALHRI-----GWP-VPLPEA  321 (388)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CCE-EECCCE
T ss_conf             89996799999999999875476543999999999996888999999999999999999999977-----987-507985


Q ss_pred             E-EEEEEEC----CCHHHHHHHH-HHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             0-9998724----9989999999-9689899626------89889955898688999999999999999
Q gi|254780432|r  331 L-LIGLKTV----FSPALLAAKF-RDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       331 l-~~~ie~~----~~~~~~~~~l-~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      . ++=+++.    .++..++.++ .+.||.+.|.      +++.+||+  +..+++.|.+++++|++.|
T Consensus       322 ~~y~w~~l~~~~~~~~~ef~~~Ll~~~gV~v~PG~~Fg~~g~g~iRl~--~a~~~~~l~eal~Rl~~~l  388 (388)
T PRK07366        322 TMYVWAKLPEPWQGNSVEFCTQLVAQTGVAASPGSGFGKSGEGYVRFA--LVHDPDILEEAVERIAAFL  388 (388)
T ss_pred             EEEEEEECCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHC
T ss_conf             779978789878899899999999839999976646588999869999--6299999999999999869


No 140
>PRK09148 aminotransferase; Validated
Probab=99.67  E-value=6.3e-15  Score=118.08  Aligned_cols=332  Identities=14%  Similarity=0.129  Sum_probs=194.9

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC---CCCCCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCC
Q ss_conf             799764641022674357878999999999999731---450687578189999986520101----33-3123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL---WHVSNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~---~~~~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGse  100 (392)
                      ..|++.||+.-|  .-.+ --+|.|++|+.+.+...   .|++.....+.++.+++.+....+    ++ .+..++++++
T Consensus        28 ~~G~~Vi~L~iG--~Pd~-~~P~~i~~a~~~a~~~~~~~~Y~~~~G~p~LReaia~~~~~r~g~~~~p~~~Iivt~Ga~~  104 (406)
T PRK09148         28 AAGADIIDLGMG--NPDL-PTPQHIVDKLCETAGKPRTHRYSASKGIPGLRRAQAAYYARRFGVKLNPDTQVVATLGSKE  104 (406)
T ss_pred             HCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHH
T ss_conf             679982889898--9999-9789999999999749988878997585999999999999985898898873998879899


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |...+++.-       -.+| ..|+..+-+|-...............    -|..+  ......+++.+.+....+.-++
T Consensus       105 al~~~~~al-------~~pG-D~Vli~~P~Yp~y~~~~~~~g~~~~~----v~~~~--~~~~~~~le~~~~~~~~ktk~i  170 (406)
T PRK09148        105 GFANMAQAI-------TAPG-DVVLCPNPSYPIHAFGFIMAGGVIRS----VPAEP--DEEFFPALERAVRHSIPKPIAL  170 (406)
T ss_pred             HHHHHHHHH-------CCCC-CEEEECCCCHHHHHHHHHHHCCCEEE----CCCCC--CCCCCCCHHHHHHHCCCCCEEE
T ss_conf             999999996-------6999-99998077658789999981791586----05776--4333302999997458764499


Q ss_pred             C-CCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC--CCCCCCCCE----EECCCCCC-CCCC
Q ss_conf             2-33322221124621012322110223457213101100344445553101--112454530----21034444-4434
Q gi|254780432|r  181 L-IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY--EWANVKPDI----MTIAKGMG-GGFP  252 (392)
Q Consensus       181 i-~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~--e~~gi~PDi----~~~gK~l~-gG~P  252 (392)
                      | .-|-. -.|. ..+.+.+++|.++|++||+++|.||+...+.-.|..+-+  +..+. .|.    -.+||..+ .|+=
T Consensus       171 il~~P~N-PTG~-v~~~~~l~~l~~~a~~~~i~visDEiY~~l~~~~~~~~s~~~~~~~-~~~~I~~~s~SK~~~m~G~R  247 (406)
T PRK09148        171 IVNYPSN-PTAY-VADLDFYKDLVAFAKKHDIWILSDLAYSEIYFDGNPPPSVLQVPGA-KDVTVEFTSMSKTFSMAGWR  247 (406)
T ss_pred             EECCCCC-CCCC-CCCHHHHHHHHHHHHCCEEEEECCCCHHHHEECCCCCCCHHHCCCH-HHHHHHHCCCCHHCCCCCCC
T ss_conf             9778999-8887-6899999999987540548996342253513788767554317430-32211111420303675533


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             432100011122222332234532111100123345543201222101----1210000268899998867970755046
Q gi|254780432|r  253 IGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRG  328 (392)
Q Consensus       253 ~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG  328 (392)
                      +|.+++.+++++.+.......+++.+...-.++.+.|+.-  ++.+++    .+++-+.+.+.|++     .++ .-...
T Consensus       248 iG~~v~~~~li~~l~~~~~~~~~~~~~~~Q~aa~~aL~~~--~~~~~~~~~~y~~rrd~l~~~L~~-----~g~-~~~~P  319 (406)
T PRK09148        248 MGFAVGNERLIAALTRVKSYLDYGAFTPIQVAATAALNGP--QDCIAEMREVYKKRRDVLVESFGR-----AGW-DIPPP  319 (406)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHHH-----CCC-EECCC
T ss_conf             5999759999999999997643788789999999997596--789999999999999999998886-----697-64379


Q ss_pred             CEEEEE-EEECC-----CHHHHHHHHHHC-CEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             400999-87249-----989999999968-9899626------89889955898688999999999999999985
Q gi|254780432|r  329 QGLLIG-LKTVF-----SPALLAAKFRDE-CLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       329 ~Gl~~~-ie~~~-----~~~~~~~~l~~~-Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      .|.|+. +++..     +...++.++.++ ||.+.|.      +++.+||+  +..+++.|++++++|++.+.++
T Consensus       320 ~G~~y~w~~l~~~~~~~~~~~f~~~Ll~~~gV~v~PG~~Fg~~g~~~iRls--fa~~~~~L~eal~Rl~~~l~~~  392 (406)
T PRK09148        320 AASMFAWAPIPEAFRHLGSLEFSKLLVEKADVAVAPGVGFGEHGEGYVRIA--LVENEQRIRQAARNIKRFLSSA  392 (406)
T ss_pred             CEEEEEEEECCCCCCCCCHHHHHHHHHHCCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHCC
T ss_conf             836999988864347899999999999739999989732188998859999--7388999999999999999760


No 141
>PRK06290 aspartate aminotransferase; Provisional
Probab=99.67  E-value=7.8e-15  Score=117.45  Aligned_cols=332  Identities=13%  Similarity=0.142  Sum_probs=200.9

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-C-CCCCCCCCHHHHHHHHHHHHHCC------CCCCCCCCCCCC
Q ss_conf             799764641022674357878999999999999731-4-50687578189999986520101------333123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-W-HVSNLYQSTQQEIFANHLIHSTF------ADRVFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~-~~~~~~~~~~~~~la~~L~~~~~------~~~v~f~~SGse  100 (392)
                      ..|.+.||+.-|  . .=-..++.|++|+.++++.. . +++.....+.+.+.++.+-+..+      .+.+..++++++
T Consensus        41 ~~~~DVI~L~iG--e-PDf~tP~~i~~a~~~a~~~~~~~y~~~~G~~eLReaIa~~~~~~~gv~~~dp~~eIivt~Ga~~  117 (411)
T PRK06290         41 YPDMELIDMGVG--E-PDEMADESVVEVLCEEAKKPENRGYADNGIQELKEAAARYMEKVYGVKDLDPVTEVIHSIGSKP  117 (411)
T ss_pred             CCCCCEEECCCC--C-CCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCHHH
T ss_conf             879987778998--9-9998799999999999837998888987649999999999999719987897767998988899


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |...++..--       .+| ..||..+-+|-.-........+.+..-    |..+  ..-...|++++++.+.++.-++
T Consensus       118 al~~~~~all-------~pG-DeVli~~P~yp~Y~~~~~~~G~~~v~v----p~~~--e~~~~~d~~~l~~~i~~ktK~i  183 (411)
T PRK06290        118 ALAYLPSCFI-------NPG-DVTLMTVPGYPVTATHTKWYGGEVYNL----PLLE--ENNFLPDLDAIPKDVLEKAKLL  183 (411)
T ss_pred             HHHHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHCCCEEEEE----ECCC--CCCCCCCHHHHHHHCCCCCEEE
T ss_conf             9999999966-------999-989986887365899999849989998----6566--6787659577198625576599


Q ss_pred             CC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCC-CCCCCCC--E--EECCCCCC-CCCCC
Q ss_conf             23-33222211246210123221102234572131011003444455531011-1245453--0--21034444-44344
Q gi|254780432|r  181 LI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYE-WANVKPD--I--MTIAKGMG-GGFPI  253 (392)
Q Consensus       181 i~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e-~~gi~PD--i--~~~gK~l~-gG~P~  253 (392)
                      ++ -|- .-.| ...+++.++.|.++|++||+++|.|||...+--.|+.+.+- ..+. .|  |  -.+||..+ .|+-+
T Consensus       184 ilnsP~-NPTG-~v~s~e~l~~i~~~a~~~~i~vIsDEiY~~l~yd~~~~s~~s~~~~-~~~~I~i~S~SK~~~mtGwRi  260 (411)
T PRK06290        184 YLNYPN-NPTG-AVATKEFYKEVVDFAFENDIIVVQDAAYAALTFDGKPLSFLSVPGA-KEVGVEIHSFSKAYNMTGWRL  260 (411)
T ss_pred             EECCCC-CCCC-EEECHHHHHHHHHHHHHCCCEEECHHHHHHHEECCCCCCCCCCCCC-CCEEEEECCCCCCCCCCEEEE
T ss_conf             988999-9986-1424899999999986428776423535551008977761025677-441799825774678722458


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC----HHHHHCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             3210001112222233223453211110012334554320122210----112100002688999988679707550464
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE----NVINIAKILFEGLTAIKNRFPNMFLEVRGQ  329 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~----~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~  329 (392)
                      |.+++.+++++.+.......+.+.....-.||.+.|+   .++..+    ..+++-+.+.+.|+++     + +.-....
T Consensus       261 G~~i~~~~li~~~~~i~~~~~~~~~~~~Q~aa~~aL~---~~~~~~~~~~~y~~rrd~l~~~L~~~-----G-~~~~~P~  331 (411)
T PRK06290        261 AFVAGNELIVKAFAAVKDNTDSGQFIAIQKAGIYCLR---HPEITEKTRAKYERRLDKMVKILKEV-----G-FNAKMPG  331 (411)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHC-----C-CEECCCC
T ss_conf             9886699999999999974647614999999999955---98999999999999999999999977-----9-8506887


Q ss_pred             EEEEE-EEECC---------CHHHHHHHHH-HCCEEEEECC--CCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             00999-87249---------9899999999-6898996268--98899558986889999999999999999852
Q gi|254780432|r  330 GLLIG-LKTVF---------SPALLAAKFR-DECLLTAPSS--DNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       330 Gl~~~-ie~~~---------~~~~~~~~l~-~~Gll~~~~~--~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      |.|.. +++..         ++..++.+|+ +.||.+.|..  ++-+||+  ++.++++|++++++|++..+.|+
T Consensus       332 GafY~~~~ip~~~~~~~~~~~~~efa~~LLee~~VavvPG~~fG~yvRis--~~~~~e~leea~~rl~~~~~~l~  404 (411)
T PRK06290        332 GTFYLYVKAPKGTKSGIKFANAEEFSQYLIKEKLISTVPWDDAGHFLRMS--VTFEAKSIEEEDRILNEVKRRLS  404 (411)
T ss_pred             EEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHHH
T ss_conf             53699687877665777668999999999984899995655153559999--83889999999999999999872


No 142
>PRK05166 histidinol-phosphate aminotransferase; Provisional
Probab=99.67  E-value=1.4e-14  Score=115.79  Aligned_cols=323  Identities=15%  Similarity=0.211  Sum_probs=199.3

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCCCCCCHHHHHH
Q ss_conf             9976464102267435787899999999999973145068757818999998652010--13331235655540356777
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHST--FADRVFFTNSGAESVECAIK  107 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~--~~~~v~f~~SGseA~e~Aik  107 (392)
                      .+.+.||+.++  -+.+|= .|++.+|+.++++.+    +.|..+...+|-+.|.+..  +.+.+..+|+.+|+...+++
T Consensus        36 ~~~~~i~L~~N--eNP~gp-sp~v~~a~~~~~~~~----~rYPd~~~~~Lr~aiA~~~gv~~~~I~v~nGs~e~i~~~~~  108 (374)
T PRK05166         36 HVPRIAKLGSN--ENPLGP-SPALARLFPDIAELL----RLYPDPQGRALRAEIAASFGVPTDQIILGNGSEDLIAVICR  108 (374)
T ss_pred             CCCCEEEECCC--CCCCCC-CHHHHHHHHHHHHHC----CCCCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHH
T ss_conf             89985880699--999898-999999999868753----76979878999999999968383019985689999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCCCC
Q ss_conf             66543200134786002343546565432123455321134799986433322210026887541012332222-33322
Q gi|254780432|r  108 TARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL-IEPIQ  186 (392)
Q Consensus       108 lar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi-~Epv~  186 (392)
                      ..-       .+| ++|+....+|-.-...+....+... .   -|..+++    ..|++++.+.+.+++-.|+ .-|=.
T Consensus       109 a~~-------~pG-d~Vl~~~Ptf~~Y~~~~~~~G~~v~-~---vpl~~~~----~~d~~~l~~ai~~~tklv~l~nPnN  172 (374)
T PRK05166        109 AVL-------RPG-DRVVTLYPSFPLHEDYPTLMGARVE-R---VTVTPDL----TVDVDALLAAVARKPRMLMFSNPMN  172 (374)
T ss_pred             HHH-------CCC-CEEEECCCCHHHHHHHHHHHCCEEE-E---EECCCCC----CCCHHHHHHHHCCCCCEEEEECCCC
T ss_conf             997-------399-9898778877789999998298159-9---7368667----9799999986156987899828989


Q ss_pred             CCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CCCCCCCCC-C-EE--ECCCCCC-CCCCCCC-CCCC
Q ss_conf             2211246210123221102234572131011003444455531-011124545-3-02--1034444-4434432-1000
Q gi|254780432|r  187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AYEWANVKP-D-IM--TIAKGMG-GGFPIGA-CLAT  259 (392)
Q Consensus       187 g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~e~~gi~P-D-i~--~~gK~l~-gG~P~sa-v~~~  259 (392)
                       --|. ..+++.++.+.+.|++ +.++|+||...-|-....+- ......-.. . |+  +|||..+ .|+=+|. ++..
T Consensus       173 -PTG~-~~~~~~l~~l~~~~~~-~~~vvvDEaY~ef~~~~~~~~~~~~~~~~~~n~IvlrSfSK~~glaGlRvGyai~~~  249 (374)
T PRK05166        173 -PVGS-WLTPGALARLLDAVPP-ETLIVVDEAYAEYAAGDDYPSALTLLKNRGLPWVVLRTFSKAYGLAGLRIGYGLVSD  249 (374)
T ss_pred             -CCCC-CCCHHHHHHHHHHCCC-CEEEEECHHHHHHHCCCCCCCHHHHHHHCCCCEEEEEECCHHHHCCCCCEEEEECCC
T ss_conf             -9876-5884779999974588-739995047899752788664798862047877999955565515777504541592


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECC
Q ss_conf             11122222332234532111100123345543201222101121000026889999886797075504640099987249
Q gi|254780432|r  260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF  339 (392)
Q Consensus       260 ~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~  339 (392)
                      .++.+.+....  .+|+-|.++.++|.++|+-   .+.+++..+.-..-++.+.+...+. ++ .-....|-++-++...
T Consensus       250 ~~i~~~l~~~~--~~~~v~~~aq~aa~aaL~~---~~~~~~~~~~~~~~R~~l~~~L~~~-g~-~v~ps~anFilv~~~~  322 (374)
T PRK05166        250 PSLRAFLDRVR--TPFNANGIAQAAALAALDD---EEHLAKGVALALAERERMKKELAEM-GY-RVAPSRANFLFFDART  322 (374)
T ss_pred             HHHHHHHHHHC--CCCCCCHHHHHHHHHHHCC---HHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCEEEEEECCC
T ss_conf             99999999834--9828699999999998569---9999999999999999999999977-79-4899866189986899


Q ss_pred             CHHHHHHHHHHCCEEEEEC----CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9899999999689899626----898899558986889999999999999999
Q gi|254780432|r  340 SPALLAAKFRDECLLTAPS----SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       340 ~~~~~~~~l~~~Gll~~~~----~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      +...+.++|+++|+++++.    .++.+|++   +=|.+|-++++++|++.+.
T Consensus       323 ~~~~~~~~L~~~gI~Vr~~~~~gl~~~lRIs---vgt~een~rll~aL~~il~  372 (374)
T PRK05166        323 DASALAEALLRQGVIVKPWKQPGFETYIRVS---IGSPEENDHFMAALDEVLA  372 (374)
T ss_pred             CHHHHHHHHHHCCCEEEECCCCCCCCEEEEE---ECCHHHHHHHHHHHHHHHH
T ss_conf             9999999998489199858989999989998---1899999999999999985


No 143
>PRK08912 hypothetical protein; Provisional
Probab=99.66  E-value=1.1e-14  Score=116.48  Aligned_cols=331  Identities=16%  Similarity=0.171  Sum_probs=195.1

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC-CC-CCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314-50-687578189999986520101----33-31235655540
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW-HV-SNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAES  101 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~-~~-~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGseA  101 (392)
                      +.++..||+.-|  .-.+ -.++.|++|+.++++... ++ ......+.+..+++.+.+..+    .+ .++.++++++|
T Consensus        23 a~~~~~I~L~~G--~Pd~-~~p~~i~~a~~~a~~~~~~~Y~~~~G~~~LR~aia~~~~~~~g~~~~p~~~V~vt~Ga~~a   99 (387)
T PRK08912         23 AREHGAINLGQG--FPDD-PGPEDVRRAAADALLDGYNQYPPMMGLPELRQAVAAHYARFHGLDLDPMTEVMVTSGATEA   99 (387)
T ss_pred             HCCCCCEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHH
T ss_conf             637992773697--8999-9889999999999852999898998729999999999999868998988729987668999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             35677766543200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       102 ~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
                      ...+++..-       .+|. .||..+-+|.+.........+.+..-    |..+  .. ..-|.+.+++.+.+++-+++
T Consensus       100 l~~~~~al~-------~pGD-~Vlv~~P~y~~y~~~~~~~G~~~~~v----~~~~--~~-~~~d~~~l~~~~~~~tk~ii  164 (387)
T PRK08912        100 LAAALLALV-------EPGD-EVVLFQPLYDSYLPIIRRAGGVPRLV----RLEP--PH-WRLPEAALAAAFSPRTKAVL  164 (387)
T ss_pred             HHHHHHHHC-------CCCC-EEEEECCCCHHHHHHHHHCCCEEEEC----CCCC--CC-CCCCHHHHHHCCCCCCEEEE
T ss_conf             999999966-------9989-89994880811799999729889975----6558--77-78899999852788866999


Q ss_pred             C-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC--CCCCCCCCE---EECCCCCC-CCCCCC
Q ss_conf             3-3322221124621012322110223457213101100344445553101--112454530---21034444-443443
Q gi|254780432|r  182 I-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY--EWANVKPDI---MTIAKGMG-GGFPIG  254 (392)
Q Consensus       182 ~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~--e~~gi~PDi---~~~gK~l~-gG~P~s  254 (392)
                      + -| +.--|. ..+.+-+++|.++|++||+++|.||+...+--.|.-+-.  ...+...-.   -.+||.++ .|+=+|
T Consensus       165 l~~P-~NPTG~-v~s~e~l~~l~~~a~~~~i~vi~DEiY~~l~~~~~~~~~~~~~~~~~~~~i~i~S~SK~~~m~G~RiG  242 (387)
T PRK08912        165 LNNP-LNPAGK-VFPREDLALLAEFCQRHDAVAICDEVWEHVVFDGRRHIPLMALPGMRERTVKIGSAGKIFSLTGWKVG  242 (387)
T ss_pred             ECCC-CCCCCC-CCCHHHHHHHHHHHHHCCEEEEECCCHHHEEECCCCCCHHHCCCCCCCCEEEECCCCCEECCCCCCEE
T ss_conf             8999-898885-68699999999988657979980265233156786540444066766736998567775205533279


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC----HHHHHCCHHHHHHHHHHHHCCCEEEEECCCE
Q ss_conf             210001112222233223453211110012334554320122210----1121000026889999886797075504640
Q gi|254780432|r  255 ACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE----NVINIAKILFEGLTAIKNRFPNMFLEVRGQG  330 (392)
Q Consensus       255 av~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~----~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G  330 (392)
                      .+++.+++.+.+.......+++.++..-.++.+.|+.  .+++++    ..++.-+.+.+.|+++     ++ .-+...|
T Consensus       243 ~~~~~~~li~~l~~~~~~~~~~~~~~~Q~a~a~~l~~--~~~~~~~~~~~~~~rr~~l~~~L~~~-----g~-~~~~~~G  314 (387)
T PRK08912        243 FVCAAPPLLRVLAKAHQFLTFTTPPNLQRAVAYGLGK--PDDYFEGMRADLARSRDRLAAGLRRI-----GF-PVLPSQG  314 (387)
T ss_pred             EEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHHHHHHHHHHC-----CC-EEECCCC
T ss_conf             9983999999999998758557669999999999738--77999999999999999999999976-----98-5627981


Q ss_pred             -EEEEEEEC-----CCHHHHHHH-HHHCCEEEEECC--------CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             -09998724-----998999999-996898996268--------988995589868899999999999999998
Q gi|254780432|r  331 -LLIGLKTV-----FSPALLAAK-FRDECLLTAPSS--------DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       331 -l~~~ie~~-----~~~~~~~~~-l~~~Gll~~~~~--------~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                       +++-+++.     .+...++.+ +.+.||.+.|..        .+.|||+  +.-++++|++++++|.++++.
T Consensus       315 ~~~~~~~~~~~~~~~~~~~f~~~ll~e~gV~~vPG~~F~~~~~~~~~iRls--fa~~~e~l~ea~~RL~~~lk~  386 (387)
T PRK08912        315 TYFLTVDLAPLGLAEDDVAFCRRLVEEAGVAAIPVSAFYEEDPVTSVVRFC--FAKRDATLDEAVERLAAAFRG  386 (387)
T ss_pred             EEEEEEECCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHC
T ss_conf             589988514558998999999999996899998150128999999859999--799999999999999999836


No 144
>PRK03158 histidinol-phosphate aminotransferase; Provisional
Probab=99.66  E-value=1.7e-14  Score=115.30  Aligned_cols=319  Identities=14%  Similarity=0.183  Sum_probs=202.6

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHH
Q ss_conf             764641022674357878999999999999731450687578189999986520101--333123565554035677766
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTA  109 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aikla  109 (392)
                      ++.||+.++  -+.+|- .|++++|+.++++.+..    |..+...+|.+.|.+..+  .+.+..+|+.+|+...+++..
T Consensus        29 ~~ii~ls~N--enp~g~-~~~v~~a~~~~~~~~~~----YPd~~~~~Lr~~iA~~~gv~~~~I~v~nGs~e~i~~~~~~~  101 (359)
T PRK03158         29 SKIVKLASN--ENPFGC-SPRVTEALASEASQYAL----YPDGYAFELRTKVAKHLGVKEEQLIFGNGSDEVIQIISRAL  101 (359)
T ss_pred             CCEEEEECC--CCCCCC-CHHHHHHHHHHHHHCCC----CCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHHHH
T ss_conf             976895089--999999-99999999987873676----96988899999999986848677998478899999999998


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCCCCCC
Q ss_conf             543200134786002343546565432123455321134799986433322210026887541012332222-3332222
Q gi|254780432|r  110 RRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL-IEPIQGE  188 (392)
Q Consensus       110 r~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi-~Epv~g~  188 (392)
                      -       .+|+. ++....+|-.-...+........ .   -|..+     ...|++.+.+.+.++...++ .-|= .-
T Consensus       102 ~-------~~g~~-vvi~~P~f~~Y~~~a~~~g~~~~-~---vpl~d-----~~~dl~~~~~~i~~~tklv~l~nPn-NP  163 (359)
T PRK03158        102 L-------HEGTN-TVMANPTFSQYRHNAVIEGAEVR-E---VPLKD-----GIHDLDAMLEAIDENTKIVWICNPN-NP  163 (359)
T ss_pred             H-------CCCCE-EECCCCEEEHHHHHHHHCCCEEE-E---ECCCC-----CCCCHHHHHHHCCCCCCEEEECCCC-CC
T ss_conf             0-------79981-11379820555999976285379-9---62677-----7669999997507588789974899-99


Q ss_pred             CCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-CCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             1124621012322110223457213101100344445553101-1124545302---1034444-443443210001112
Q gi|254780432|r  189 GGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-EWANVKPDIM---TIAKGMG-GGFPIGACLATNEVA  263 (392)
Q Consensus       189 ~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~i~  263 (392)
                      .|. ..+.+-++++.+.|.++ +++|+||...-|.....+... ....--|.++   +|+|..+ .|+-+|.+++++++.
T Consensus       164 TG~-~~~~~~l~~l~~~~~~~-~~vvvDEaY~ef~~~~~~~~~~~l~~~~~nviv~rsfSK~~~laGlRlGy~ia~~~li  241 (359)
T PRK03158        164 TGT-YVEKQKLLAFLEKVPKS-VLVVLDEAYYEYVTAEDYPQTLPLLEKYENLMILRTFSKAYGLAALRVGYGIADEELI  241 (359)
T ss_pred             CCC-CCCCHHHHHHHHHCCCC-EEEEEEHHHHHHHCCCCCCCHHHHHHHCCCEEEECCCCHHCCCCCCCCEECCCCHHHH
T ss_conf             888-76523489999748577-2999722788873257862035676532562365156541068888522031899999


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCHHH
Q ss_conf             22223322345321111001233455432012221011210000268899998867970755046400999872499899
Q gi|254780432|r  264 ACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL  343 (392)
Q Consensus       264 ~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~~~  343 (392)
                      +.+....  ..|+-|.++.++|.++|+   ++++++...+.-+.-++.+.++.+++ ++ .-.-..+-++-+++..+...
T Consensus       242 ~~l~~~~--~~~~v~~~aq~aa~aal~---d~~~~~~~~~~~~~~~~~~~~~l~~~-g~-~~~ps~anF~l~~~~~~~~~  314 (359)
T PRK03158        242 GQLEPAR--LPFNTSTIAQAAALAALE---DQAFIQECVKKNAEGLKQYYAFCKEY-GV-FYYPSQTNFVLIDLGIPGDE  314 (359)
T ss_pred             HHHHHHC--CCCCCHHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCCEEEEECCCCHHH
T ss_conf             9999853--886856999999999957---99999999999999999999999868-88-89999850899868999999


Q ss_pred             HHHHHHHCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             9999996898996268----9889955898688999999999999999
Q gi|254780432|r  344 LAAKFRDECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       344 ~~~~l~~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      +.+.|+++|+++++..    ++.+|++   +=|.+|.++++++|++.|
T Consensus       315 ~~~~L~~~gi~Vr~g~~fg~~~~iRIs---vgt~~en~~ll~aL~~il  359 (359)
T PRK03158        315 VFEYLLKKGYIVRSGAALGFPTGIRIT---VGLKEENDEIIELLAELL  359 (359)
T ss_pred             HHHHHHHCCEEEEECCCCCCCCEEEEE---ECCHHHHHHHHHHHHHHC
T ss_conf             999998199399968989998989999---489999999999999869


No 145
>PRK09295 selenocysteine lyase; Validated
Probab=99.66  E-value=8e-14  Score=110.85  Aligned_cols=331  Identities=14%  Similarity=0.139  Sum_probs=191.4

Q ss_pred             CCCE--EEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCCCCCCCHH------HHHHH-HHHHHHCC---CCCCCCCC
Q ss_conf             9976--4641022674357878999999999999731-45068757818------99999-86520101---33312356
Q gi|254780432|r   30 NGIP--FLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVSNLYQSTQ------QEIFA-NHLIHSTF---ADRVFFTN   96 (392)
Q Consensus        30 dG~~--yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~~~~~~~~------~~~la-~~L~~~~~---~~~v~f~~   96 (392)
                      +|+.  |+|-.++      ....++|++|+.+.+... ...+. ..+..      ..+-+ +++.+..+   .+.+.|+.
T Consensus        20 ~~~~~iYlDnaAt------t~~p~~Vi~a~~~~~~~~~~n~~~-~~~~~~~~a~~~~e~aR~~iA~~lga~~~~eIvFts   92 (406)
T PRK09295         20 NGLPLAYLDSAAS------AQKPSQVIDAEAEFYRHGYAAVHR-GIHTLSAQATEKMENVRKQASLFINARSAEELVFVR   92 (406)
T ss_pred             CCCCEEEECCCCC------CCCCHHHHHHHHHHHHHCCCCCCC-CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEC
T ss_conf             8997599528853------789999999999999865698886-413899999999999999999974999989699937


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             5554035677766543200134786002343546565432123-455321134799986433322210026887541012
Q gi|254780432|r   97 SGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI-SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN  175 (392)
Q Consensus        97 SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~-s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~  175 (392)
                      ++||++-.+++.   +....-++|.. ||.-+--+|. .+..+ .+.    .+.++.-..-.+.....-|++.+++.+.+
T Consensus        93 ~~Tea~N~~~~~---~~~~~~~~gd~-vi~s~~EH~s-~~~pw~~l~----~~~G~~v~~vp~~~~g~id~~~l~~~i~~  163 (406)
T PRK09295         93 GTTEGINLVANS---WGNSNVRAGDN-IIISEMEHHA-NIVPWQMLC----ARVGAELRVIPLNPDGTLQLETLPALFDE  163 (406)
T ss_pred             CCHHHHHHHHHH---HHHHHCCCCCE-EEEECCCCHH-HHHHHHHHH----HHHCCEEEEEECCCCCCCCHHHHHHHHCC
T ss_conf             816998888866---68860589898-9994664287-888999999----96496248980389984859999987537


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCCCC
Q ss_conf             332222333222211246210123221102234572131011003444455531011124545302103--444444344
Q gi|254780432|r  176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA--KGMGGGFPI  253 (392)
Q Consensus       176 ~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g--K~l~gG~P~  253 (392)
                      ++..|.+--+..+.|.+.|    ++.+.++|+++|+++++|=+|+ +|..    -.+--.+..|+++++  | |.|-.-+
T Consensus       164 ~T~LVsv~~vsn~~G~i~p----v~~I~~~~~~~g~~~~vDaaQ~-~g~~----~idv~~l~~D~~~~S~HK-l~GP~G~  233 (406)
T PRK09295        164 RTRLLAITHVSNVLGTENP----LAEMIALAHQHGAKVLVDGAQA-VMHH----PVDVQALDCDFYVFSGHK-LYGPTGI  233 (406)
T ss_pred             CCEEEEEEECCCCCCCCCC----HHHHHHHHHHCCCEEEEECCCC-CCCC----CCCHHHHHCCEEEEEHHH-CCCCCCE
T ss_conf             9639999713678887178----9999998875585489642346-6810----554666315479986142-2699814


Q ss_pred             CCCCCCCCCCCCCCCCCCC------------CCC--------CC--CCCCHHHHHHHHHHHHC---CCCCCHHHHHCCHH
Q ss_conf             3210001112222233223------------453--------21--11100123345543201---22210112100002
Q gi|254780432|r  254 GACLATNEVAACMNQGSHG------------STY--------GG--NVLAMVLGEKVLNIIQS---DGFLENVINIAKIL  308 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~------------~T~--------~g--npl~~aaa~a~L~~l~~---~~l~~~~~~~g~~l  308 (392)
                      |++.+++++.+.+.|...|            .++        .|  |..+.++..++++++.+   +++.++.+.+.+++
T Consensus       234 G~Lyv~~~~~~~l~P~~~GG~~~~~~~~~~~~~~~~~p~rfe~GT~n~~~i~gl~aAl~~~~~~g~~~i~~~~~~L~~~l  313 (406)
T PRK09295        234 GILYVKEALLQEMPPWEGGGSMIATVSLTEGTTWAKAPWRFEAGTPNTGGIIGLGAALDYVSALGLNNIAEYEQNLMHYA  313 (406)
T ss_pred             EEEEECHHHHHHCCCCCCCCCCEEEECCCCCCCCCCCCHHCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHH
T ss_conf             99998334563178631688631100345675535652220588876889999999999999718899999999999999


Q ss_pred             HHHHHHHHHHCCCEEE-EECCCEEEEEEEECC-CHHHHHHHHHHCCEEEEEC------------CCCEEEECCCCCCCHH
Q ss_conf             6889999886797075-504640099987249-9899999999689899626------------8988995589868899
Q gi|254780432|r  309 FEGLTAIKNRFPNMFL-EVRGQGLLIGLKTVF-SPALLAAKFRDECLLTAPS------------SDNVVRILPPLTITAE  374 (392)
Q Consensus       309 ~~~L~~l~~~~~~~v~-~vRG~Gl~~~ie~~~-~~~~~~~~l~~~Gll~~~~------------~~~~irl~Ppl~it~~  374 (392)
                      .++|++    .|++.. ....+....++.+.. .+..+...|-+.|+.++..            -+..||+++...-|++
T Consensus       314 ~~~L~~----~~~v~~~gp~~r~~ivsf~~~~~~~~~v~~~L~~~gI~vr~G~~Ca~~~~~~~~~~~~iRvS~~~ynT~e  389 (406)
T PRK09295        314 LSQLEQ----VPDLTLYGPQNRLGVIAFNLGKHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLAMYNTHE  389 (406)
T ss_pred             HHHHHC----CCCEEEECCCCCCEEEEEECCCCCHHHHHHHHHHCCEEEECCHHHHHHHHHHHCCCCEEEEECCCCCCHH
T ss_conf             999736----9998995887755079997389899999999854998997634333044576289967999788999999


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999985
Q gi|254780432|r  375 EIHEGLERIERTAIKL  390 (392)
Q Consensus       375 eid~~i~~l~~al~~L  390 (392)
                      |||++++.|++..+-|
T Consensus       390 eId~lv~aL~~I~k~l  405 (406)
T PRK09295        390 EVDRLVAGLQRIHRLL  405 (406)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999972


No 146
>PRK08960 hypothetical protein; Provisional
Probab=99.66  E-value=2.6e-14  Score=114.02  Aligned_cols=331  Identities=15%  Similarity=0.137  Sum_probs=194.1

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCC-CCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731-4506-87578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVS-NLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~-~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|-  -.+ --++.|++|+++.++.. .+++ .....+.+..+++.+.+..+    .|.+..++++++|.
T Consensus        29 ~~G~~vi~l~~G~--pdf-~~p~~i~~a~~~a~~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~~~~d~I~vt~G~~~al  105 (387)
T PRK08960         29 AAGHDVIHLEIGE--PDF-TTAAPIVAAGQAALAAGHTRYTAARGLPALREAIAGFYAQRYGLDVDPERILVTPGGSGAL  105 (387)
T ss_pred             HCCCCEEECCCCC--CCC-CCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHHH
T ss_conf             7799807889948--999-8899999999999853899889987729999999999999858999843289808669999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCC-CCC
Q ss_conf             5677766543200134786002343546565432123455321134799986433322210026887541012332-222
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTA-AIL  181 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iA-avi  181 (392)
                      ..+++.--       .+| +.||..+-+|-+.........+.....    |..+.  .-...|.+.+++.+..+.- .++
T Consensus       106 ~~~~~~l~-------~pG-D~Vlv~~P~Yp~~~~~~~~~~~~~~~v----p~~~~--~~~~~~~~~le~~~~~~~~~iil  171 (387)
T PRK08960        106 LLASSLLV-------DPG-KHWLLADPGYPCNRHFLRLVEGAAQLV----PVGPD--TRYQLTPALVERHWDSDSVGALV  171 (387)
T ss_pred             HHHHHHHC-------CCC-CEEEEECCCCCCHHHHHHHHCCEEEEE----ECCCC--CCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999956-------999-879981787655289999853744999----75754--47788999999727878729997


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCE---EECCCCCC-CCCCCCCCC
Q ss_conf             33322221124621012322110223457213101100344445553101112454530---21034444-443443210
Q gi|254780432|r  182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI---MTIAKGMG-GGFPIGACL  257 (392)
Q Consensus       182 ~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi---~~~gK~l~-gG~P~sav~  257 (392)
                      .-| +.-.|. ..+++.+++|.++|++||+++|.|||...+--.+....  .....+..   -.+||.++ .|+=+|.++
T Consensus       172 ~nP-~NPTG~-v~s~~~l~~l~~~a~~~~~~vI~DEiY~~l~~~~~~~s--~~~~~~~~i~i~S~SK~~~~~G~RiG~~v  247 (387)
T PRK08960        172 ASP-ANPTGT-LLSRDELAALSQALKARGGHLVVDEIYHGLTYGVDAAS--VLEVDDSAFVLNSFSKYFGMTGWRLGWLV  247 (387)
T ss_pred             CCC-CCCCCC-CCCHHHHHHHHHHHHHCCCEEEEECCCHHHCCCCCCCC--CCCCCCCEEEEEECCCCCCCCCCEEEEEE
T ss_conf             689-898863-14689999999987623977998446144125898653--11367877999506432557763058999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECCCEEE-
Q ss_conf             0011122222332234532111100123345543201222101----12100002688999988679707550464009-
Q gi|254780432|r  258 ATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRGQGLL-  332 (392)
Q Consensus       258 ~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~-  332 (392)
                      +.++++..+.......+...+.+.-.++.+.++. +..++++.    .+++-+.+.+.|++    .+ ....++..|.| 
T Consensus       248 ~p~~~i~~~~~~~~~~~~~~~~~~Q~aa~~al~~-~~~~~~~~~~~~~~~rrd~l~~~l~~----~~-~~~~~~P~G~~y  321 (387)
T PRK08960        248 APPAAVPELEKLAQNLYISASSMAQHAALACFEP-ETIAILEARRAEFQRRRDFLLPALRE----LG-FGIAVEPQGAFY  321 (387)
T ss_pred             ECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH-CCHHHHHHHHHHHHHHHHHHHHHHHH----CC-CCCCCCCCEEEE
T ss_conf             8899999999999854377987999999999621-55999999999999999999999997----59-960458986669


Q ss_pred             EEEEEC---CCHHHHHHHHH-HCCEEEEEC---C----CCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             998724---99899999999-689899626---8----98899558986889999999999999999
Q gi|254780432|r  333 IGLKTV---FSPALLAAKFR-DECLLTAPS---S----DNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       333 ~~ie~~---~~~~~~~~~l~-~~Gll~~~~---~----~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      +=+++.   .+...++..++ +.||.+.|.   +    ++.+||+  +.-++++|++++++|.++|+
T Consensus       322 ~w~~~~~~~~d~~~~~~~ll~~~gV~v~PG~~Fg~~~~~~~~Rls--~~~~~~~l~eal~RL~~~Lk  386 (387)
T PRK08960        322 LYADISAFGGDAFAFCRHFLETEHVAFTPGLDFGRHQAGHHVRFA--YTQSLPRLQEAVERIARGLR  386 (387)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHC
T ss_conf             978888889999999999998699999747220899999989999--76999999999999999966


No 147
>PRK07310 consensus
Probab=99.66  E-value=2.9e-14  Score=113.69  Aligned_cols=334  Identities=13%  Similarity=0.123  Sum_probs=195.2

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC--CCC-CCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314--506-87578189999986520101----3331235655540
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW--HVS-NLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAES  101 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~--~~~-~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA  101 (392)
                      .+|++.|++.-|-  -.+ -..|.|++|++++++...  +++ .....+.+..+++.+.+..+    .|.++.++++++|
T Consensus        27 ~~G~dvi~L~iG~--pdf-~~p~~i~~a~~~a~~~~~~~~Y~~~~G~~~lR~Aia~~~~~~~g~~v~pd~I~vt~G~~~a  103 (395)
T PRK07310         27 AQGRDILSLTLGE--PDF-VTPKNIQDAAIESIENGRASFYTVASGLPELKAAIATYFENFYGYHLSPNQIVVGTGAKFI  103 (395)
T ss_pred             HCCCCEEECCCCC--CCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHH
T ss_conf             7799737768958--999-9899999999999828988878997473999999999989987899883209987788999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             35677766543200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       102 ~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
                      ...+++.--       .+| +.|+..+-+|...........+.+...    |..+  ..--..|++.+++.+.+++-++|
T Consensus       104 l~~~~~~l~-------~pG-D~Vlv~~P~Y~~y~~~~~~~g~~~v~~----~~~~--~~~~~~d~~~l~~~~~~~~k~ii  169 (395)
T PRK07310        104 LYAFFMAVL-------NPG-DEVIIPTPYWVSYSDQVKMAEGVPVFV----QAKE--ENHFKVTVEQLEAARTSKTKVVL  169 (395)
T ss_pred             HHHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEEE----ECCC--CCCCCCCHHHHHHHCCCCCEEEE
T ss_conf             999999974-------999-989983787754699999759989997----5674--45745049999974658974999


Q ss_pred             C-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCC-CCCC--CCCC-C--EEECCCCCC-CCCCC
Q ss_conf             3-332222112462101232211022345721310110034444555310-1112--4545-3--021034444-44344
Q gi|254780432|r  182 I-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA-YEWA--NVKP-D--IMTIAKGMG-GGFPI  253 (392)
Q Consensus       182 ~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~-~e~~--gi~P-D--i~~~gK~l~-gG~P~  253 (392)
                      + -| +.-.|. ..+++.+++|.++|++||+++|.|||...+--.|.-+- ...+  ++.. -  +..+||..+ .|+=+
T Consensus       170 l~~P-~NPTG~-v~s~~~l~~l~~~a~~~~i~visDEiY~~l~~~g~~~~p~~~~~~~~~~~~i~~~s~SK~f~~~G~Ri  247 (395)
T PRK07310        170 LNSP-SNPTGM-IYSAEELRAIGEWAVEHDILILADDIYGRLVYNGNQFTPISSLSEAIRKQTIVINGVSKTYAMTGWRV  247 (395)
T ss_pred             ECCC-CCCCCC-CCCCCHHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCEE
T ss_conf             8999-798562-66354146776556526879994365210014898888888841243257358840123567766548


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHH---HCCCEEEEECCCE
Q ss_conf             3210001112222233223453211110012334554320122210112100002688999988---6797075504640
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKN---RFPNMFLEVRGQG  330 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~---~~~~~v~~vRG~G  330 (392)
                      |.+++.+++.+.+.......+...+.++-.++.+.++-  .++.++   ++-+.+.++++.+.+   +.|+ +.-++-.|
T Consensus       248 G~~v~~~~~i~~~~~~~~~~~~~~~~~~q~aa~~al~~--~~~~~~---~~~~~~~~r~~~~~~~l~~~~g-~~~~~P~g  321 (395)
T PRK07310        248 GFAVGEPEIISAMSKIAGQTTSNLTAVSQYAAIEAFTG--SQSSVE---EMRLAFEERLNIIYPLLAQVPG-FEVVKPQG  321 (395)
T ss_pred             EEEECCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC--CHHHHH---HHHHHHHHHHHHHHHHHHCCCC-CEEECCCE
T ss_conf             99977999999999998650478138999999999968--889999---9999999999999998730899-68726986


Q ss_pred             EEEE-EEEC--------CCHHHHHHHHH-HCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             0999-8724--------99899999999-6898996268----988995589868899999999999999998
Q gi|254780432|r  331 LLIG-LKTV--------FSPALLAAKFR-DECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       331 l~~~-ie~~--------~~~~~~~~~l~-~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      -++. .++.        .+...++.++. +.||.+.|..    ++.+||.  +..++++|++++++|++.+..
T Consensus       322 ~~~~w~~~~~~~~~~g~~d~~~~~~~ll~~~gV~v~PG~~FG~~~~vRl~--~a~~~~~l~eal~RL~~~l~s  392 (395)
T PRK07310        322 AFYLFPNVKKAMEMKGYTDVTDFTTAILEEVGVALVTGAGFGAPENVRLS--YATDLETLKEAVRRLHVFMES  392 (395)
T ss_pred             EEEEEEECCCHHCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCCEEEE--ECCCHHHHHHHHHHHHHHHHH
T ss_conf             68981666511124788989999999998499999889766999988999--809999999999999999987


No 148
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase. This clade of the pfam00155 superfamily of aminotransferases includes several which are adjacent to elements of the lysine biosynthesis via diaminopimelate pathway (GenProp0125). Every member of this clade is from a genome which possesses most of the lysine biosynthesis pathway but lacks any of the known aminotransferases, succinylases, desuccinylases, acetylases or deacetylases typical of the acylated versions of this pathway nor do they have the direct, NADPH-dependent enzyme (ddh). Although there is no experimental characterization of any of the sequences in this clade, a direct pathway is known in plants and Chlamydia, so it seems quite reasonable that these enzymes catalyze the same transformation.
Probab=99.66  E-value=1.7e-14  Score=115.18  Aligned_cols=329  Identities=16%  Similarity=0.198  Sum_probs=190.6

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC---CCCCCCCCHHHHHHHHHHHHHCC----CCC-CCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314---50687578189999986520101----333-123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW---HVSNLYQSTQQEIFANHLIHSTF----ADR-VFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~---~~~~~~~~~~~~~la~~L~~~~~----~~~-v~f~~SGse  100 (392)
                      .+|++.|++.-|  -..+. .+|.|++|++++++...   +.......+.+..+++.+.+..+    .+. ++.+++.++
T Consensus        26 ~~G~dvi~l~ig--~pdf~-~p~~i~~a~~~a~~~~~~~~Y~~~~G~~~lreaia~~~~~~~g~~~~p~~~vi~t~Ga~~  102 (383)
T TIGR03540        26 AEGVDVISLGIG--DPDLP-TPKHIVEALCKAAENPENHRYPSYEGMLAYRQAVADWYKRRFGVELDPETEVLSLIGSKE  102 (383)
T ss_pred             HCCCCEEECCCC--CCCCC-CCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCHH
T ss_conf             569985888899--89999-899999999999828887654998784999999999999986898996766998478259


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |...+++.--       .+| ..|+..+-+|..-...+.........    -|..+.  .-...|++.+++.+.+++.++
T Consensus       103 al~~~~~~l~-------~pG-D~Vli~~P~Y~~y~~~~~~~g~~~v~----vpl~~~--~~~~~d~e~l~~~~~~~~k~i  168 (383)
T TIGR03540       103 GIAHIPLAFV-------NPG-DIVLVPDPGYPVYRIGTLFAGGEPYE----MPLKEE--NGFLPDFDAIPEDIAKKAKLM  168 (383)
T ss_pred             HHHHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEE----EECCCC--CCCCCCHHHHHHHCCCCCEEE
T ss_conf             9999999966-------898-98998789860169999971985899----613357--798579999987452377499


Q ss_pred             CC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CCCCCCCCCC----EEECCCCCC-CCCCC
Q ss_conf             23-33222211246210123221102234572131011003444455531-0111245453----021034444-44344
Q gi|254780432|r  181 LI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AYEWANVKPD----IMTIAKGMG-GGFPI  253 (392)
Q Consensus       181 i~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~e~~gi~PD----i~~~gK~l~-gG~P~  253 (392)
                      ++ -| +.-.|. ..+++-+++|.++|++||+++|.||+..-+---|... .+-..+-..|    +..+||.++ .|+=+
T Consensus       169 il~~P-~NPTG~-v~s~~~l~~i~~la~~~~i~iIsDEiY~~l~~~~~~~~s~~~~~~~~~~~i~~~S~SK~~~~~G~Ri  246 (383)
T TIGR03540       169 FINYP-NNPTGA-VAPLKFFKELVEFAKEYNIIVCHDNAYSEITFDGYKAPSFLEVDGAKDVGIEFHSLSKTYNMTGWRI  246 (383)
T ss_pred             EECCC-CCCCCC-CCCCHHHHCCCCCCCCCCCEEECCHHHHHHCCCCCCCCCCEECCCCCCEEEEEEECCCCCCCCCCEE
T ss_conf             98999-897070-1210222201001245540576110255530389999771113665542577630235447887348


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             32100011122222332234532111100123345543201222101----12100002688999988679707550464
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRGQ  329 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG~  329 (392)
                      |.+++.+++++.+.......+.+.+...-.++.+.++.-  ++++++    .++.-+.+.+.|+++     ++ .-.+..
T Consensus       247 G~~i~~~~l~~~~~~~~~~~~~~~~~~~q~a~~~al~~~--~~~~~~~~~~~~~~r~~~~~~L~~~-----g~-~~~~p~  318 (383)
T TIGR03540       247 GMAVGNADLIAGLGKVKTNVDSGVFQAIQYAAIAALNGP--QDVVKEIRKIYQRRRDLLLEALKKI-----GI-DVEKPK  318 (383)
T ss_pred             EEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCH--HHHHHHHHHHHHHHHHHHHHHHHHC-----CC-EEECCC
T ss_conf             962289999999999975513567659999999998591--9999999999999999999999876-----98-773578


Q ss_pred             E-EEEEEEECC--CHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             0-099987249--9899999999-689899626------8988995589868899999999999999
Q gi|254780432|r  330 G-LLIGLKTVF--SPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       330 G-l~~~ie~~~--~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~a  386 (392)
                      | ++.=+++..  +...++..++ +.||.+.|.      +++.+||.  +..++++|++++++|++.
T Consensus       319 g~~~~w~~~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~g~~~iRl~--~~~~~e~l~eal~RL~kl  383 (383)
T TIGR03540       319 ATFYVWVPVPEGYTSAEFAARLLEETGVVVTPGVGFGEYGEGYIRIS--LTVPDERLEEAVARIKKL  383 (383)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHCC
T ss_conf             05799898999989899999999839999988853288998869999--869999999999998449


No 149
>PRK08068 transaminase; Reviewed
Probab=99.65  E-value=1.6e-14  Score=115.46  Aligned_cols=328  Identities=12%  Similarity=0.149  Sum_probs=192.1

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC---CCCCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCC
Q ss_conf             7997646410226743578789999999999997314---50687578189999986520101----33-3123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW---HVSNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~---~~~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGse  100 (392)
                      .+|++.|++.-|  --.+ -.++.|++|+++.++...   |.......+.+..+++.+.+..+    .+ .+..++++++
T Consensus        29 ~~G~~vi~l~~G--~Pd~-~~p~~i~~a~~~~~~~~~~~~Y~~~~G~~~LR~aia~~~~~~~g~~~~p~~eI~vt~Ga~~  105 (389)
T PRK08068         29 AEGHDVINLGQG--NPDQ-PTPEHIVEALQEAAENPANHKYSPFRGYPFLKEAAADFYKREYGVTLDPETEVAILFGGKA  105 (389)
T ss_pred             HCCCCCEECCCC--CCCC-CCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHH
T ss_conf             679991899998--8999-9899999999999738767888998580999999999999986899898880998278899


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |...+++.--       .+| ..|+..+-+|.+..........+...    -|..+  ..-...|++.+++.+.+++-++
T Consensus       106 al~~~~~al~-------~pG-D~Vlv~~P~Yp~y~~~~~~~g~~~~~----vpl~~--~~~~~~d~e~l~~~i~~~tk~i  171 (389)
T PRK08068        106 GLVELPQCLL-------NPG-DTALVPDPGYPDYLSGVALARAQFET----MPLIA--ENNFLPDYEKIPESVAEKAKLM  171 (389)
T ss_pred             HHHHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEE----EECCC--CCCCCCCHHHHHHHCHHCCEEE
T ss_conf             9999999966-------999-98998078898649999971875689----96366--6798689999987431046599


Q ss_pred             CC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCC-CCCCCCCCCCC----EEECCCCCC-CCCCC
Q ss_conf             23-3322221124621012322110223457213101100344445553-10111245453----021034444-44344
Q gi|254780432|r  181 LI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL-FAYEWANVKPD----IMTIAKGMG-GGFPI  253 (392)
Q Consensus       181 i~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~-f~~e~~gi~PD----i~~~gK~l~-gG~P~  253 (392)
                      ++ -| ..-.|. ..+.+.+++|.++|++||+++|.|||...+.-.|.. ..+-...-..|    +-.+||.++ .|+=+
T Consensus       172 il~~P-~NPTG~-v~~~~~l~~l~~la~~~~i~visDEiY~~l~~~~~~p~s~l~~~~~~~~~I~~~S~SK~~~~~G~Ri  249 (389)
T PRK08068        172 YLNYP-NNPTGA-VATKAFFEETVAFAKKHNIGVVHDFAYGAIGFDGQKPVSFLQTPGAKDVGIEIYTLSKTFNMAGWRV  249 (389)
T ss_pred             EECCC-CCCCCH-HCCHHHHHHHHHHHHCCCEEEEECCCCCCEEECCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCEE
T ss_conf             98899-798461-2059999999998710777999626521114678766411036532013406610356557863117


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCC-CCCCHHHHHHHHHHHHCCCCCCHH----HHHCCHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             321000111222223322345321-111001233455432012221011----210000268899998867970755046
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGG-NVLAMVLGEKVLNIIQSDGFLENV----INIAKILFEGLTAIKNRFPNMFLEVRG  328 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~g-npl~~aaa~a~L~~l~~~~l~~~~----~~~g~~l~~~L~~l~~~~~~~v~~vRG  328 (392)
                      |.+++++++.+.+.... .+++.+ ++..-.++.+.|.-  .++.+++.    +++-+.+.+.|+++     ++ .-...
T Consensus       250 G~~v~~~~~i~~l~~~~-~~~~~~~~~~~q~aa~~al~~--~~~~~~~~~~~~~~rr~~~~~~l~~~-----g~-~~~~P  320 (389)
T PRK08068        250 AFAVGNESVIEAINLLQ-DHLFVSLFGAIQDAAIEALLS--DQSCVQELVARYESRRNAFISACREI-----GW-EVDAP  320 (389)
T ss_pred             EEEECCHHHHHHHHHHC-CCCEECCCHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHHHHHHHHHHC-----CC-EECCC
T ss_conf             99977999999999730-253004784999999999868--88899999999999999999999975-----97-60588


Q ss_pred             CEEEEE-EEEC--CCHHHHHHHHHHC-CEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             400999-8724--9989999999968-9899626------8988995589868899999999999999
Q gi|254780432|r  329 QGLLIG-LKTV--FSPALLAAKFRDE-CLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERT  386 (392)
Q Consensus       329 ~Gl~~~-ie~~--~~~~~~~~~l~~~-Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~a  386 (392)
                      .|.|+. +++.  .+...++..+.++ ||.+.|.      +++.+|++  +..++++|++++++|.+.
T Consensus       321 ~G~~y~w~~~~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~g~~~vRl~--fa~~~e~l~ea~~RL~~l  386 (389)
T PRK08068        321 KGSFFAWMPVPKGYTSEQFADLLLEKAHVAVAPGNGFGEHGEGYVRVG--LLIDEERLREAINRIAKL  386 (389)
T ss_pred             CEEEEEEEECCCCCCHHHHHHHHHHCCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHHC
T ss_conf             813599786899989899999999709999987854378996969999--838999999999999724


No 150
>PRK00950 histidinol-phosphate aminotransferase; Validated
Probab=99.65  E-value=2.6e-14  Score=114.05  Aligned_cols=324  Identities=18%  Similarity=0.236  Sum_probs=194.7

Q ss_pred             EECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCC-CCCCCCHH
Q ss_conf             96799764641022674357878999999999999731450687578189999986520101--3331235-65554035
Q gi|254780432|r   27 FSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFT-NSGAESVE  103 (392)
Q Consensus        27 ~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~-~SGseA~e  103 (392)
                      +-.+++++||+.++  -+.+|-. |.+++|+.++++.+    +.|..+...+|.+.+.+..+  .+++..+ |+.+|+..
T Consensus        30 ~g~~~~~ii~ls~n--enp~gp~-p~v~~a~~~~~~~~----~~YPd~~~~~Lr~aiA~~~gv~~e~ii~~gnGs~e~i~  102 (369)
T PRK00950         30 YGIDPESIIKLGSN--ENPLGPS-PKAVEALIDEAPNI----HQYPEPDAPELREAISKYTGVPVENIIVGGDGADEIID  102 (369)
T ss_pred             CCCCCCCEEEECCC--CCCCCCC-HHHHHHHHHHHHCC----CCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCHHHHHH
T ss_conf             09896898881298--9986788-99999999875325----87999888999999999868197587997564999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-C
Q ss_conf             677766543200134786002343546565432123455321134799986433322210026887541012332222-3
Q gi|254780432|r  104 CAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL-I  182 (392)
Q Consensus       104 ~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi-~  182 (392)
                      ..++.--       .+|. .|+..+.+|......+.....+..+ -   +..+  ..-.-.|++++.+.+.+++.+++ .
T Consensus       103 ~l~~~~~-------~~Gd-~vl~~~P~y~~Y~~~a~~~G~~~~~-v---~~~~--~~~f~~d~~~l~~~i~~~tklv~l~  168 (369)
T PRK00950        103 VLMRILI-------DEGD-EVIIPIPTFTYYEISARACGAKPVY-A---KFDR--EEDFKLDVESVLNAITDKTKIIFLC  168 (369)
T ss_pred             HHHHHHH-------CCCC-EEEECCCCCHHHHHHHHHCCCEEEE-C---CCCC--CCCCCCCHHHHHHHCCCCCEEEEEE
T ss_conf             9999995-------7999-9998988730369999983982022-3---6771--2499889999997367676089980


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCCC
Q ss_conf             33222211246210123221102234572131011003444455531011124545302---1034444-4434432100
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GGFPIGACLA  258 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~  258 (392)
                      -|=.= .|.. .+.+   .|+++|+++++++|+||+..-|..  .-+. +...--+.++   +|||..+ .|+=+|.+++
T Consensus       169 nPnNP-TG~~-~~~~---el~~l~~~~~~~vv~DEaY~ef~~--~~~~-~l~~~~~n~iv~~SfSK~~~laGlRlGy~i~  240 (369)
T PRK00950        169 TPNNP-TGNL-IPEE---DIRKIVESTDALVFVDEAYIEFAE--YDLT-ELALEYDNVLVLRTFSKVFGLAGMRIGYGIM  240 (369)
T ss_pred             CCCCC-CCEE-ECHH---HHHHHHHCCCEEEEECCCHHHHCC--CCHH-HHHHHCCCEEEEEECCHHHHCCCCEEEEEEC
T ss_conf             89998-7832-4799---987898718879994242675257--9715-6787458658984121554057750467646


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEEC
Q ss_conf             01112222233223453211110012334554320122210112100002688999988679707550464009998724
Q gi|254780432|r  259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV  338 (392)
Q Consensus       259 ~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~  338 (392)
                      .+++.+.+....  ..|+-|.++.++|.++|+   +.+.+++..+.-+.-++.|.+-..+.+.+-. .-..+.++-+++.
T Consensus       241 ~~~li~~l~~~~--~~~~v~~~aq~aa~aaL~---~~~~~~~~~~~~~~~R~~l~~~L~~l~~~~v-~ps~anFil~~~~  314 (369)
T PRK00950        241 PKWIIEYMMRIK--PPFSLTRLSQAAAIAALR---DKEFIEKSIELGIESREYLYEGLKKFKPLKV-YPSEANYVLVDVK  314 (369)
T ss_pred             CHHHHHHHHHHC--CCCCHHHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHCCCCEE-CCCCCEEEEEECC
T ss_conf             999999999856--875706999999999950---9588999999999999999999985799778-7898618999899


Q ss_pred             C--CHHHHHHHHHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9--9899999999689899626------898899558986889999999999999999
Q gi|254780432|r  339 F--SPALLAAKFRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       339 ~--~~~~~~~~l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      .  +...+++.|.++|+++++.      +++.+|++   +-|.+|.++++++|++.++
T Consensus       315 ~~~~~~~~~~~Ll~~gI~Vr~g~~f~~~~~~~iRis---igt~~en~~ll~al~~il~  369 (369)
T PRK00950        315 PGMTAKEFTEELLKKGVIVRDCTSFEGLGDYYIRVS---IGTLEENERFLEILKEIVE  369 (369)
T ss_pred             CCCCHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE---ECCHHHHHHHHHHHHHHHC
T ss_conf             999999999999969959996877777898989998---0899999999999999859


No 151
>PRK06207 aspartate aminotransferase; Provisional
Probab=99.65  E-value=4.7e-14  Score=112.33  Aligned_cols=341  Identities=15%  Similarity=0.199  Sum_probs=194.6

Q ss_pred             CCCEE----EECHHHHHHHCCCCCCHHHHHHHHHHHHHCCC---CCCCCCCHHHHHHHHHHHHHC-----CCCCCCCCCC
Q ss_conf             99764----64102267435787899999999999973145---068757818999998652010-----1333123565
Q gi|254780432|r   30 NGIPF----LDFASGIAVNSLGHSHPELVAILKSQSEKLWH---VSNLYQSTQQEIFANHLIHST-----FADRVFFTNS   97 (392)
Q Consensus        30 dG~~y----iD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~---~~~~~~~~~~~~la~~L~~~~-----~~~~v~f~~S   97 (392)
                      .|+..    |||.-|  ..-+-.=.|+.++++.+++.+-.+   +......+.+.+.|+++.+..     +.|.+..+++
T Consensus        33 ~g~~~~~~~id~~~G--~pD~~~PtP~~i~~~~~~~~~~g~~~Yt~~~G~~eLReAia~~~~~~~g~~~d~~d~Iivt~G  110 (406)
T PRK06207         33 RGDPLPGRPVDFSHG--DVDAHEPTPGSLELFSQGVERGGVQAYTEYRGDLEIRELVAARLAEFTGAPVDARDGLIITPG  110 (406)
T ss_pred             CCCCCCCCCCCCCCC--CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCC
T ss_conf             589889997237889--999999986999999999973899889998672999999999999986899998786998587


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCHHHHHHHHHCCCC
Q ss_conf             5540356777665432001347860023435465654321234553211347999864333222-100268875410123
Q gi|254780432|r   98 GAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQA-KFCDLQSLKNQISND  176 (392)
Q Consensus        98 GseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~-~~~d~~~l~~~~~~~  176 (392)
                      +.+|.-.++...-       .+| +.||..+-+|-+.....-...+..... ..  ........ ...|++.+++.+.++
T Consensus       111 ~~~al~~a~~al~-------~pG-DeViv~~P~y~~y~~~i~~~g~~~vpv-~l--~~~~~~~~~~~~d~d~le~~i~~~  179 (406)
T PRK06207        111 TQGALFLAVASTV-------TRG-DKVAIVQPDYFANRKLVEFFEGEIVPV-QL--DYVSVDETRAGLDLDQLEAAFKAG  179 (406)
T ss_pred             HHHHHHHHHHHHC-------CCC-CEEEEECCCCCCHHHHHHHCCCEEEEE-EC--CCCCCCCCCCCCCHHHHHHHCCCC
T ss_conf             7999999999975-------899-879997898745799999829879998-56--776776344689999999745448


Q ss_pred             CCCCCC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-CCCCCCCC----EEECCCCCC-C
Q ss_conf             322223-3322221124621012322110223457213101100344445553101-11245453----021034444-4
Q gi|254780432|r  177 TAAILI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-EWANVKPD----IMTIAKGMG-G  249 (392)
Q Consensus       177 iAavi~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~~gi~PD----i~~~gK~l~-g  249 (392)
                      +-++|+ -| ..-.|. ..+++.+++|.++|++||+++|.|||...+--.|+-+.+ ......+|    +..+||..+ .
T Consensus       180 tk~iil~nP-~NPTG~-v~s~e~l~~l~~la~~~~i~visDEiY~~l~ydg~~~~~~~~~~~~~~~~I~~~s~SK~~~m~  257 (406)
T PRK06207        180 VRVFLFSNP-NNPAGV-VYSPEEIAQIAALARRYGATVIADQLYSRLRYAGASYTHLRALAVDPENVITIMGPSKTESLS  257 (406)
T ss_pred             CEEEEECCC-CCCCCH-HCCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCHHHCCCCCCCEEEEEECHHHHHCC
T ss_conf             769998899-798572-133999999999875579599996466454558988778766357767679975132443122


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             43443210001112222233223453211110012334554320122210112100002688999988679707550464
Q gi|254780432|r  250 GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQ  329 (392)
Q Consensus       250 G~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~  329 (392)
                      |+-+|.+++.+++++.+.......++..+.+.-+++.+.++.-  +++.+.....-+..++.+-+.....+++. -..-.
T Consensus       258 G~RlG~~~~~~~li~~~~~~~~~~~~~~~~~~Q~a~~~~l~~~--~~~~~~~~~~~~~~R~~l~~~l~~~~g~~-~~~P~  334 (406)
T PRK06207        258 GYRLGVAFGSPAIIARMEKLQAIVSLRAAGYCQAVLRTWFDEP--PGWMEDRIAQHQAIRDDLIRVLRGIDGVF-ARAPE  334 (406)
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHHCCCCCE-ECCCC
T ss_conf             5624889789999999999998843684299999999999677--99999999999999999999985089957-45899


Q ss_pred             -EEEEEEEEC---CCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             -009998724---99899999999-689899626------89889955898688999999999999999985
Q gi|254780432|r  330 -GLLIGLKTV---FSPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       330 -Gl~~~ie~~---~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                       |++.=+++.   .+...+++.++ +.||.+.|.      +.+.+||+  +..+++.|.+++++|.+.+.+.
T Consensus       335 gg~yl~~~l~~~~~~~~~f~~~Ll~e~gVav~PG~~FG~~~~~~vRls--fa~~~e~l~eal~RL~~~l~~y  404 (406)
T PRK06207        335 AGSYLFPRLPKLAVGLADFVKILRLQAGVVVTPGTEFSPHTADSIRLN--FSQDHAAAVAAVERIAALIERY  404 (406)
T ss_pred             CEEEEEEECCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHH
T ss_conf             148996888888999999999999858999988656589998979999--7398999999999999999985


No 152
>PRK07777 aminotransferase; Validated
Probab=99.65  E-value=2e-14  Score=114.81  Aligned_cols=332  Identities=14%  Similarity=0.159  Sum_probs=193.2

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCC-CCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCCC
Q ss_conf             799764641022674357878999999999999731-450-687578189999986520101----33-31235655540
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHV-SNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAES  101 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~-~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGseA  101 (392)
                      +.++..|+|.-|.  -.+ --.|.|++|+.++++.. .++ +.....+.++++++.+.+..+    .| .++.++++++|
T Consensus        21 a~~~~~I~l~~G~--Pd~-~~p~~i~~a~~~a~~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~~~pe~eI~vt~Ga~~a   97 (386)
T PRK07777         21 AVRTGAVNLGQGF--PDE-DGPPEMLEAAQEAIAGGVNQYPPGPGIAPLRAAIAAQRRRRYGLEYDPDTEVLVTVGATEA   97 (386)
T ss_pred             HCCCCCEEECCCC--CCC-CCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHH
T ss_conf             5799988949978--998-5689999999999862899779987649999999999999819999998809987787999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             35677766543200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       102 ~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
                      ...+++.--       .+| +.|+..+-+|.+..............    -|..+. ..-...|++++++.+.+++-+++
T Consensus        98 l~~~~~~l~-------~pG-D~Vlv~~P~y~~y~~~~~~~g~~~v~----vpl~~~-~~~~~~d~~~l~~~~~~~tk~ii  164 (386)
T PRK07777         98 IAAAVLGLV-------EPG-DEVLLIEPYYDSYAAVIAMAGAHRVA----VPLVPD-GRGFALDVDALRAAVTPRTRALI  164 (386)
T ss_pred             HHHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHHCCEEEE----CCCCCC-CCCCCCCHHHHHHHCCCCCEEEE
T ss_conf             999999964-------899-87763499778769999983892561----343477-88846696999974687776999


Q ss_pred             C-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCC-CCCCCCCCC----EEECCCCCC-CCCCCC
Q ss_conf             3-332222112462101232211022345721310110034444555310-111245453----021034444-443443
Q gi|254780432|r  182 I-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA-YEWANVKPD----IMTIAKGMG-GGFPIG  254 (392)
Q Consensus       182 ~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~-~e~~gi~PD----i~~~gK~l~-gG~P~s  254 (392)
                      + -| +.--|. ..+++-+++|.++|++||+++|.||+...+.-.|.-+. ...++-.+|    +-.+||.++ .|+=+|
T Consensus       165 l~~P-~NPTG~-v~s~e~l~~l~~la~~~~i~ii~DE~Y~~l~f~~~~~~~~~~~~~~~~~~i~i~S~SK~~~~~G~R~G  242 (386)
T PRK07777        165 VNSP-HNPTGT-VLSAAELAAIAELAVEHDLLVITDEVYEHLVFDGARHLPLATLPGMAERTVTISSAAKTFNVTGWKIG  242 (386)
T ss_pred             ECCC-CCCCCC-CCCHHHHHHHHHHHHHCCCEEECCCCHHHHCCCCCCCCCHHHCCCCCCCCEEECCCCCCCCCCCCCEE
T ss_conf             7999-698884-88899999999998642978865753775226887777365467865760243166676677662259


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC----HHHHHCCHHHHHHHHHHHHCCCEEEEECCCE
Q ss_conf             210001112222233223453211110012334554320122210----1121000026889999886797075504640
Q gi|254780432|r  255 ACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE----NVINIAKILFEGLTAIKNRFPNMFLEVRGQG  330 (392)
Q Consensus       255 av~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~----~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G  330 (392)
                      .+++.+++++.+.......|+..+...-.++.+.|+.-  +.+++    ..+++-+.+.+.|+++     ++ .-....|
T Consensus       243 ~~v~~~~li~~~~~~~~~~~~~~~~~~Q~a~~~al~~~--~~~~~~~~~~~~~rrd~~~~~L~~~-----g~-~~~~p~G  314 (386)
T PRK07777        243 WACGPAPLIAAVRAAKQYLTYVGGAPFQPAVAHALDHE--DAWVAALRDSLQAKRDRLAAGLAEA-----GF-AVHDSAG  314 (386)
T ss_pred             EEEECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHHHC-----CC-EEECCCE
T ss_conf             99858999999999998636758658999999998687--5999999999999999999999976-----98-8717982


Q ss_pred             E-EEEEEEC----CCHHHHHHHHHH-CCEEEEEC---------CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             0-9998724----998999999996-89899626---------898899558986889999999999999999
Q gi|254780432|r  331 L-LIGLKTV----FSPALLAAKFRD-ECLLTAPS---------SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       331 l-~~~ie~~----~~~~~~~~~l~~-~Gll~~~~---------~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      . ++-+++.    .+...+++++.+ .||.+.|.         +.+.||++  |.-++++|++++++|.+.++
T Consensus       315 ~~f~~~~~~~~~~~d~~~f~~~L~~~~gV~v~PG~~F~~~~~~g~~~vRls--f~~~~e~l~ea~~RL~~~~r  385 (386)
T PRK07777        315 TYFLCADPRPLGYDDGTAFCRALPERVGVAAIPMSAFCDPADAWNHLVRFA--FCKRDDTLDEAIRRLRALRR  385 (386)
T ss_pred             EEEEEEECCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHC
T ss_conf             689988666689999999999999868999988744288987789979999--68999999999999999864


No 153
>PRK08175 aminotransferase; Validated
Probab=99.65  E-value=3.3e-14  Score=113.36  Aligned_cols=334  Identities=15%  Similarity=0.167  Sum_probs=193.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-C--CCCCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCC
Q ss_conf             799764641022674357878999999999999731-4--50687578189999986520101----33-3123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-W--HVSNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~--~~~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGse  100 (392)
                      ..|++.||+.-|  --.+ -.+|+|++|+.+.++.. .  |+......+.+..+++.+.+..+    .+ .++.++++++
T Consensus        26 ~~G~dvi~l~iG--~pdf-~~p~~i~~a~~~~~~~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~~~p~~~iivt~Ga~~  102 (395)
T PRK08175         26 RRGEDIIDFSMG--NPDG-ATPPHIVEKLCEVAQRPDTHGYSTSRGIPRLRRAISRWYQDRYDVDIDPESEAIVTIGSKE  102 (395)
T ss_pred             HCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHH
T ss_conf             579981877697--8999-8799999999999769998888997574999999999999986898787883998888799


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |...+++..-       .+| +.|+..+-+|-...............    -|..++...  ..|++.+.+....++.++
T Consensus       103 al~~~~~al~-------~pG-D~Vli~~P~Yp~y~~~~~~~g~~~~~----vpl~~~~~~--~~~le~~~~~~~~ktk~i  168 (395)
T PRK08175        103 GLAHLMLATL-------DHG-DTVLVPNPSYPIHIYGAVIAGAQVRS----VPLVEGVDF--FNELERAIRESYPKPKMM  168 (395)
T ss_pred             HHHHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHHCCCEEE----EECCCCCCC--HHHHHHHHHHCCCCCEEE
T ss_conf             9999999727-------998-98997787740149999984784078----504577760--441999997268774599


Q ss_pred             CC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-CCCCCCCCE----EECCCCCC-CCCCC
Q ss_conf             23-3322221124621012322110223457213101100344445553101-112454530----21034444-44344
Q gi|254780432|r  181 LI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-EWANVKPDI----MTIAKGMG-GGFPI  253 (392)
Q Consensus       181 i~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~~gi~PDi----~~~gK~l~-gG~P~  253 (392)
                      ++ -| +.-.|. ..+++.+++|.++|++||+++|.||+..-+.--|.-+-+ -...-..|.    ..+||.++ .|+=+
T Consensus       169 iln~P-~NPTG~-v~s~e~l~~i~~~a~~~~i~visDEiY~~l~~d~~~~~s~~~~~~~~~~~i~~~S~SK~f~~~G~Ri  246 (395)
T PRK08175        169 ILGFP-SNPTAQ-CVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWKAPSIMQVPGAKDVAVEFFTLSKSYNMAGWRI  246 (395)
T ss_pred             EECCC-CCCCCC-CCCHHHHHHHHHHHHHCCEEEEECCCHHHHCCCCCCCCCHHHCCCCCCCEEEEEECCCCCCCCCCCE
T ss_conf             98899-998887-5799999999998886694898235314210288778685447456465489950322347775456


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEE
Q ss_conf             32100011122222332234532111100123345543201--2221011210000268899998867970755046400
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGL  331 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl  331 (392)
                      |.+++.+++++.+.......+++.++....++.+.|+.-++  +++.+..+++-+.+.+.|+++     ++. -.+..|-
T Consensus       247 G~ii~~~~~i~~~~~~~~~~~~~~~~~~Q~aa~~al~~~~~~~~~~~~~~~~rr~~l~~~L~~~-----g~~-~~~P~G~  320 (395)
T PRK08175        247 GFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEA-----GWM-VEMPKAS  320 (395)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CCE-EECCCEE
T ss_conf             9996499999999999987046876799999999985989999999999999999999999875-----985-4068966


Q ss_pred             -EEEEEECC-----CHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             -99987249-----9899999999-689899626------8988995589868899999999999999998
Q gi|254780432|r  332 -LIGLKTVF-----SPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       332 -~~~ie~~~-----~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                       ++-+++..     +...++.+++ +.||.+.|.      +++.+||+  +.-+++.|++++++|.+.++.
T Consensus       321 ~y~w~~~~~~~~~~~~~ef~~~ll~e~~V~v~PG~~Fg~~g~~~vRl~--~~~~~~~l~eal~Ri~~~~~a  389 (395)
T PRK08175        321 MYVWAKIPEPYAAMGSLEFAKKLLNEAKVCVSPGIGFGDYGDTHVRFA--LIENRDRIRQAVRGIKAMFRA  389 (395)
T ss_pred             EEEEEECCCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHH
T ss_conf             699688888767899899999999849899977733277999869999--728999999999999999986


No 154
>PRK06220 consensus
Probab=99.65  E-value=2.9e-14  Score=113.75  Aligned_cols=332  Identities=16%  Similarity=0.169  Sum_probs=198.9

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCCCCC-CCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731-4506875-78189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVSNLY-QSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~~~~-~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|--  .+ -..|.|++|+.+.++.. .+++... ..+.+..+++.+.+..+    .|.+++++++.+|.
T Consensus        28 ~~G~dvi~l~iG~p--df-~~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lreaia~~~~~~~g~~~~pd~I~vt~G~~~al  104 (384)
T PRK06220         28 RQGRDIIHLEVGEP--DF-PTPECVCEAACAAIERGLTHYTHSLGLPELREAIAEHYRRRYGVDVDPDQVIVTSGTSPAM  104 (384)
T ss_pred             HCCCCEEECCCCCC--CC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHEEEECCCHHHHH
T ss_conf             66998079999889--99-9789999999999854999989997869999999999999868998801289868889999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++.--       .+| +.|+..+-+|.+...........+..    -|..+  ..-...|++.+++.+.+++.++++
T Consensus       105 ~~~~~~l~-------~pG-D~Vlv~~P~Y~~~~~~~~~~g~~~v~----v~~~~--~~~~~~d~~~l~~~~~~~~k~i~l  170 (384)
T PRK06220        105 LMVFMALL-------NKG-DEVILSDPHYACYPNFVKFLGGTPVF----VPVYE--EDGFQYRPEAIRACLTPRTKAILI  170 (384)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCCCCHHHHHHCCCEEEE----ECCCC--CCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999981-------899-98997789887639999984983999----22463--237677999999747888739997


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-CCCCCCCCEEECCCCCC-CCCCCCCCCCC
Q ss_conf             -3322221124621012322110223457213101100344445553101-11245453021034444-44344321000
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-EWANVKPDIMTIAKGMG-GGFPIGACLAT  259 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~~gi~PDi~~~gK~l~-gG~P~sav~~~  259 (392)
                       -| +.-.|. ..+++.++++.++    ++++|.||+...+--.|..+.. +..+-.-=+-.+||.++ .|+-+|.+++.
T Consensus       171 ~~P-~NPtG~-v~s~e~l~~l~~~----~~~vIsDEiY~~l~~~~~~~s~~~~~~~~i~~~S~SK~~~~~G~RiG~~i~~  244 (384)
T PRK06220        171 NSP-SNPTGH-VLSPERLAGIASL----GIPIISDEIYHGLVYEGREHSILEFTDNAFVLNGFSKLYAMTGWRLGYLIVP  244 (384)
T ss_pred             CCC-CCCCCC-CCCHHHHHHHHHH----CCEEEECCCHHHHCCCCCCCCHHHCCCCEEEEEECHHHCCCCCCCEEEEEEC
T ss_conf             289-998786-7719999998730----9889724626864158998882114787899974235307865356999988


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC--CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEE-EE
Q ss_conf             111222223322345321111001233455432012--221011210000268899998867970755046400999-87
Q gi|254780432|r  260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD--GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG-LK  336 (392)
Q Consensus       260 ~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~--~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~-ie  336 (392)
                      +++++.+.......+...+.++-.++.+.|+..++.  .+.+..+++-+.+.+.|+++     +....+...|.++. ++
T Consensus       245 ~~~i~~l~~~~~~~~~~~~~~~q~a~~~al~~~~~~~~~~~~~~~~~r~~l~~~L~~~-----~~~~~~~P~g~~y~~~~  319 (384)
T PRK06220        245 PSCVRALQKLHQNFFICANSVVQEAGIAALKQAQEDVARMRQIYNERRQYMIKRLREM-----GFGIRVEPTGAFYVLAD  319 (384)
T ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHC-----CCCCCCCCCEEEEEEEE
T ss_conf             9999999999986157898799999999995839999999999999999999999975-----99856389852688577


Q ss_pred             E---CCCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             2---499899999999-689899626------89889955898688999999999999999985
Q gi|254780432|r  337 T---VFSPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       337 ~---~~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +   ..+...++..+. +.||.+.|.      +++.+||.  +..++++|++++++|++++.+-
T Consensus       320 ~~~~~~d~~~~~~~ll~~~gV~v~PG~~Fg~~~~g~iRl~--f~~~~e~l~ea~~RL~~~l~~~  381 (384)
T PRK06220        320 ARHLSGDSYALAFDILEEAGVGVTPGIDFGNGGEGYLRFS--YANSLENIAEGLDRLEQFLEKR  381 (384)
T ss_pred             CCCCCCCHHHHHHHHHHHCCEEEECCHHCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHH
T ss_conf             8878999999999999839999977810088999979999--7099999999999999999987


No 155
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase. This family of succinyldiaminopimelate transaminases (DapC) includes the experimentally characterized enzyme from Bordatella pertussis. The majority of genes in this family are proximal to genes encoding components of the lysine biosynthesis via diaminopimelate pathway (GenProp0125).
Probab=99.64  E-value=4.1e-14  Score=112.71  Aligned_cols=337  Identities=13%  Similarity=0.081  Sum_probs=191.6

Q ss_pred             EEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCC-CHHHHHHHHHHHHHCC-------CCCCCCCCC
Q ss_conf             99679976464102267435787899999999999973145068757-8189999986520101-------333123565
Q gi|254780432|r   26 LFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQ-STQQEIFANHLIHSTF-------ADRVFFTNS   97 (392)
Q Consensus        26 i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~-~~~~~~la~~L~~~~~-------~~~v~f~~S   97 (392)
                      +....|++.||+.-|  .-.+. -.+.|++|+++.++...++++... .+.++.+++.+.+..+       .+.++.+++
T Consensus        23 ~~~~~g~~iI~L~iG--~Pd~~-~P~~v~ea~~~al~~~~~Y~~~~G~~~LReAia~~~~~~~~~~~~~dp~~~I~vt~G   99 (394)
T TIGR03538        23 VTPPASLPPIALSIG--EPKHA-TPAFVLEALRENLHGLSTYPTTKGLPELRQAIARWLERRFDLPTGVDPERHVLPVNG   99 (394)
T ss_pred             HHHHCCCCEEECCCC--CCCCC-CCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCC
T ss_conf             034089987878488--89999-779999999998438889999988699999999999997398877896776998988


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             5540356777665432001347860-023435465654321234553211347999864333222100268875410123
Q gi|254780432|r   98 GAESVECAIKTARRYHYMAGKTNKF-RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND  176 (392)
Q Consensus        98 GseA~e~Aiklar~~~~~~g~t~r~-~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~  176 (392)
                      +++|...+++..-       .+|.. .|+..+-.|......+....+.+.+    -|..+  ..-...|++++++.+.++
T Consensus       100 a~~al~~~~~~l~-------~pGd~~~V~~p~P~Y~~y~~~~~~~g~~~~~----v~~~~--e~~~~~d~~~l~~~~~~~  166 (394)
T TIGR03538       100 TREALFAFAQAVI-------NPGQAPLVVMPNPFYQIYEGAALLAGAEPYF----LNCTA--ENGFLPDFDAVPESVWRR  166 (394)
T ss_pred             HHHHHHHHHHHHC-------CCCCCEEEEECCCCCCCCHHHHHHCCCEEEE----CCCCC--CCCCCCCHHHHHHHCCCC
T ss_conf             8999999999972-------9998108994788664529999975998997----58673--458888999998745236


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCC--CC-CC---CCCC-CC-C-EE--ECCC
Q ss_conf             3222233322221124621012322110223457213101100344445553--10-11---1245-45-3-02--1034
Q gi|254780432|r  177 TAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL--FA-YE---WANV-KP-D-IM--TIAK  245 (392)
Q Consensus       177 iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~--f~-~e---~~gi-~P-D-i~--~~gK  245 (392)
                      +-++++-.=+.-.|. ..+++.++++.++|++||+++|.||+...+.-.+..  .+ ++   ..+. .. . |+  .+||
T Consensus       167 tk~iil~sP~NPTG~-v~s~~~l~~l~~~a~~~~i~iisDE~Y~~l~~d~~~~p~~~~~~~~~~~~~~~~~~i~~~S~SK  245 (394)
T TIGR03538       167 CQLLFVCSPGNPTGA-VLSLETLKKLIELADQYGFIIASDECYSELYFDEANPPAGLLQAAAALGRDDFRRCLVFHSLSK  245 (394)
T ss_pred             CEEEEECCCCCCCCC-CCCHHHHHHHHHHHHCCCEEEEEECCCCCEEECCCCCCHHHHHHHHHHCCCCCCCEEEEECCCC
T ss_conf             659998899999897-7787999999999732676999806833278578889737877776625444476799955654


Q ss_pred             CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEE
Q ss_conf             444-4434432100011122222332234532111100123345543201222101121000026889999886797075
Q gi|254780432|r  246 GMG-GGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFL  324 (392)
Q Consensus       246 ~l~-gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~  324 (392)
                      ..+ .|+=+|.+++.+++++.+.........+.+...-.++.+.+   ..+..   +++.-+.++++.+.+.+.....+.
T Consensus       246 ~~~~~G~RiG~~~~~~~~i~~~~~~~~~~~~~~~~~~q~a~~aa~---~~~~~---~~~~r~~~~~r~~~~~~~L~~~~~  319 (394)
T TIGR03538       246 RSNLPGLRSGFVAGDAEILKAFLRYRTYHGCAMPPPTQLASIAAW---NDEQH---VRENRALYREKFAAVLEILGPVLD  319 (394)
T ss_pred             CCCCCCCEEEEEECCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHH---CCHHH---HHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             445467517999579999999998522374268999999999984---89899---999999999999999998642796


Q ss_pred             EECCCE-EEEEEEECCCHHHHHHHH-HHCCEEEEEC------------CCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             504640-099987249989999999-9689899626------------89889955898688999999999999999
Q gi|254780432|r  325 EVRGQG-LLIGLKTVFSPALLAAKF-RDECLLTAPS------------SDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       325 ~vRG~G-l~~~ie~~~~~~~~~~~l-~~~Gll~~~~------------~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      -.+..| +++=+++..+...++.++ .+.||.+.|.            |.+.|||+  +.-++++|.+++++|++.+
T Consensus       320 ~~~P~Gg~y~w~~~~~~~~~f~~~ll~e~gV~v~PG~~F~~~~~~~~~G~g~iR~s--~~~~~e~l~ea~~Rl~~fl  394 (394)
T TIGR03538       320 LELPDAGFYLWPKVPGDDEAFARALYEEENVTVLPGRYLSREAEGVNPGAGRVRIA--LVAPLEECVEAAERIRRFI  394 (394)
T ss_pred             CCCCCEEEEEEEECCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHC
T ss_conf             25798548999968999999999999868999987734165545788899989999--7598999999999999869


No 156
>PRK08636 aspartate aminotransferase; Provisional
Probab=99.64  E-value=4.2e-14  Score=112.64  Aligned_cols=339  Identities=15%  Similarity=0.132  Sum_probs=190.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-C--CCCCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCC
Q ss_conf             799764641022674357878999999999999731-4--50687578189999986520101----33-3123565554
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-W--HVSNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAE  100 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~--~~~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGse  100 (392)
                      ..|++.||+.-|  --.+ --++.|++|+.+++++. .  ++......+.+.++++.+.+..+    .+ .++.++++++
T Consensus        30 ~~G~~vi~l~iG--~Pd~-~~P~~i~~a~~~a~~~~~~~gY~~~~G~~eLR~aia~~~~~~~g~~~~p~~~I~vt~Ga~~  106 (403)
T PRK08636         30 RAGEDVIDFSMG--NPDG-PTPQHIIDKLCESAQKPKTHGYSVSKGIYKLRLAICNWYKRKYNVDLDPDTEVVATMGSKE  106 (403)
T ss_pred             HCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCHHH
T ss_conf             659986889796--8999-8799999999999769988789997472999999999999970999999874999179899


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             03567776654320013478600234354656543212345532113-----4799986433322210026887541012
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQY-----LEGFGPKIEGFDQAKFCDLQSLKNQISN  175 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~-----~~~~~p~~~~~~~~~~~d~~~l~~~~~~  175 (392)
                      |.-.+++..-       .+| +.||..+-+|-..........+....     ...|.+..    ..-..+++.+.+....
T Consensus       107 al~~~~~al~-------~pG-D~Vli~~P~Y~~y~~~~~~~g~~~~~~~l~~~~~~~~d~----~~~~~~le~~~~~~~~  174 (403)
T PRK08636        107 GYVHLVQAIT-------NPG-DVAIVPDPAYPIHSQAFILAGGNVHKMPLEYNEDFELDE----DKFFENLEKALRESSP  174 (403)
T ss_pred             HHHHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEEEECCCCCCCCCCH----HHHHHCHHHHHHHCCC
T ss_conf             9999999977-------999-989977888703899999849968997433577742466----6520258998762688


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-CCCCCCCCEE----ECCCCCC-C
Q ss_conf             33222233322221124621012322110223457213101100344445553101-1124545302----1034444-4
Q gi|254780432|r  176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-EWANVKPDIM----TIAKGMG-G  249 (392)
Q Consensus       176 ~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~~gi~PDi~----~~gK~l~-g  249 (392)
                      ++-++|+-.=..-.|. ..+++.+++|.++|++||+++|.|||...+--.|.-+-+ -...-.+|.+    .+||..+ .
T Consensus       175 ktk~iiln~P~NPTG~-v~s~~~l~~i~~la~~~~i~visDEiY~~l~~~g~~~~s~~~~~~~~~~~i~~~s~SK~~~~~  253 (403)
T PRK08636        175 KPKYVVVNFPHNPTTA-TVEKSFYERLVALAKKERFYIISDIAYADITFDGYKTPSILEVEGAKDVAVESYTLSKSYNMA  253 (403)
T ss_pred             CCEEEEECCCCCCCCC-CCCHHHHHHHHHHHHHCCEEEEECCCHHHEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             7179998999899887-889999999999998659389962640000017987874102753001332224420025776


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             434432100011122222332234532111100123345543201--222101121000026889999886797075504
Q gi|254780432|r  250 GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFLEVR  327 (392)
Q Consensus       250 G~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vR  327 (392)
                      |+=+|.+++++++.+.+.......+++.+...-.++...|+.-++  +.+.+..+++-+.+.+.|++     .++ .-..
T Consensus       254 G~RiG~ii~~~~li~~~~~~~~~~~~~~~~~~q~aa~~al~~~~~~~~~~~~~y~~rr~~l~~~l~~-----~g~-~~~~  327 (403)
T PRK08636        254 GWRVGFVVGNKKLIGALKKIKSWLDYGMFTPIQVAATIALDGDQSCVEEIRETYEKRRDVLIKSFEN-----AGW-ELQK  327 (403)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH-----CCC-EECC
T ss_conf             4128999739999999999998634685689999999998398999999999999999999999986-----597-0037


Q ss_pred             CCEEEEE-EEEC-----CCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             6400999-8724-----99899999999-689899626------898899558986889999999999999999852
Q gi|254780432|r  328 GQGLLIG-LKTV-----FSPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       328 G~Gl~~~-ie~~-----~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      ..|-++. +++.     .+...++.++. +.||.+.|.      +++.+|++  +..++++|++++++|++.++++.
T Consensus       328 P~g~~y~w~~l~~~~~~~~~~ef~~~ll~~~gV~v~PG~~Fg~~g~~~vRis--f~~~~e~l~ea~~Rl~~~l~e~~  402 (403)
T PRK08636        328 PRASMFVWAKIPEPFRHLGSLEFSKQLLTEAKVAVSPGIGFGEYGDEYVRIA--LIENENRIRQAARNIKKFLKEFE  402 (403)
T ss_pred             CCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             8810389787875447899899999999749799988753288999879999--71899999999999999999844


No 157
>pfam00266 Aminotran_5 Aminotransferase class-V. This domain is found in amino transferases, and other enzymes including cysteine desulphurase EC:4.4.1.-.
Probab=99.64  E-value=5.1e-14  Score=112.10  Aligned_cols=315  Identities=16%  Similarity=0.184  Sum_probs=187.0

Q ss_pred             EEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC-CCCCHH------HHHHH-HHHHHHCC---CCCCCCCCCCCCCH
Q ss_conf             464102267435787899999999999973145068-757818------99999-86520101---33312356555403
Q gi|254780432|r   34 FLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN-LYQSTQ------QEIFA-NHLIHSTF---ADRVFFTNSGAESV  102 (392)
Q Consensus        34 yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~-~~~~~~------~~~la-~~L~~~~~---~~~v~f~~SGseA~  102 (392)
                      |+|-.++      ..-.|++++++.+.+.+.. .++ ...+..      ..+-+ +.+.+..+   .+.+.|+.|+||++
T Consensus         2 YlD~aat------tp~~~~V~~~~~~~~~~~~-~np~s~~~~~~~~~~~~~e~aR~~ia~~lga~~~~~i~ft~~~Te~~   74 (371)
T pfam00266         2 YLDSAAT------TQKPQAVLDALQEYYTDYN-GNVHRGVHHLGKEATQAYEEAREKVAEFINAPSDEEIIFTSGTTEAI   74 (371)
T ss_pred             CCCCCCC------CCCCHHHHHHHHHHHHHCC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHH
T ss_conf             5768123------6899999999999998648-88565214999999999999999999971939989799848878998


Q ss_pred             HHHHHHHH-HHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             56777665-43200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  103 ECAIKTAR-RYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       103 e~Aiklar-~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
                      ..+++-.. .+      ...+.||....-|+........+.    .+.+..-..-.+.....-|++.+++.+.+++..|.
T Consensus        75 n~~~~~~~~~~------~~gd~ii~s~~eh~s~~~~~~~l~----~~~g~~v~~i~~~~~g~i~~~~l~~~i~~~t~lv~  144 (371)
T pfam00266        75 NLVAISLGRRL------KPGDEILVTEMEHHANLVPWQELA----KRTGATVRVIPVDPNGLLDLDALEKLLTPRTKLVA  144 (371)
T ss_pred             HHHHHHHHHCC------CCCCEEEEECCCCCCHHHHHHHHH----HHCCCEEEEECCCCCCCCCHHHHHHHCCCCCEEEE
T ss_conf             87652345314------998999995477552365999987----62495699935698986989999985689964999


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEC--CCCCCCCCCCCCCCCC
Q ss_conf             33322221124621012322110223457213101100344445553101112454530210--3444444344321000
Q gi|254780432|r  182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI--AKGMGGGFPIGACLAT  259 (392)
Q Consensus       182 ~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~--gK~l~gG~P~sav~~~  259 (392)
                      +--+....|.+.|    ++.+.++|+++|+++++|=+|+ +|..  .+-.+.+  .+|++++  =| +.|..-+|++..+
T Consensus       145 ~~~v~n~tG~~~p----i~~i~~~~~~~g~~~~vDa~q~-~g~~--~id~~~~--g~D~~~~s~hK-~~GP~G~G~L~v~  214 (371)
T pfam00266       145 ITHVSNVTGTVNP----VEEIGKLAHEYGALVVVDAAQA-VGHR--PIDVQAL--GVDFLAFSGHK-LYGPTGIGVLYGR  214 (371)
T ss_pred             EECCCCCCCEECH----HHHHHHHHHHCCCEEEEECCCC-CCCC--CCCCCCC--CCCEEEEECCC-CCCCCCEEEEEEC
T ss_conf             9676677882405----5569999863691799875123-6752--2032324--36569986555-6899843999981


Q ss_pred             CCCCCCCCCCCCCCC-------------------C---CCCCCCHHHHHHHHHHHHC---CCCCCHHHHHCCHHHHHHHH
Q ss_conf             111222223322345-------------------3---2111100123345543201---22210112100002688999
Q gi|254780432|r  260 NEVAACMNQGSHGST-------------------Y---GGNVLAMVLGEKVLNIIQS---DGFLENVINIAKILFEGLTA  314 (392)
Q Consensus       260 ~~i~~~~~~~~~~~T-------------------~---~gnpl~~aaa~a~L~~l~~---~~l~~~~~~~g~~l~~~L~~  314 (392)
                      ++..+.+.|...+..                   |   +-|..+.++..++++++.+   +++.++.+.+.+++.++|++
T Consensus       215 ~~~~~~l~p~~~g~~~~~~~~~~~~~~~~~~~~~~e~GT~n~~~~~~l~~al~~~~~~g~~~i~~~~~~L~~~l~~~L~~  294 (371)
T pfam00266       215 RDLLEKLPPWKGGGGMIDLVSLLQETTFADAPSKFEAGTPNIAGIIGLGAALDYLAEIGLEAIEKHERELAAYLYERLLA  294 (371)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             57784578756799843565422235545614440478998788999999999999819899999999999999999855


Q ss_pred             HHHHCCCEEE--EE-CCCEEEEEEEEC-CCHHHHHHHHHHCCEEEEEC------------CCCEEEECCCCCCCHHHHHH
Q ss_conf             9886797075--50-464009998724-99899999999689899626------------89889955898688999999
Q gi|254780432|r  315 IKNRFPNMFL--EV-RGQGLLIGLKTV-FSPALLAAKFRDECLLTAPS------------SDNVVRILPPLTITAEEIHE  378 (392)
Q Consensus       315 l~~~~~~~v~--~v-RG~Gl~~~ie~~-~~~~~~~~~l~~~Gll~~~~------------~~~~irl~Ppl~it~~eid~  378 (392)
                      +    |.+..  +. .-..-+..+.+. .+...+...|.++||.+...            .+..||+++...-|++|||+
T Consensus       295 ~----~~~~i~~~~~~~~~~ivsf~~~~~~~~~~~~~L~~~gI~vs~G~~Cs~~~l~~~~~~g~iRiS~~~ynT~eeId~  370 (371)
T pfam00266       295 I----PGIRLVPAVAERRPSIISFNFPGVHPHDVATLLDERGIAVRSGHHCAQPLMERLGVHGTLRASLYFYNTEEEVDR  370 (371)
T ss_pred             C----CCEEEECCCCCCCCCEEEEEECCCCHHHHHHHHHHCCEEEECCCCCCCHHHHHHCCCCEEEEECCCCCCHHHHHC
T ss_conf             9----998994986246688899995990999999997348819976400032444876799889997688799999825


Q ss_pred             H
Q ss_conf             9
Q gi|254780432|r  379 G  379 (392)
Q Consensus       379 ~  379 (392)
                      +
T Consensus       371 L  371 (371)
T pfam00266       371 L  371 (371)
T ss_pred             C
T ss_conf             9


No 158
>PRK06507 consensus
Probab=99.64  E-value=3.5e-14  Score=113.21  Aligned_cols=333  Identities=14%  Similarity=0.173  Sum_probs=199.5

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCC-CCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             799764641022674357878999999999999731-4506-87578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVS-NLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~-~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      .+|++.|++.-|  .-.+ ..+|++++|+++.+... ..++ .....+.++++++.+.+..+    .+.+..++++++|.
T Consensus        28 ~~G~~vi~L~iG--~pd~-~~p~~i~~a~~~~~~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~~~p~~I~vt~G~~~al  104 (400)
T PRK06507         28 AEGIKVVSLSSG--EPDF-PTPAHAIEAAHAAALAGDTKYPPMDGTPALKAAIQRKFKRENNLDYDPSEIVVSNGGKQVI  104 (400)
T ss_pred             HCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHH
T ss_conf             779973777893--8899-8889999999999745899879987849999999999999848999824389817829999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++..-       .+| ..|+..+-+|.+.........+.+...    |..+  ..-...|.+.+++.+.+++-++|+
T Consensus       105 ~~~~~~l~-------~pG-D~Vli~~P~y~~y~~~~~~~g~~~v~v----~l~~--~~g~~~d~~~le~~~~~~tk~iil  170 (400)
T PRK06507        105 FNAMMATC-------NPG-DEVVIPAPSWVSYADIVKLAGGVPVAV----PCRE--ETGFKLRPEDLEAAITPRTKWLFL  170 (400)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCCHHHHHHHHCCCEEEEE----ECCC--CCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999966-------999-989990587740579999819915997----5670--117641699999746756649997


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCC-CCEEEECCCCCCCCCCCCCCCCCCCCCCCC----EE---ECCCCCC-CCCC
Q ss_conf             -332222112462101232211022345-721310110034444555310111245453----02---1034444-4434
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDI-DALLIFDEVQTGYGRTGKLFAYEWANVKPD----IM---TIAKGMG-GGFP  252 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~-g~llI~DEV~tG~GRtG~~f~~e~~gi~PD----i~---~~gK~l~-gG~P  252 (392)
                       -| ..-.|. ..+++.+++|.++|++| ++++|.||+...+.-.|.-+.+ ...+.||    ++   .+||..+ .|+=
T Consensus       171 ~~P-~NPTG~-v~s~~~l~~i~~~a~~~~~v~visDEiY~~l~~~~~~~~s-~~~~~p~~~~~~i~~~S~SK~~~~~G~R  247 (400)
T PRK06507        171 NFP-NNPTGA-ACTRAEMAAIAEVMLRHPHVWIMTDDIYEHLVYDGFEFCT-IAEVEPRLYDRVLTMNGVSKAYAMTGWR  247 (400)
T ss_pred             CCC-CCHHHH-HHHHHHHHHHHHHHHHCCCCEECCCCCHHHHEECCCCCCC-HHHHCCCCCCCEEEEECCCCCCCCCCCC
T ss_conf             499-293128-8647799999986653168214056642441208977887-8885856455358983354444676510


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC----HHHHHCCHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             43210001112222233223453211110012334554320122210----11210000268899998867970755046
Q gi|254780432|r  253 IGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE----NVINIAKILFEGLTAIKNRFPNMFLEVRG  328 (392)
Q Consensus       253 ~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~----~~~~~g~~l~~~L~~l~~~~~~~v~~vRG  328 (392)
                      +|.+++.+++.+.+.......+.+-+.++-.++.+.|+--  +++++    ..+++-+.+.+.|++    .|++ .-.+.
T Consensus       248 iG~~~~~~~~i~~~~~~~~~~~~~~~~~~Q~aa~~al~~~--~~~~~~~~~~~~~rrd~l~~~L~~----~~g~-~~~~P  320 (400)
T PRK06507        248 LGFCGGPKELIKAMSNVNGQATGGIATLAQAAAAAALDGP--QDLLKERAAIYRERRDFVVEKLAE----IPGL-TCHKP  320 (400)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHHH----CCCC-CCCCC
T ss_conf             4877487999999999986524765439999999998497--777789999999999999999984----7899-56789


Q ss_pred             CEEEEEE-EEC-------------CCHHHHHHH-HHHCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             4009998-724-------------998999999-996898996268----988995589868899999999999999998
Q gi|254780432|r  329 QGLLIGL-KTV-------------FSPALLAAK-FRDECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       329 ~Gl~~~i-e~~-------------~~~~~~~~~-l~~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      .|.|+.. ++.             .++..++.+ +.+.||.+.|..    ++.+|++  +..++++|.+++++|.+.+.+
T Consensus       321 ~G~fy~~~~~~~~~~~~~~~~~~~~~d~~f~~~Ll~e~gV~v~PG~~FG~~~~vRis--~a~~~~~l~eal~Rl~~f~~~  398 (400)
T PRK06507        321 EGAFYIYPNIAGLIGKTSKGGRRLETDEDFVMALLEEQHVATVQGAAYGMSPYFRLS--YATDMESLGEGCARIAQFCED  398 (400)
T ss_pred             CEEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHH
T ss_conf             814799775401023345345667888999999998589999778744899839999--649999999999999999996


Q ss_pred             H
Q ss_conf             5
Q gi|254780432|r  390 L  390 (392)
Q Consensus       390 L  390 (392)
                      |
T Consensus       399 l  399 (400)
T PRK06507        399 L  399 (400)
T ss_pred             C
T ss_conf             4


No 159
>PRK09147 aminotransferase; Provisional
Probab=99.63  E-value=6.9e-14  Score=111.27  Aligned_cols=339  Identities=12%  Similarity=0.038  Sum_probs=193.5

Q ss_pred             EEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC-CCCHHHHHHHHHHHHHCC-----CC-CCCCCCC
Q ss_conf             7996799764641022674357878999999999999731450687-578189999986520101-----33-3123565
Q gi|254780432|r   25 WLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL-YQSTQQEIFANHLIHSTF-----AD-RVFFTNS   97 (392)
Q Consensus        25 ~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~-~~~~~~~~la~~L~~~~~-----~~-~v~f~~S   97 (392)
                      .+....|+..||+.-|  .-.+ --.+.|++|+.+.++...+++.. ...+.++.+++.+.+..+     .+ .+..+++
T Consensus        22 ~~~~~~~~~vI~L~iG--~Pd~-~~P~~v~~a~~~a~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~~~~~~~~v~vt~G   98 (397)
T PRK09147         22 GVTPPADLPPISLSIG--EPKH-PTPAFVRDALAANLDGLAVYPTTAGLPALRQAIARWLERRYGLPAVDPATQVLPVNG   98 (397)
T ss_pred             HCHHCCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEECCC
T ss_conf             0401389985876488--8999-978999999999862877899997849999999999998709986785746998888


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             5540356777665432001347860--02343546565432123455321134799986433322210026887541012
Q gi|254780432|r   98 GAESVECAIKTARRYHYMAGKTNKF--RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN  175 (392)
Q Consensus        98 GseA~e~Aiklar~~~~~~g~t~r~--~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~  175 (392)
                      ++||..++++..-       .++..  .|+..+-+|......+......+.+    -|..+.  .-...|++.+++.+.+
T Consensus        99 a~~al~~~~~a~l-------~~gd~g~~Vl~~~P~Y~~y~~~~~~~G~~~v~----vp~~~e--~~~~~d~~~l~~~i~~  165 (397)
T PRK09147         99 SREALFAFAQTVI-------DRSDPGPLVVCPNPFYQIYEGAALLAGAEPYF----LNCDPA--NGFAPDFDAVPAEVWA  165 (397)
T ss_pred             CHHHHHHHHHHHC-------CCCCCCCEEEECCCCCCCCHHHHHHCCCEEEE----ECCCCC--CCCCCCHHHHHHHHHH
T ss_conf             2899999998605-------88898888996888787749999976986899----235712--2777697898987311


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCC--CC----CCCCCC--CCCEE---ECC
Q ss_conf             33222233322221124621012322110223457213101100344445553--10----111245--45302---103
Q gi|254780432|r  176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL--FA----YEWANV--KPDIM---TIA  244 (392)
Q Consensus       176 ~iAavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~--f~----~e~~gi--~PDi~---~~g  244 (392)
                      ++-++++-.=+.-.|. ..+.+-+++|.++|++||+++|.|||...+.-.+..  .+    ....+.  .+..+   .+|
T Consensus       166 ~tk~iil~sP~NPTG~-v~s~e~l~~l~~la~~~~i~iisDEiY~~l~~d~~~~p~~~~~~~~~~~~~~~~~~I~~~S~S  244 (397)
T PRK09147        166 RTQLLFVCSPGNPTGA-VLPLDDWKKLFALSDRYGFVIASDECYSEIYFDEAAPPLGLLEAAAELGRDDFKRLVVFHSLS  244 (397)
T ss_pred             CCCEEEECCCCCCCCC-CCCHHHHHHHHHHHCCCEEEEEECCCCCCCEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCC
T ss_conf             2748986899898899-888899999999632472899982686521547987981577777762656568689981572


Q ss_pred             CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEE
Q ss_conf             4444-443443210001112222233223453211110012334554320122210112100002688999988679707
Q gi|254780432|r  245 KGMG-GGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMF  323 (392)
Q Consensus       245 K~l~-gG~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v  323 (392)
                      |..+ .|+=+|.+++.+++++.+.......+...++....|+.+.+   .++.   ++.+.-+.++++.+.+.+...+.+
T Consensus       245 K~~~~~G~RiG~i~~~~~li~~~~~~~~~~~~~~~~~~q~A~~aa~---~~~~---~~~~~r~~~~~r~~~~~~~l~~~~  318 (397)
T PRK09147        245 KRSNVPGLRSGFVAGDAALLKKFLLYRTYHGCAMPPQVQLASIAAW---NDEA---HVRENRALYREKFDAVTPILAPVL  318 (397)
T ss_pred             CCCCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH---CCCH---HHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             1036766525888689999999999735422257899999999985---6836---799999999999999999873379


Q ss_pred             EEECCCE-EEEEEEECC-CHHHHHHHH-HHCCEEEEEC------------CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             5504640-099987249-989999999-9689899626------------898899558986889999999999999999
Q gi|254780432|r  324 LEVRGQG-LLIGLKTVF-SPALLAAKF-RDECLLTAPS------------SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       324 ~~vRG~G-l~~~ie~~~-~~~~~~~~l-~~~Gll~~~~------------~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      .-.+-.| +++=+++.. ++..++.++ .+.||.+.|.            |.+.|||+  +.-++++|.+++++|++.++
T Consensus       319 ~~~~P~gg~ylw~~~~~~~~~~f~~~Ll~~~gV~v~PGs~F~~~~~g~~~G~g~vRl~--~a~~~e~l~eal~Rl~~~l~  396 (397)
T PRK09147        319 DVQLPDAGFYLWAKVPGGDDTAFARRLYADYNVTVLPGSYLAREAHGVNPGAGRVRIA--LVAPLAECVEAAERIVDFLR  396 (397)
T ss_pred             CCCCCCEEEEEEEECCCCCHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHC
T ss_conf             8778897359988689999899999999968999986810042334788899889999--74989999999999999972


No 160
>PRK09440 avtA valine--pyruvate transaminase; Provisional
Probab=99.62  E-value=6.5e-14  Score=111.43  Aligned_cols=331  Identities=16%  Similarity=0.200  Sum_probs=178.6

Q ss_pred             HHHCCCCCCHH--------HHHHHHHHHHHCC-------CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             74357878999--------9999999997314-------50687578189999986520101----33312356555403
Q gi|254780432|r   42 AVNSLGHSHPE--------LVAILKSQSEKLW-------HVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        42 ~~~~lGh~~p~--------i~~a~~~q~~~~~-------~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      .+.+||-+.|.        +.+|+.+.++.-.       |.++....+.++.+++.+.+..+    .+.++.++++++|.
T Consensus        31 ~vIsl~~G~P~~~p~~~~~~~~a~~~~l~~~~~~~~~~qY~~~~G~~eLReaIA~~~~~~~g~~~~pd~I~vT~Gaqqal  110 (416)
T PRK09440         31 GAIMLGGGNPAHIPEMEDYFRDLLAELLASGKLTEALGNYDGPQGKDELIEALAALLNERYGWNISPENIALTNGSQSAF  110 (416)
T ss_pred             CEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHHH
T ss_conf             84881796898889822999999999984686665447889998709999999999999848999830099848789999


Q ss_pred             HHHHHHHHHHHHCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCHHHHHHHHHCCCCC
Q ss_conf             56777665432001347--860023435465654321234553211347999864333222---1002688754101233
Q gi|254780432|r  103 ECAIKTARRYHYMAGKT--NKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQA---KFCDLQSLKNQISNDT  177 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t--~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~---~~~d~~~l~~~~~~~i  177 (392)
                      ..++++--.    .+..  .+..++...-+|.|-....+  ...  ....+.|.......-   -..|.+.++  +.+++
T Consensus       111 ~l~~~~l~~----pgd~~~~~~vl~p~~P~Y~~Y~~~~l--~~~--~~~~~~p~i~~~~~~~~~~~~d~~~l~--~~~~t  180 (416)
T PRK09440        111 FYLFNLFAG----RRADGSLKKILLPLAPEYIGYADAGL--EED--LFVSARPNIELLPEGQFKYHVDFEHLD--IDEET  180 (416)
T ss_pred             HHHHHHHCC----CCCCCCCCEEEEECCCCCCCHHHHHH--HHC--CCEECCCEEEECCCCCCCCCCCHHHHH--CCCCC
T ss_conf             999999647----67887764389726986544477775--006--500005605766875656788989971--77784


Q ss_pred             CCCCCC-CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCCCCCCC
Q ss_conf             222233-3222211246210123221102234572131011003444455531011124545302---103444444344
Q gi|254780432|r  178 AAILIE-PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMGGGFPI  253 (392)
Q Consensus       178 Aavi~E-pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~gG~P~  253 (392)
                      .++++- | +.-.|. ..+.+-+++|.++|++||+++|.||+.- .---+..|........+.++   .+||.+.-|+=+
T Consensus       181 ~~ii~~~P-~NPTG~-v~s~e~~~~l~~la~~~~i~iI~De~Y~-~~~~~~~~~~~~~~~~~~vI~~~SfSK~~~pG~Ri  257 (416)
T PRK09440        181 GAICVSRP-TNPTGN-VITDEELAKLDALARQHNIPLIIDNAYG-PPFPGIIFSEATPLWNPNIILCMSLSKLGLPGVRC  257 (416)
T ss_pred             EEEEECCC-CCCCCC-CCCHHHHHHHHHHHHHCCEEEEEECCCC-CCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCE
T ss_conf             39997789-899887-7889999999999998795899978987-77876331556766789889974511202865425


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHH-CCHHHHH---H-HHHHHHCCCEEEEE-C
Q ss_conf             321000111222223322345321111001233455432012221011210-0002688---9-99988679707550-4
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI-AKILFEG---L-TAIKNRFPNMFLEV-R  327 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~-g~~l~~~---L-~~l~~~~~~~v~~v-R  327 (392)
                      |-+++.+++++.+.......+...+.++-+++.+.|+   +..+.+...+. -+..+++   + +.+.+..++....+ +
T Consensus       258 G~~vap~~~i~~l~~~~~~~~~~~~~~~Q~~a~~~l~---~~~~~~~~~~~~r~~y~~rr~~~~~~L~~~l~~~~~~~~~  334 (416)
T PRK09440        258 GIVIANEEIIEALTNMNGIISLAPGRLGPAIAAELIE---SGDLLRLSETVIRPFYRQKVQLAIALLRRALPDLPCLIHK  334 (416)
T ss_pred             EEEECCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH---CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             8996899999999999976348856999999999997---7968999999999999999999999999857898148857


Q ss_pred             CCE-EEEEEEEC---CCHHHHHHHHHHCCEEEEEC-------------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             640-09998724---99899999999689899626-------------89889955898688999999999999999985
Q gi|254780432|r  328 GQG-LLIGLKTV---FSPALLAAKFRDECLLTAPS-------------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       328 G~G-l~~~ie~~---~~~~~~~~~l~~~Gll~~~~-------------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      -.| +++=+.+.   .+...+.+.+.++||.+.|.             +.+.|||+  +.-++++|++++++|.++++++
T Consensus       335 P~Ggff~wv~~p~~~~~~~~l~~~l~e~gV~vvPG~~F~~g~~~~~~~~~~~lRls--fa~~~e~i~egi~RLa~~i~~~  412 (416)
T PRK09440        335 PEGAIFLWLWFKDLPITTEELYQRLKARGVLIVPGHYFFPGLDEPWPHTHQCIRMS--YVQDDEEIEKGIAILAEEVEKA  412 (416)
T ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHCCEEEEECHHHCCCCCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHH
T ss_conf             98246999988999989999999999799799826431799987655778869998--2799999999999999999999


No 161
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type. Members of this family are the NifS-like cysteine desulfurase of the epsilon division of the Proteobacteria, similar to the NifS protein of nitrogen-fixing bacteria. Like NifS, and unlike IscS, this protein is found as part of a system of just two proteins, a cysteine desulfurase and a scaffold, for iron-sulfur cluster biosynthesis. This protein is called NifS by Olsen, et al. (PMID:11123951), so we use this designation.
Probab=99.61  E-value=7.6e-14  Score=110.97  Aligned_cols=323  Identities=18%  Similarity=0.201  Sum_probs=185.1

Q ss_pred             EEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH-------HHHHHHC---CCCCCCCCCCCCCCHH
Q ss_conf             46410226743578789999999999997314506875781899999-------8652010---1333123565554035
Q gi|254780432|r   34 FLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFA-------NHLIHST---FADRVFFTNSGAESVE  103 (392)
Q Consensus        34 yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la-------~~L~~~~---~~~~v~f~~SGseA~e  103 (392)
                      |+|-.+.      -.-+|++++++.+.+.+.+. ++...|....+..       +++.+..   +.+.+.|+.++|||+-
T Consensus         2 YLD~aAt------t~~~~~Vi~~~~~~~~~~~~-Np~s~h~~~~~a~~~~e~aR~~ia~~l~a~~~~eIvFTsg~Tea~N   74 (382)
T TIGR03403         2 YLDNNAT------TMLDPKVKELMDPFFCDIYG-NPNSLHQFGTATHPAIAEALDKLYKGINARDLDDIIITSCATESNN   74 (382)
T ss_pred             CCCCCCC------CCCCHHHHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHHH
T ss_conf             4637356------89999999999999986689-9632539999999999999999999759699786999387589999


Q ss_pred             HHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             67776-65432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  104 CAIKT-ARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       104 ~Aikl-ar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      .+++- ++.+  .. ..+++.||+.. .=|-.-...+    ..-.+.++.-..-+++....-|++.+++.+.+++..|.+
T Consensus        75 ~~~~gl~~~~--~~-~~~~~~ii~s~-~EH~sv~~~~----~~l~~~G~~v~~~~~d~~G~~d~~~l~~~l~~~T~LVai  146 (382)
T TIGR03403        75 WVLKGVYFDE--IL-KGGKNHIITTE-VEHPAVRATC----AFLESLGVEVTYLPINEQGTITAEQVREAITEKTALVSV  146 (382)
T ss_pred             HHHHHHHHHH--HH-CCCCCEEEEEC-CCCHHHHHHH----HHHHHCCCEEEEECCCCCCCCCHHHHHHHCCCCCCEEEE
T ss_conf             9999999998--63-68999999955-6515389999----999965978999775999858899999760146606776


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCC-CCCCCCCC
Q ss_conf             33222211246210123221102234572131011003444455531011124545302103--4444443-44321000
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA--KGMGGGF-PIGACLAT  259 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g--K~l~gG~-P~sav~~~  259 (392)
                      --+.++-|.+.|    ++.+.++|+++|+++++|=+|+ +|+.  .+-.+.+  ..|+++++  | +. |- =+|++..+
T Consensus       147 ~~anN~tG~i~p----v~~I~~~~~~~g~~~~vDa~Q~-~g~~--pidv~~l--~~D~l~~S~HK-~~-GP~GiG~L~ir  215 (382)
T TIGR03403       147 MWANNETGMIFP----IKEIGEICKERGVLFHTDAVQA-IGKI--PVDVQKA--GVDFLSFSAHK-FH-GPKGVGGLYIR  215 (382)
T ss_pred             ECCCCCCCCCCC----HHHHHHHHHHCCCEEEEEHHHH-CCCC--CCCCCCC--CCCEEEEEHHH-CC-CCCCEEEEEEC
T ss_conf             314767777787----9999999987298799671341-3564--6432323--46524531010-36-88834999986


Q ss_pred             CCCCCCCCCCCC---------CCCCCCCCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEE--EE-
Q ss_conf             111222223322---------34532111100123345543201--22210112100002688999988679707--55-
Q gi|254780432|r  260 NEVAACMNQGSH---------GSTYGGNVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMF--LE-  325 (392)
Q Consensus       260 ~~i~~~~~~~~~---------~~T~~gnpl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v--~~-  325 (392)
                      +++  .+.|..+         ++|.  |..++++..+++++..+  +...++++++.++|.++|+++    |++.  .+ 
T Consensus       216 ~~~--~l~P~~~Gg~~~~~~r~GT~--n~~~i~~l~~A~~~~~~~~~~~~~~~~~L~~~l~~~L~~i----~~~~i~g~~  287 (382)
T TIGR03403       216 KGV--ELTPLFHGGEHMGGRRSGTL--NVPYIVAMGEAMRLANEYLDFEKSHVRRLRDRLEDALLEL----PDVFVVGDR  287 (382)
T ss_pred             CCC--CCCCCCCCCCCCCCCCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC----CCCEEECCH
T ss_conf             777--65876589877476127986--7889999999999999989999999999999999999817----794671683


Q ss_pred             -ECCC-EEEEEEEECCCHHHHHHHHHHCCEEEEEC-----------------------CCCEEEECCCCCCCHHHHHHHH
Q ss_conf             -0464-00999872499899999999689899626-----------------------8988995589868899999999
Q gi|254780432|r  326 -VRGQ-GLLIGLKTVFSPALLAAKFRDECLLTAPS-----------------------SDNVVRILPPLTITAEEIHEGL  380 (392)
Q Consensus       326 -vRG~-Gl~~~ie~~~~~~~~~~~l~~~Gll~~~~-----------------------~~~~irl~Ppl~it~~eid~~i  380 (392)
                       -|-- -+.+.++. .++..+...|-++|+.+...                       ....||++....-|++|||+++
T Consensus       288 ~~r~p~~~~~~~~~-i~~~~~~~~L~~~gI~v~~GsaCas~~~~~s~vl~a~g~~~~~~~~~vR~S~~~ynT~eeId~~i  366 (382)
T TIGR03403       288 EHRVPNTILISIKG-VEGEAMLWDLNKAGIAASTGSACASEDLEANPVMVAIGADKELAHTAIRLSLSRFTTEEEIDYTI  366 (382)
T ss_pred             HHCCCCEEEEECCC-CCHHHHHHHHCCCCEEEECHHHHCCCCCCCCHHHHHCCCCHHHCCCEEEEECCCCCCHHHHHHHH
T ss_conf             32588579862799-89899999847099799755772899887589999719985445957999758999999999999


Q ss_pred             HHHHHHHHHHC
Q ss_conf             99999999852
Q gi|254780432|r  381 ERIERTAIKLS  391 (392)
Q Consensus       381 ~~l~~al~~L~  391 (392)
                      +.|.+++.+|-
T Consensus       367 ~~l~~~v~~lr  377 (382)
T TIGR03403       367 EVFKKAVQRLR  377 (382)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999998


No 162
>cd00609 AAT_like Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of  the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary hi
Probab=99.61  E-value=6.9e-14  Score=111.25  Aligned_cols=315  Identities=18%  Similarity=0.216  Sum_probs=179.6

Q ss_pred             CHHHHHHHHHHHHH---CCCCCCCCCCHHHHHHHHHHHHHC----CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             99999999999973---145068757818999998652010----13331235655540356777665432001347860
Q gi|254780432|r   50 HPELVAILKSQSEK---LWHVSNLYQSTQQEIFANHLIHST----FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKF  122 (392)
Q Consensus        50 ~p~i~~a~~~q~~~---~~~~~~~~~~~~~~~la~~L~~~~----~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~  122 (392)
                      .|.+.+++.+....   ..+.......+.+..+++.+....    ..+.+.+++++++|...+++..-       .+| .
T Consensus        13 ~~~~~~~~~~~~~~~~~~~y~~~~g~~~lr~aia~~~~~~~~~~~~~~~I~it~G~~~al~~~~~~l~-------~~g-d   84 (350)
T cd00609          13 PPEVLEALAAAALRAGLLGYYPDPGLPELREAIAEWLGRRGGVDVPPEEIVVTNGAQEALSLLLRALL-------NPG-D   84 (350)
T ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEEECCHHHHHHHHHHHHC-------CCC-C
T ss_conf             99999999999747467587999881999999999987873899747978992699999999999980-------898-9


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             02343546565432123455321134799986433322210026887541012332222333222211246210123221
Q gi|254780432|r  123 RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQL  202 (392)
Q Consensus       123 ~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~Epv~g~~G~~~~~~~~l~~l  202 (392)
                      +|+...-+|.+....+... |....   .-|..+  +.....+.+.++....+++.++++-+-+.--|. ..+.+-+++|
T Consensus        85 ~vlv~~P~y~~~~~~~~~~-g~~~~---~v~~~~--~~~~~~~~~~~~~~~~~~~~~v~l~~P~NPtG~-~~~~~~l~~l  157 (350)
T cd00609          85 EVLVPDPTYPGYEAAARLA-GAEVV---PVPLDE--EGGFLLDLELLEAAKTPKTKLLYLNNPNNPTGA-VLSEEELEEL  157 (350)
T ss_pred             EEEEECCCCCHHHHHHHHC-CCCCC---CCCCCC--CCCCCCCHHHHHHHCCCCCCEEEECCCCCCCCC-CCCHHHHHHH
T ss_conf             8999479863069999982-99412---556560--038676689999856889978985699497254-6337889899


Q ss_pred             HCCCCCCCCEEEECCCCCCCCCCCCCCCC-CCCCCCCC--E--EECCCCCC-CCCCCCCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             10223457213101100344445553101-11245453--0--21034444-4434432100011-12222233223453
Q gi|254780432|r  203 RKICDDIDALLIFDEVQTGYGRTGKLFAY-EWANVKPD--I--MTIAKGMG-GGFPIGACLATNE-VAACMNQGSHGSTY  275 (392)
Q Consensus       203 ~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~~gi~PD--i--~~~gK~l~-gG~P~sav~~~~~-i~~~~~~~~~~~T~  275 (392)
                      .++|++||+++|.||+...|.-.+..... ...+ .+|  |  -.+||.++ .|+-+|.+++.++ +.+.+.........
T Consensus       158 ~~~a~~~~~~ii~De~Y~~~~~~~~~~~~~~~~~-~~~~~i~~~S~SK~~~l~GlRiG~~~~~~~~~~~~~~~~~~~~~~  236 (350)
T cd00609         158 AELAKKHGILIISDEAYAELVYDGEPPPALALLD-AYERVIVLRSFSKTFGLPGLRIGYLIAPPEELLERLKKLLPYTTS  236 (350)
T ss_pred             HHHHHHCCCEEEEECCCHHHCCCCCCCCHHHHCC-CCCEEEEEECCCCCCCCCCCCEEEEEECHHHHHHHHHHHCCCCCC
T ss_conf             9998623862688534122036998889678557-798089991172303794537799998889999999862421467


Q ss_pred             CCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEEC-CCEEEEEEEECC--CHHHHHHHHHHCC
Q ss_conf             2111100123345543201222101121000026889999886797075504-640099987249--9899999999689
Q gi|254780432|r  276 GGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVR-GQGLLIGLKTVF--SPALLAAKFRDEC  352 (392)
Q Consensus       276 ~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vR-G~Gl~~~ie~~~--~~~~~~~~l~~~G  352 (392)
                      ..++++..++.+.++--  ++.+++.++.-+.-++.+.+...+++... .+. ..|.++-+++..  +...+.+.+.++|
T Consensus       237 ~~~~~~q~~~~~~l~~~--~~~~~~~~~~~~~~~~~l~~~l~~~~~~~-~~~p~~g~f~~~~~~~~~~~~~~~~~l~~~g  313 (350)
T cd00609         237 GPSTLSQAAAAAALDDG--EEHLEELRERYRRRRDALLEALKELGPLV-VVKPSGGFFLWLDLPEGDDEEFLERLLLEAG  313 (350)
T ss_pred             CCCHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHHHHHHHCCCCE-EECCCCCEEEEEECCCCCHHHHHHHHHHHCC
T ss_conf             89879999999998682--99999999999999999999998579961-2079955399898999982999999999799


Q ss_pred             EEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             899626------898899558986889999999999999
Q gi|254780432|r  353 LLTAPS------SDNVVRILPPLTITAEEIHEGLERIER  385 (392)
Q Consensus       353 ll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~  385 (392)
                      +++.+.      +++.+|+.  +..+++++++++++|.+
T Consensus       314 v~v~~g~~f~~~~~~~iRl~--~~~~~~~~~~~~~rl~~  350 (350)
T cd00609         314 VVVRPGSAFGEGGEGFVRLS--FATPEEELEEALERLAE  350 (350)
T ss_pred             EEEEECHHHCCCCCCEEEEE--ECCCHHHHHHHHHHHCC
T ss_conf             99992456488998979999--63989999999998578


No 163
>PRK09082 putative aminotransferase; Validated
Probab=99.61  E-value=4.2e-14  Score=112.64  Aligned_cols=325  Identities=16%  Similarity=0.157  Sum_probs=189.4

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCHHHHHHHHHHHHHCC----CC-CCCCCCCCCCCHHH
Q ss_conf             7646410226743578789999999999997314--50687578189999986520101----33-31235655540356
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW--HVSNLYQSTQQEIFANHLIHSTF----AD-RVFFTNSGAESVEC  104 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~--~~~~~~~~~~~~~la~~L~~~~~----~~-~v~f~~SGseA~e~  104 (392)
                      +..||+.-|  .-.+ .-+|.|++|++++++...  |+......+.+..+|+++.+..+    .+ .++.++++++|...
T Consensus        30 ~~~I~L~~G--~Pd~-~~P~~i~~a~~~a~~~~~~~Y~~~~G~~~LReaiA~~~~~~~g~~~~p~~eI~vT~Ga~~al~~  106 (386)
T PRK09082         30 HGAINLSQG--FPDF-DGPPRLVEALAYAMAAGHNQYPPMTGVAALREAIADKTARLYGRRYDADSEITVTAGATEALFA  106 (386)
T ss_pred             CCCEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEECCCHHHHHHH
T ss_conf             998872798--9999-8789999999999965999898987719999999999999968998988838987788999999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             77766543200134786002343546565432123455321134799986433322210026887541012332222333
Q gi|254780432|r  105 AIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP  184 (392)
Q Consensus       105 Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~Ep  184 (392)
                      +++..-       .+| +.||..+-+|.+.........+.+..-    |..++  . .-.|++.+++.+.+++-++++-.
T Consensus       107 ~~~al~-------~pG-D~Vlv~~P~Y~~y~~~~~~~G~~~v~v----pl~~~--~-~~~d~~~l~~~i~~~tk~iil~s  171 (386)
T PRK09082        107 AILALV-------RPG-DEVIVFDPSYDSYAPAIELAGGRAVRV----ALQPP--D-FRVDWQRFAAAITPRTRLIILNT  171 (386)
T ss_pred             HHHHHC-------CCC-CEEEEECCCCHHHHHHHHHCCCEEEEE----CCCCC--C-CCCCHHHHHHHCCCCCEEEEECC
T ss_conf             999975-------999-989992686287999999849989992----67798--8-88799999963675764999799


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC--CCCCCCCC---EEECCCCCC-CCCCCCCCCC
Q ss_conf             22221124621012322110223457213101100344445553101--11245453---021034444-4434432100
Q gi|254780432|r  185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY--EWANVKPD---IMTIAKGMG-GGFPIGACLA  258 (392)
Q Consensus       185 v~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~--e~~gi~PD---i~~~gK~l~-gG~P~sav~~  258 (392)
                      =+.-.|. ..+++-+++|.++|++||+++|.||+...+.-.|+.+.+  ...+...-   +-.+||.++ .|+=+|.+++
T Consensus       172 P~NPTG~-v~s~~~l~~l~~la~~~~i~ii~DE~Y~~l~~d~~~~~s~~~~~~~~~~~i~i~S~SK~~~~~G~RiG~~v~  250 (386)
T PRK09082        172 PHNPSGT-VWSAADMDALAQLIAGTDILVLSDEVYEHIVFDGQGHASVLRHPELRERAFVVSSFGKTYHVTGWKVGYCVA  250 (386)
T ss_pred             CCCCCCC-CCCHHHHHHHHHHHHHCCCEEEECCCHHHHCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             9697360-136355999999999819479711222331138988868444865334544432444245787510599987


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC----HHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEE-E
Q ss_conf             01112222233223453211110012334554320122210----112100002688999988679707550464009-9
Q gi|254780432|r  259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE----NVINIAKILFEGLTAIKNRFPNMFLEVRGQGLL-I  333 (392)
Q Consensus       259 ~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~----~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~-~  333 (392)
                      .+++.+.+.......++..+...-.++.+.|+.-  ++.++    ..+++-+.+.+.|++    . . +.-+...|.+ +
T Consensus       251 p~~l~~~~~~~~~~~~~~~~~~~Q~a~a~~l~~~--~~~~~~~~~~y~~rrd~l~~~L~~----~-~-~~~~~~~G~~f~  322 (386)
T PRK09082        251 PAALSAEFRKVHQYNTFTVNTPAQLALADYLRAE--PEHYLELPAFYQAKRDRFRAALAN----S-R-FKLLPCEGTYFQ  322 (386)
T ss_pred             CHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHH----C-C-CEEECCCCEEEE
T ss_conf             8999999999998645787689999999999669--589999999999999999999986----7-9-888479925999


Q ss_pred             EEEEC----CCHHHHHHH-HHHCCEEEEEC--------CCCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             98724----998999999-99689899626--------898899558986889999999999999
Q gi|254780432|r  334 GLKTV----FSPALLAAK-FRDECLLTAPS--------SDNVVRILPPLTITAEEIHEGLERIER  385 (392)
Q Consensus       334 ~ie~~----~~~~~~~~~-l~~~Gll~~~~--------~~~~irl~Ppl~it~~eid~~i~~l~~  385 (392)
                      -+++.    .++..++++ +.+.||.+.|.        +.+.|||+  |..++++|++++++|.+
T Consensus       323 ~~~~~~~~~~~~~~f~~~l~~e~gV~v~PG~~F~~~~~~~~~iRl~--fa~~~e~l~ea~~RLak  385 (386)
T PRK09082        323 LVDYSAISDLNDVEFCQWLTREHGVAAIPLSVFYADPFPHRLVRFC--FAKQEETLDAAAERLCQ  385 (386)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHH
T ss_conf             8860348998999999999985899998271105799999979999--68999999999999842


No 164
>cd06502 TA_like Low-specificity threonine aldolase (TA). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I).  TA catalyzes the conversion of L-threonine or L-allo-threonine to glycine and acetaldehyde in a secondary glycine biosynthetic pathway.
Probab=99.59  E-value=1.5e-14  Score=115.63  Aligned_cols=305  Identities=17%  Similarity=0.206  Sum_probs=172.8

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCCCC-HHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             57878999999999999731450687578-18999998652010133312356555403567776654320013478600
Q gi|254780432|r   45 SLGHSHPELVAILKSQSEKLWHVSNLYQS-TQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR  123 (392)
Q Consensus        45 ~lGh~~p~i~~a~~~q~~~~~~~~~~~~~-~~~~~la~~L~~~~~~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~  123 (392)
                      +.-.-||+|.+||.++-  ...  ..|.. +...+|.+++.+..+.+.++|+.|||.||-.||+..-+       ++.. 
T Consensus         6 t~t~p~p~m~~A~~~A~--~gd--~~yg~D~~~~~le~~~a~l~g~eaa~f~~sGT~aN~~al~~~~~-------~~~~-   73 (338)
T cd06502           6 TVTGPTPEMLEAMAAAN--VGD--DVYGEDPTTAKLEARAAELFGKEAALFVPSGTAANQLALAAHTQ-------PGGS-   73 (338)
T ss_pred             CCCCCCHHHHHHHHCCC--CCC--CCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCC-------CCCE-
T ss_conf             18889999999998063--678--66678989999999999984898299807841899999998569-------9975-


Q ss_pred             CCCCCCCCCCCC--CCCCC-CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCC-------CCCCCCCCCCCCCCCCCCC
Q ss_conf             234354656543--21234-5532113479998643332221002688754101-------2332222333222211246
Q gi|254780432|r  124 IVTFEGAFHGRT--LATIS-AGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQIS-------NDTAAILIEPIQGEGGVRK  193 (392)
Q Consensus       124 ii~~~~~yHG~t--~~a~s-~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~-------~~iAavi~Epv~g~~G~~~  193 (392)
                      ||+-+ ..|=..  .++.+ ++|..-     .+.......   -+.+.+++.+.       ..+..|-+|-....|+  .
T Consensus        74 vi~~~-~aHi~~~E~g~~~~~~G~~~-----~~~~~~~g~---l~~~~i~~~i~~~~~~h~~~~~lv~ient~e~G~--v  142 (338)
T cd06502          74 VICHE-TAHIYTDEAGAPEFLSGVKL-----LPVPGENGK---LTPEDLEAAIRPRDDIHFPPPSLVSLENTTEGGT--V  142 (338)
T ss_pred             EEEEC-CCCEEEECCCCHHHHCCCEE-----EEEECCCCC---CCHHHHHHHHCCCCCCCCCCCEEEEEEECCCCCE--E
T ss_conf             88504-67145653773998749625-----643389997---3899999963156886466520799873128963--1


Q ss_pred             CCHHHHHHHHCCCCCCCCEEEECCCC--CCCCCCCCCCCCCCCCCCCCEE--ECCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             21012322110223457213101100--3444455531011124545302--10344444434432100-0111222223
Q gi|254780432|r  194 VPEEFLQQLRKICDDIDALLIFDEVQ--TGYGRTGKLFAYEWANVKPDIM--TIAKGMGGGFPIGACLA-TNEVAACMNQ  268 (392)
Q Consensus       194 ~~~~~l~~l~~lc~~~g~llI~DEV~--tG~GRtG~~f~~e~~gi~PDi~--~~gK~l~gG~P~sav~~-~~~i~~~~~~  268 (392)
                      +|.+.++.|+++|++||+.+-+|--.  -...-+|.  ....+.---|.+  |++|+++  .|+++|+. ++++.+.+..
T Consensus       143 ~~~~el~~i~~~a~~~gl~lH~DGARl~nA~~a~g~--~~~~~~~~~Dsvs~~~sKglg--ap~gavl~g~~~~i~~a~~  218 (338)
T cd06502         143 YPLDELKAISALAKENGLPLHLDGARLANAAAALGV--ALKTYKSGVDSVSFCLSKGGG--APVGAVVVGNRDFIARARR  218 (338)
T ss_pred             CCHHHHHHHHHHHHHCCCEEEECCCCEECEEECCCC--CHHHHHHHCCEEEEECCCCCC--CCCCEEEECCHHHHHHHHH
T ss_conf             279999999999997497266536530044541599--989986418789996656677--7432478778899999999


Q ss_pred             C--CCCCCCCCCCCCHHHHHHHHHHHHCCC---CCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCH--
Q ss_conf             3--223453211110012334554320122---210112100002688999988679707550464009998724998--
Q gi|254780432|r  269 G--SHGSTYGGNVLAMVLGEKVLNIIQSDG---FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP--  341 (392)
Q Consensus       269 ~--~~~~T~~gnpl~~aaa~a~L~~l~~~~---l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~--  341 (392)
                      .  ..|+-++-.-+-.|++++.|   +.+.   ..++...+.++|.++|+++..    .+..+. ..+.+ +.....+  
T Consensus       219 ~rK~~Gg~mrq~g~lAAa~~~~L---~~~~~~~~l~~dh~~A~~La~~l~~~~~----~~~~~e-tniv~-~~~~~~n~~  289 (338)
T cd06502         219 RRKQAGGGMRQSGFLAAAGLAAL---ENDLWLRRLRHDHEMARRLAEALEELGG----LESEVQ-TNIVL-LDPVEANAV  289 (338)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHH---HCCHHHHHHHHHHHHHHHHHHHHHHCCC----CCCCCC-CCEEE-EECCCCCHH
T ss_conf             99864753645999999999998---5483789999999999999999986799----766665-77589-832754188


Q ss_pred             ----HHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             ----99999999689899626898899558986889999999999999
Q gi|254780432|r  342 ----ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIER  385 (392)
Q Consensus       342 ----~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~  385 (392)
                          ......++++|+.+.+.+++.+||..++-+|++++|++++.|++
T Consensus       290 ~~~~~~~~~~~~~~g~~~~~~~~~~vR~Vt~~~~t~~dvd~~i~~ik~  337 (338)
T cd06502         290 FVELSKEAIERRGEGVLFYAWGEGGVRFVTHWDTTEEDVDELLSALKA  337 (338)
T ss_pred             HHHHHHHHHHHHHCCEEEEECCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             987469999999689699946999289998899999999999999962


No 165
>PRK06358 threonine-phosphate decarboxylase; Provisional
Probab=99.59  E-value=1.7e-13  Score=108.76  Aligned_cols=324  Identities=18%  Similarity=0.219  Sum_probs=188.5

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHH
Q ss_conf             799764641022674357878999999999999731450687578189999986520101--333123565554035677
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAI  106 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Ai  106 (392)
                      .+.+++|||.++  .+.+|-. |.+++|+.+.++.+..    |..+...+|-+.|.+..+  .+.+..+|+.+|+....+
T Consensus        16 ~~~~~iidls~N--eNP~g~p-~~v~~a~~~~~~~l~~----YPd~~~~~Lr~aiA~~~gv~~~~I~~gnGs~e~i~~~~   88 (354)
T PRK06358         16 LTKNMILDFSAN--INPLGVP-ESVKDAITENLDKLVE----YPDIDYLELRKRIASFEQLDLENVILGNGAAEVIFNIV   88 (354)
T ss_pred             CCCCCEEECCCC--CCCCCCC-HHHHHHHHHHHHHHCC----CCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHH
T ss_conf             694648886499--9898889-9999999998766101----89997799999999987838799998687899999999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC-CCCCCCCC
Q ss_conf             76654320013478600234354656543212345532113479998643332221002688754101233-22223332
Q gi|254780432|r  107 KTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT-AAILIEPI  185 (392)
Q Consensus       107 klar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~i-Aavi~Epv  185 (392)
                      +.   +      .++ +++....+|--....+........+    -|........  .|.+.++ .+.+++ ..+|.-|=
T Consensus        89 ~~---~------~~~-~v~i~~Ptf~~Y~~~~~~~g~~v~~----~~l~~~~~~~--~~~~~l~-~~~~~~~~v~l~nPn  151 (354)
T PRK06358         89 RV---L------KPK-KVLILAPTFSEYERALKSVDAEVIY----YELKEETNFA--INEDVLE-KITEEIDLIFLCNPN  151 (354)
T ss_pred             HH---C------CCC-EEEEECCCHHHHHHHHHHCCCEEEE----EECCCCCCCC--CCHHHHH-HCCCCCCEEEEECCC
T ss_conf             86---1------899-6999798879999999984986789----9777003888--7999997-445577789996899


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-CCCCCCCCEE---ECCCCCC-CCCCCCCCCCCC
Q ss_conf             2221124621012322110223457213101100344445553101-1124545302---1034444-443443210001
Q gi|254780432|r  186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-EWANVKPDIM---TIAKGMG-GGFPIGACLATN  260 (392)
Q Consensus       186 ~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~  260 (392)
                      .= -|. ..+.+.++.+.+.|+++++++|+||...-|..-+..... +..+--|.++   +|||..| .|+-+|..++.+
T Consensus       152 NP-TG~-~~~~~~l~~l~~~~~~~~~~vviDEaY~ef~~~~~~~s~~~~~~~~~nlivlrSfSK~~glaGlRiGy~i~~~  229 (354)
T PRK06358        152 NP-TGQ-LISKEELKKILEKCEKKNIYVIIDEAFMDFVEENETISMIKYLENFKNLIIIRAFTKFFAIPGLRLGYGLCSN  229 (354)
T ss_pred             CC-CCC-CCCHHHHHHHHHHHHCCCEEEEEECHHHHHHCCCCCCCHHHHHHHCCCEEEEEECCHHHCCCCHHEEEEEECC
T ss_conf             98-664-0679999999987201787999964056763688766678887523766899725166367662115654287


Q ss_pred             -CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECC
Q ss_conf             -1122222332234532111100123345543201222101121000026889999886797075504640099987249
Q gi|254780432|r  261 -EVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF  339 (392)
Q Consensus       261 -~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~  339 (392)
                       .+.+.+....  ..|.-|.++.+|+.++|+-   .+.+++..+.-..-++.|.+...+.+++ .-....+-++-++.. 
T Consensus       230 ~~i~~~l~~~~--~p~~vn~~a~~aa~aal~d---~~~~~~~~~~~~~~R~~l~~~L~~l~g~-~v~ps~anFvl~~~~-  302 (354)
T PRK06358        230 KNLIEKLNQMR--EPWSINTFADLAGRVLLED---KNYIKKTIQWIKKEKEFLYNGLSEFKGL-TVYEPSVNFIFFKLN-  302 (354)
T ss_pred             HHHHHHHHHCC--CCCCHHHHHHHHHHHHHCC---HHHHHHHHHHHHHHHHHHHHHHHCCCCC-EECCCCCEEEEEEEC-
T ss_conf             99999998458--9988269999999999529---9999999999999999999998749996-888998489999839-


Q ss_pred             CHHHHHHHHHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9899999999689899626------898899558986889999999999999999
Q gi|254780432|r  340 SPALLAAKFRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       340 ~~~~~~~~l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      ++..+.+.|+++|+++++.      +++.+|++   +=|.+|.+++++.|++.|.
T Consensus       303 ~~~~~~~~L~~~gIlVr~~~~f~~l~~~~iRis---vgt~~en~~ll~aL~~iL~  354 (354)
T PRK06358        303 KPIDLRKELLLKGILIRSCSNYRGLDENYYRVA---VKSREDNKKLLEALSVILS  354 (354)
T ss_pred             CHHHHHHHHHHCCCEEEECCCCCCCCCCEEEEE---ECCHHHHHHHHHHHHHHHC
T ss_conf             879999999859919997887788899979996---2899999999999999749


No 166
>PRK04152 consensus
Probab=99.59  E-value=1.6e-13  Score=108.79  Aligned_cols=321  Identities=16%  Similarity=0.213  Sum_probs=192.3

Q ss_pred             ECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHH
Q ss_conf             6799764641022674357878999999999999731450687578189999986520101--33312356555403567
Q gi|254780432|r   28 SENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECA  105 (392)
Q Consensus        28 d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~A  105 (392)
                      -.+.+++|||.++  -+.+|-. |.+.+|+++++..+.    .|..+...+|.+.+.+..+  .+.+..+|+.+|+....
T Consensus        27 g~~p~~ii~ls~N--eNP~g~p-~~~~~ai~~~~~~~~----~YPd~~~~~Lr~~iA~~~gv~~~~I~vgnGs~e~i~~~   99 (364)
T PRK04152         27 GIDPKDVIKLASN--ENPFGTS-PKVIEAIRKNASKAH----LYPDDSMFELKSALASKFDVESENIIIGAGSDQVIEFA   99 (364)
T ss_pred             CCCCCCEEEECCC--CCCCCCC-HHHHHHHHHHHHHCC----CCCCCCHHHHHHHHHHHHCCCHHEEEECCCHHHHHHHH
T ss_conf             9681247881799--9999999-999999998787376----79996799999999998695830099856999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHC-CCCCC-CCCCC
Q ss_conf             77665432001347860023435465654321234553211347999864333222100268875410-12332-22233
Q gi|254780432|r  106 IKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SNDTA-AILIE  183 (392)
Q Consensus       106 iklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~-~~~iA-avi~E  183 (392)
                      ++..-       .+| ..|+....+|-.-...+. ..|-....      .+..    ..|++.+.+.. ..+.- .+|.-
T Consensus       100 ~~~~~-------~~g-~~vl~~~Ptf~~Y~~~a~-~~g~~v~~------~~~~----~~dl~~~~~~~~~~~~~lv~l~n  160 (364)
T PRK04152        100 IHAKL-------NEK-SSVLMAGVTFAMYEIYAK-QCGAKIYK------TQSV----EHDLNEFLELYKSHKPKIIFLCL  160 (364)
T ss_pred             HHHHH-------CCC-CEEEECCCCHHHHHHHHH-HCCCEEEE------CCCC----CCCHHHHHHHHHCCCCCEEEECC
T ss_conf             99983-------899-844658987268999999-83987996------6874----33989999986377985899879


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC---CCCC-CCCCCCCCCEE---ECCCCCC-CCCCCCC
Q ss_conf             3222211246210123221102234572131011003444455---5310-11124545302---1034444-4434432
Q gi|254780432|r  184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTG---KLFA-YEWANVKPDIM---TIAKGMG-GGFPIGA  255 (392)
Q Consensus       184 pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG---~~f~-~e~~gi~PDi~---~~gK~l~-gG~P~sa  255 (392)
                      |=-= .|.. .+++-+..+.+.|.+ ++++|+||...-|....   .... .+..+--|.++   +|+|..| .|+-+|.
T Consensus       161 PNNP-TG~~-~~~~~l~~~~~~~~~-~~~vvvDEAY~ef~~~~~~~~~~~~~~l~~~~~nlivlrsfSK~~glaGlRlGy  237 (364)
T PRK04152        161 PNNP-LGEC-LDASEVYKFIKGIDE-DTLVVIDAAYMEFAKFKDSKKHIEPKELIKLFPNVIYLGTFSKAYGLGGMRVGY  237 (364)
T ss_pred             CCCC-CCCC-CCCCCHHHHHHHCCC-CCEEEEEHHHHHHHHCCCCCCCCCHHHHHHHCCCEEEEECCHHHCCCCCCCCCC
T ss_conf             9998-6724-665124999975455-776874167788860377534558899874279789983260523787773520


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEE
Q ss_conf             10001112222233223453211110012334554320122210112100002688999988679707550464009998
Q gi|254780432|r  256 CLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL  335 (392)
Q Consensus       256 v~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~i  335 (392)
                      +++.+++.+.+....  .+|+-|.++.+||.++|+   +++++++..+.-..-++++.++.... ++ .-....+-++-+
T Consensus       238 ~ia~~~~i~~l~k~~--~p~~vn~~a~~aa~~aL~---~~~~~~~~~~~~~~er~~~~~~~~~~-g~-~~~ps~aNFil~  310 (364)
T PRK04152        238 GIANAEIISALYKLR--PPFNVTTLSLKAAIEALK---DEEFVEKTLENNFKEMKRYEEFAKEQ-GI-EFIDSYTNFITF  310 (364)
T ss_pred             CCCCHHHHHHHHHHC--CCCCCCHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCCEEEE
T ss_conf             138999999999853--898867999999999937---99999999999999999999998858-88-489998878989


Q ss_pred             EE--CCCHHHHHHHHHHCCEEEEEC---CCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             72--499899999999689899626---89889955898688999999999999999
Q gi|254780432|r  336 KT--VFSPALLAAKFRDECLLTAPS---SDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       336 e~--~~~~~~~~~~l~~~Gll~~~~---~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                      .+  ..+...+.+.|+++|++++.+   +.+.+|++   +=|.+|-++++++|+++|
T Consensus       311 ~~~~~~~a~~l~~~L~~~gI~VR~~~~~g~~~iRIs---vg~~een~~li~aL~~vL  364 (364)
T PRK04152        311 FFDERKNSTEISQKLLKKGIIVRNLKSYGLNAIRIT---IGTPEQNDRVFEELDKEL  364 (364)
T ss_pred             ECCCCCCHHHHHHHHHHCCEEEEECCCCCCCEEEEE---CCCHHHHHHHHHHHHHHC
T ss_conf             899999999999999968919985798996979997---399999999999999759


No 167
>PRK07309 aromatic amino acid aminotransferase; Validated
Probab=99.58  E-value=2.1e-13  Score=108.05  Aligned_cols=332  Identities=16%  Similarity=0.212  Sum_probs=188.8

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCCCC-CCCHHHHHHHHHHHHHCC-----CCCCCCCCCCCCCH
Q ss_conf             99764641022674357878999999999999731-450687-578189999986520101-----33312356555403
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVSNL-YQSTQQEIFANHLIHSTF-----ADRVFFTNSGAESV  102 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~~~-~~~~~~~~la~~L~~~~~-----~~~v~f~~SGseA~  102 (392)
                      ++...|++.-|.  ..+ -..|+|++|+++.++.. .+++.. ...+.+..+++.+.+..+     .+.++.+++.++|.
T Consensus        28 ~~~dvI~l~ig~--pdf-~~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lr~aia~~~~~~~g~~~~p~~~I~it~G~~~al  104 (390)
T PRK07309         28 DIPGILKLTLGE--PDF-TTPEHVKEAAKAAIDANQSHYTGMAGLLELRQAAADFVKEKYNLDYAPENEILVTIGATEAL  104 (390)
T ss_pred             CCCCEEECCCCC--CCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHH
T ss_conf             899908998978--999-98899999999998479999979977499999999999998589999888799888989999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHC---CCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410---123322
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI---SNDTAA  179 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~---~~~iAa  179 (392)
                      ..+++.--       .+| ..|+..+-.|++..........+...   . |...+  .. .-|.+.+++.+   .+++-+
T Consensus       105 ~~~~~~l~-------~pG-D~Vli~~P~Y~~~~~~~~~~g~~~v~---v-~~~~~--~~-~~~~~~le~~~~~~~~k~k~  169 (390)
T PRK07309        105 SASLTAIL-------EPG-DKVLLPAPAYPGYEPIVNLVGAEIVE---I-DTTEN--DF-VLTPEMLEKAILEQGDKLKA  169 (390)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHCCCEEEE---E-CCCCC--CC-CCCHHHHHHHHHHCCCCEEE
T ss_conf             99999966-------998-98998378744199999984988999---4-46201--15-78999999998748887499


Q ss_pred             CCC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCE----EECCCCCC-CCCCC
Q ss_conf             223-3322221124621012322110223457213101100344445553101112454530----21034444-44344
Q gi|254780432|r  180 ILI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI----MTIAKGMG-GGFPI  253 (392)
Q Consensus       180 vi~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi----~~~gK~l~-gG~P~  253 (392)
                      +|+ -| +.-.| ...+.+-++++.++|++||+++|.|||..-+--.|.-+.+- ....||-    ..+||..+ .|+-+
T Consensus       170 lil~~P-~NPtG-~v~s~e~l~~i~~la~~~~v~iisDEiY~~l~~~~~~~~s~-~~~~~d~~i~~~s~SK~~~~~G~Ri  246 (390)
T PRK07309        170 VILNYP-ANPTG-VTYSREQIKALAEVLKKYDIFVISDEVYSELTYTGQSHVSI-AEYLPDQTILINGLSKSHAMTGWRI  246 (390)
T ss_pred             EEECCC-CCCCC-CCCCHHHHHHHHHHHHHCCEEEEEECCCHHCCCCCCCCCCH-HHHCCCCEEEEECCCHHHHCCCCCE
T ss_conf             997899-89988-87899999999999976898999505511101489886448-7755576799960605654046635


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC--CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCE-
Q ss_conf             321000111222223322345321111001233455432012--22101121000026889999886797075504640-
Q gi|254780432|r  254 GACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD--GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQG-  330 (392)
Q Consensus       254 sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~--~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G-  330 (392)
                      |.+++.+++++.+.......+.+.+.++..++.+.|+.-.++  .+.++..+.-+.+.+.|.++.  + .+   ++-.| 
T Consensus       247 G~i~~~~~~~~~~~~~~~~~~~~~~~~~q~a~~~al~~~~~~~~~~~~~y~~rr~~l~~~l~~~~--~-~~---~~P~gg  320 (390)
T PRK07309        247 GLIFAPAELTAQLIKSHQYLVTAATTMAQFAAVEALTNGKDDALPMKKEYIKRRDYIIEKMTALG--F-KI---IKPDGA  320 (390)
T ss_pred             EEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCC--C-CC---CCCCEE
T ss_conf             89974999999999998653057874999999999974827899999999999999999998627--8-63---389800


Q ss_pred             EEEEEEEC----CCHHHHHHH-HHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             09998724----998999999-99689899626------89889955898688999999999999999985
Q gi|254780432|r  331 LLIGLKTV----FSPALLAAK-FRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       331 l~~~ie~~----~~~~~~~~~-l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +++=+++.    .+...++.. +.+.||.+.|.      +++.+|+.  +..++++|++++++|.+++.|=
T Consensus       321 ~ylw~~lp~~~~~d~~~~~~~l~~~~gV~v~PG~~Fg~~g~g~iRl~--~a~~~e~l~eal~Rl~~~l~e~  389 (390)
T PRK07309        321 FYIFAKIPAGYNQDSFKFLQDFAKEKAVAIIPGVAFGPYGEGYVRLS--YAASMETIKEAMKRLKEYMEEH  389 (390)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHC
T ss_conf             69807457899989999999999969999977732288999879999--8289999999999999999971


No 168
>PRK08363 alanine aminotransferase; Validated
Probab=99.58  E-value=6.5e-13  Score=104.91  Aligned_cols=335  Identities=15%  Similarity=0.141  Sum_probs=187.2

Q ss_pred             CCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHCC-CCCC-CCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCC
Q ss_conf             79976464102267435787-89999999999997314-5068-7578189999986520101----3331235655540
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKLW-HVSN-LYQSTQQEIFANHLIHSTF----ADRVFFTNSGAES  101 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~~-~~~~-~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA  101 (392)
                      ..|++.||+.-|-- +.... -.+.|++|+.++++... +++. ....+.+..+++.+.+..+    .|.++.++++++|
T Consensus        27 ~~G~~vi~l~iG~P-~~~df~~p~~i~~a~~~a~~~~~~~Y~~~~G~~~LR~aia~~~~~~~g~~~~pd~I~vt~G~~~a  105 (398)
T PRK08363         27 KKGIKVIRLNIGDP-VKFDFQPPEHMKEAYCRAIKEGHNYYGPSEGLPELREAIVKREKRKNGVDITPDDVRVTNAVTEA  105 (398)
T ss_pred             HCCCCEEECCCCCC-CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHH
T ss_conf             77997068569899-97899989999999999997189988998875999999999999986899866888985778999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             35677766543200134786002343546565432123455321134799986433322210026887541012332222
Q gi|254780432|r  102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL  181 (392)
Q Consensus       102 ~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi  181 (392)
                      ...+++.--       .+| ..|+..+-+|..-........+.+..   + +..+  ..-...|++++++.+.+++-+++
T Consensus       106 l~~~~~~l~-------~pG-D~Vlvp~P~Y~~y~~~~~~~g~~~v~---~-~~~~--~~~~~~d~~~l~~~i~~~tk~i~  171 (398)
T PRK08363        106 LQMLFGALL-------DPG-DEILIPGPSYPPYTGLVKFYGGVPVE---Y-RTIE--EEGWQPDIDDIRKKITEKTKAIA  171 (398)
T ss_pred             HHHHHHHHC-------CCC-CEEEECCCCCCCHHHHHHHCCCEEEC---C-CCCC--CCCCCCCHHHHHHHCCCCCEEEE
T ss_conf             999999966-------998-98998667567438999983997843---6-8862--14896899999975311372999


Q ss_pred             C-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCC-CCCCCCEE--ECCCCCC-CCCCCCCC
Q ss_conf             3-332222112462101232211022345721310110034444555310111-24545302--1034444-44344321
Q gi|254780432|r  182 I-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW-ANVKPDIM--TIAKGMG-GGFPIGAC  256 (392)
Q Consensus       182 ~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~-~gi~PDi~--~~gK~l~-gG~P~sav  256 (392)
                      + -| ..--|. ..+++.++++.++|++||+++|.||+...+---|++..... .+-.+=|+  .+||..+ .|+=+|-+
T Consensus       172 l~nP-~NPTG~-v~s~~~l~~i~~la~~~~~~vIsDEiY~~l~~~~~~~s~~~~~~~~~vi~i~s~SK~~~~~G~RiG~i  249 (398)
T PRK08363        172 VINP-NNPTGA-LYDKKTLKEILDIAGEHDLPVISDEIYDLMTYEGKHVSPGSLTKDVPVIVMNGLSKVYFATGWRLGYI  249 (398)
T ss_pred             ECCC-CCCCCC-CCCHHHHHHHHHHHHHCCCEEECHHHHHHHCCCCCCCCHHHHCCCCCEEEEECCCCCCCCCCCCEEEE
T ss_conf             8799-998888-65488999999998755964761334666416998779778286778899825503047856136999


Q ss_pred             CC--CCCCCCCCCCC--CCCCC-CCCCCCCHHHHHHHHHHHHCCCCC----CHHHHHCCHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             00--01112222233--22345-321111001233455432012221----01121000026889999886797075504
Q gi|254780432|r  257 LA--TNEVAACMNQG--SHGST-YGGNVLAMVLGEKVLNIIQSDGFL----ENVINIAKILFEGLTAIKNRFPNMFLEVR  327 (392)
Q Consensus       257 ~~--~~~i~~~~~~~--~~~~T-~~gnpl~~aaa~a~L~~l~~~~l~----~~~~~~g~~l~~~L~~l~~~~~~~v~~vR  327 (392)
                      +.  .++..+.+...  ...++ ...+...-.++.+.++.  .++.+    ++.+++-+.+.+.|+    +.|+ +.-+.
T Consensus       250 ~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~Q~a~~~al~~--~~~~~~~~~~~~~~rrd~~~~~L~----~~~g-~~~~~  322 (398)
T PRK08363        250 YFVDPEGKLDEVREALDKLARIRLCPNTPAQFAAIAGLTG--PMDYLEEYMKKLKERRDYIYKRLN----EIPG-ISTTK  322 (398)
T ss_pred             EEECCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHHHHHHHHH----HCCC-CEECC
T ss_conf             9758389999999999998550647773999999999866--877899999999999999999997----1799-57558


Q ss_pred             CCEEEEEE-EEC----CCHHHHHHH-HHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             64009998-724----998999999-99689899626------8988995589868899999999999999998
Q gi|254780432|r  328 GQGLLIGL-KTV----FSPALLAAK-FRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       328 G~Gl~~~i-e~~----~~~~~~~~~-l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      -.|.+... .+.    .++..++.+ +.+.||.+.|.      +.+.+||+  |..++++|++++++|++.+++
T Consensus       323 P~G~~y~~~~l~~~~~~~~~ef~~~ll~e~gV~v~PG~~Fg~~g~g~vRls--f~~~~e~l~eal~Rl~~~l~~  394 (398)
T PRK08363        323 PQGAFYIFPRIEEGPWKDDKEFVLDLLHEAHVLFVHGSGFGEYGAGHFRLV--FLPPVEILEEAMDRFEEFMRE  394 (398)
T ss_pred             CCEEEEEEEECCCCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHH
T ss_conf             887889837878889999999999999859999989643288999869999--838999999999999999999


No 169
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase. This family of actinobacterial succinyldiaminopimelate transaminase enzymes (DapC) are members of the pfam00155 superfamily. Many of these genes appear adjacent to other genes encoding enzymes of the lysine biosynthesis via diaminopimelate pathway (GenProp0125).
Probab=99.57  E-value=2.3e-13  Score=107.88  Aligned_cols=314  Identities=15%  Similarity=0.096  Sum_probs=180.0

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC-----CCCCCCCCCCCCCHH
Q ss_conf             799764641022674357878999999999999731450687578189999986520101-----333123565554035
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF-----ADRVFFTNSGAESVE  103 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~-----~~~v~f~~SGseA~e  103 (392)
                      ..|...||+.-|   .+-.-..|.|++|+++.++...|.......+.+.++++.+.+..+     .+.++.+++++||..
T Consensus        18 ~~~~~vI~L~iG---~Pd~p~p~~i~~a~~~a~~~~~Y~~~~G~~eLReaia~~~~~~~g~~~~~~~~I~vt~G~~~al~   94 (357)
T TIGR03539        18 SHPDGIVDLSVG---TPVDPVPPLIRAALAAAADAPGYPQTWGTPELREAIVDWLERRRGVPGLDPTAVLPVIGTKELVA   94 (357)
T ss_pred             HCCCCEEECCCC---CCCCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEECCCHHHHHH
T ss_conf             689992888799---99999899999999971247998998477999999999999971999799575998688799999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-
Q ss_conf             6777665432001347860023435465654321234553211347999864333222100268875410123322223-
Q gi|254780432|r  104 CAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI-  182 (392)
Q Consensus       104 ~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~-  182 (392)
                      ....+.-      -.+|. .||..+-+|......+....+.+               +..++   +.+...+++.++++ 
T Consensus        95 ~l~~~l~------~~pGD-~Vli~~P~y~~y~~~~~~~g~~~---------------v~~d~---~~~~~~~~~k~i~l~  149 (357)
T TIGR03539        95 WLPTLLG------LGPGD-TVVIPELAYPTYEVGALLAGATP---------------VAADD---PTELDPVGPDLIWLN  149 (357)
T ss_pred             HHHHHHH------CCCCC-EEEECCCCCCCHHHHHHHCCCEE---------------EECCC---HHHCCCCCCEEEEEC
T ss_conf             9999970------79999-89978887700899999859989---------------82388---666797785499989


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCC----CCCCCCEE---ECCCCCC-CCCCCC
Q ss_conf             332222112462101232211022345721310110034444555310111----24545302---1034444-443443
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW----ANVKPDIM---TIAKGMG-GGFPIG  254 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~----~gi~PDi~---~~gK~l~-gG~P~s  254 (392)
                      -| +.-.|. ..+++.+++|.++|++||+++|.||+...|.--|+....-.    .+-.+.++   .+||..+ .|+=+|
T Consensus       150 ~P-~NPTG~-v~s~~~l~~l~~~a~~~~i~visDEiY~~~~~~~~~~s~l~~~~~~~~~~~~i~~~S~SK~~~~~G~RiG  227 (357)
T TIGR03539       150 SP-GNPTGR-VLSVDELRAIVAWARERGAVVASDECYLELGWEGRPVSILDPRVCGGDHTGLLAVHSLSKRSNLAGYRAG  227 (357)
T ss_pred             CC-CCCCHH-CCCHHHHHHHHHHCCCCEEEEECHHHHHHHCCCCCCCCCCCHHHCCCCCCCEEEEEECCCCCCCCCCEEE
T ss_conf             99-896232-0828899999873205558995233247653589884302864537675767999615310045561289


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH----HHHHCCHHHHHHHHHHHHCCCEEEEECCCE
Q ss_conf             2100011122222332234532111100123345543201222101----121000026889999886797075504640
Q gi|254780432|r  255 ACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN----VINIAKILFEGLTAIKNRFPNMFLEVRGQG  330 (392)
Q Consensus       255 av~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~----~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G  330 (392)
                      .+++.+++.+.+.......++..+...-+++.+.|+   +++.+..    .++.-+.+.+.|    ++ +++ .-.+..|
T Consensus       228 ~~~~~~~li~~l~~~~~~~~~~~~~~~q~a~~~al~---~~~~~~~~~~~~~~rr~~l~~~L----~~-~g~-~~~~p~g  298 (357)
T TIGR03539       228 FVAGDPALVAELLTVRKHAGLMVPAPVQAAMVAALG---DDGHVAEQKARYAARRAQLKPAL----EK-AGF-RIDHSEA  298 (357)
T ss_pred             EEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC---CCHHHHHHHHHHHHHHHHHHHHH----HH-CCC-EECCCCE
T ss_conf             996799999999999985677788999999999956---92789999999999999999999----85-797-7626880


Q ss_pred             EEEE-EEECCCHHHHHHHHHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             0999-872499899999999689899626------8988995589868899999999999
Q gi|254780432|r  331 LLIG-LKTVFSPALLAAKFRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERI  383 (392)
Q Consensus       331 l~~~-ie~~~~~~~~~~~l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l  383 (392)
                      -|+. .....+.....+.+.++||.+.|.      +.+.+|++  +..++++|.+++++|
T Consensus       299 ~~y~~~~~~~~~~~~~~~l~e~gV~v~PG~~Fg~~g~~~vRis--~~~~~e~l~eal~Rl  356 (357)
T TIGR03539       299 GLYLWATRGEDAWDTVDRLAELGILVAPGDFYGPAGSQHVRVA--LTATDERIAAAVARL  356 (357)
T ss_pred             EEEEEEECCCCHHHHHHHHHHCCEEEECCCCCCCCCCCEEEEE--ECCCHHHHHHHHHHC
T ss_conf             6999875899999999999969989947874478999979999--729999999999857


No 170
>PRK01533 histidinol-phosphate aminotransferase; Validated
Probab=99.56  E-value=7.9e-13  Score=104.32  Aligned_cols=320  Identities=18%  Similarity=0.205  Sum_probs=199.8

Q ss_pred             CCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHH
Q ss_conf             9764641022674357878999999999999731450687578189999986520101--33312356555403567776
Q gi|254780432|r   31 GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKT  108 (392)
Q Consensus        31 G~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aikl  108 (392)
                      .+++||+.++  -+.+|-. |.+++|+.+++...    +.|..+...+|-+.|.+..+  .+.+..+|+.+|+...+++.
T Consensus        28 ~~~~ikLssN--ENP~g~s-~~v~~al~~~~~~~----~~YPd~~~~~Lr~~iA~~~gv~~e~I~vgnGs~E~i~~~~~a  100 (366)
T PRK01533         28 DHSFVKLASN--ENPFGCS-PRVLDELQKSWLDH----ALYPDGGATTLRQTIANKLHVKMEQVLCGSGLDEVIQIISRA  100 (366)
T ss_pred             CCCEEEEECC--CCCCCCC-HHHHHHHHHHHHHC----CCCCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHHH
T ss_conf             8876995089--9999999-99999999878745----579697789999999998682821299817899999999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC-CCCCCCC
Q ss_conf             654320013478600234354656543212345532113479998643332221002688754101233222-2333222
Q gi|254780432|r  109 ARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI-LIEPIQG  187 (392)
Q Consensus       109 ar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav-i~Epv~g  187 (392)
                      .-       .+| +.|+....+|-.-...+. +.|-....-   |...     ...|++.+.+.+.++...+ |.-|=.=
T Consensus       101 ~~-------~~g-d~vl~~~Ptf~~Y~~~a~-~~g~~~~~v---~l~~-----~~~d~~~i~~~~~~~~klv~l~nPNNP  163 (366)
T PRK01533        101 VL-------KAG-DNIVTAGATFPQYRHHAI-IEGCEVKEV---ALNN-----GVYDLDEISSVVDNDTKIVWICNPNNP  163 (366)
T ss_pred             HH-------CCC-CEEEECCCCCCHHHHHHH-HCCCEEEEE---ECCC-----CCCCHHHHHHHCCCCCCEEEECCCCCC
T ss_conf             94-------799-823658988645799999-808648998---3677-----866999999750659878997799999


Q ss_pred             CCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCC-CCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCCC
Q ss_conf             2112462101232211022345721310110034444555310-11124545302---1034444-44344321000111
Q gi|254780432|r  188 EGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA-YEWANVKPDIM---TIAKGMG-GGFPIGACLATNEV  262 (392)
Q Consensus       188 ~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~-~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~i  262 (392)
                      . |.. .+.+-+..+.+.|.+ +.++|+||-..-|...+.+.. .....--|.++   +|+|..| .|+-+|.+++++++
T Consensus       164 T-G~~-~~~~~l~~ll~~~~~-~~~vviDEAY~ef~~~~~~~~~~~l~~~~~NliVlrTfSK~~glaGlRiGy~ia~~~i  240 (366)
T PRK01533        164 T-GTY-VNDRKLTQFIEGISE-NTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEEL  240 (366)
T ss_pred             C-CCC-CCHHHHHHHHHHCCC-CEEEEECHHHHHHHCCCCCCHHHHHHHCCCCEEEEECCCHHCCCCCHHHHHHHCCHHH
T ss_conf             7-674-670658999862787-7378612878976425787105778761898489972743236830345366289999


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCHH
Q ss_conf             22222332234532111100123345543201222101121000026889999886797075504640099987249989
Q gi|254780432|r  263 AACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA  342 (392)
Q Consensus       263 ~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~~  342 (392)
                      .+.++...  ..|+-|.++.+||.++|+   +++++++..+.-..-+..++.+.+.. ++ .-....+=++-++. .+..
T Consensus       241 i~~l~~~~--~p~~vn~la~~aa~aaL~---d~~~~~~~~~~~~e~~~~~~~~l~~~-g~-~v~pS~aNFilv~~-~~~~  312 (366)
T PRK01533        241 IEKLNVVR--LPFNVSSLAQKAATIAFG---DDEFIEEIVRVNTEGLRQYESFCKEN-EI-PFYQSQTNFIFLPV-ENGG  312 (366)
T ss_pred             HHHHHHHC--CCCCCCHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCCEEEEEC-CCHH
T ss_conf             99999855--898843999999999967---99999999999999999999999878-68-58999787799866-9999


Q ss_pred             HHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999996898996268988995589868899999999999999998
Q gi|254780432|r  343 LLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       343 ~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      .+.+.|.++|+++++.. |.+|++   +=|.+|-++++++|++.+.+
T Consensus       313 ~l~~~L~~~GIlVR~~~-~~iRIs---vgt~eeN~~ll~aLke~~e~  355 (366)
T PRK01533        313 EIYEACAHAGFIIRPFP-NGVRIT---VGTREQNEGVISVLQQHFEN  355 (366)
T ss_pred             HHHHHHHHCCEEEEECC-CCEEEE---CCCHHHHHHHHHHHHHHHHH
T ss_conf             99999996898998995-987882---79999999999999999985


No 171
>PRK06836 aspartate aminotransferase; Provisional
Probab=99.54  E-value=5.4e-13  Score=105.39  Aligned_cols=329  Identities=19%  Similarity=0.219  Sum_probs=190.8

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC-----CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             7646410226743578789999999999997314-----50687578189999986520101----33312356555403
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW-----HVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~-----~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ...|||.-|  --.+ ...+.|++|+.++++...     |++.....+.+..+++.+.+..+    .+.+..++++++|.
T Consensus        34 ~dVI~l~iG--~Pdf-~~P~~i~~a~~~a~~~~~~~~~~Y~~~~G~~eLReaIa~~~~~~~g~~~~pe~Iiit~Ga~~al  110 (396)
T PRK06836         34 ENVFDFSLG--NPDV-EPPAAVKEALRELAEEEDPGMHGYMPNAGYPEVREAVAESLNARFGTPLTADHIVMTCGAAGAL  110 (396)
T ss_pred             CCEEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEECCCHHHHH
T ss_conf             985886895--9899-9779999999999967998888779874769999999999999868899589889858879999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++..-       .+| +.||..+-+|..-........+.+..-    |...  .. ...|++++++.+.+++-++++
T Consensus       111 ~~~~~~ll-------~pG-D~Vlvp~P~y~~y~~~~~~~g~~~v~v----~~~~--e~-~~~d~~~l~~~i~~~tk~iil  175 (396)
T PRK06836        111 NVVLKALL-------NPG-DEVIIFAPYFVEYKFYVDNHGGKLVVV----PPDT--ED-FQPDLDALEAAITPKTKAVII  175 (396)
T ss_pred             HHHHHHHC-------CCC-CEEEECCCCCHHHHHHHHHCCCEEEEE----CCCC--CC-CCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999966-------999-989982786506899999849979993----1676--56-767999999736756629998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCC------CCCEEEECCCCCCCCCCCCCCCC--CCCCCCCCEEECCCCCC-CCCC
Q ss_conf             -33222211246210123221102234------57213101100344445553101--11245453021034444-4434
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDD------IDALLIFDEVQTGYGRTGKLFAY--EWANVKPDIMTIAKGMG-GGFP  252 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~------~g~llI~DEV~tG~GRtG~~f~~--e~~gi~PDi~~~gK~l~-gG~P  252 (392)
                       -| +.-.|. +.+++.++++.++|++      |++++|.||+...+--.|..+.+  +.++-+-=+-.+||..+ .|+=
T Consensus       176 nsP-~NPTG~-v~s~e~l~~i~~l~~~~~~~~~h~i~vIsDEiY~~l~fd~~~~~s~~~~~d~~i~i~S~SK~~~m~G~R  253 (396)
T PRK06836        176 NSP-NNPTGV-IYSEETLKALGALLEEKSKEYGRPIYLISDEPYREIVYDGAEVPYIFKYYKNSIVVYSFSKSLSLPGER  253 (396)
T ss_pred             CCC-CCCCCC-CCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHCCCCCCCCCHHHCCCEEEEEECCCCCCCCCCCC
T ss_conf             689-898998-679999999999999865752886799805740753138987899577478299996464220467311


Q ss_pred             CCCCCCCCCCCCCC---CCCCCC-CCC--CCCCCCH-HHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             43210001112222---233223-453--2111100-1233455432012221011210000268899998867970755
Q gi|254780432|r  253 IGACLATNEVAACM---NQGSHG-STY--GGNVLAM-VLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLE  325 (392)
Q Consensus       253 ~sav~~~~~i~~~~---~~~~~~-~T~--~gnpl~~-aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~  325 (392)
                      +|.+++.+++.+..   +..... .+.  ...|... .++.+.++   ...-.+..+++-+.+.+.|+++     ++ .-
T Consensus       254 iG~iv~~~~i~~~~~~~~~~~~~~~~~~~v~a~~~~q~a~~~~~~---~~~~~~~y~~rrd~l~~~L~~~-----g~-~~  324 (396)
T PRK06836        254 IGYIAVNPEMEDADDLMAALVFANRILGFVNAPSLMQRVVAKLQD---ATVDISIYKRRRDLLYDALTEL-----GF-EF  324 (396)
T ss_pred             EEEEEECHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCC---CCHHHHHHHHHHHHHHHHHHHC-----CC-EE
T ss_conf             699986889999999999999876550556588999999999746---7266999999999999999984-----98-63


Q ss_pred             ECCCEEEEEE-EE-CCCHHHHHHHHHHCCEEEEEC----CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             0464009998-72-499899999999689899626----898899558986889999999999999999852
Q gi|254780432|r  326 VRGQGLLIGL-KT-VFSPALLAAKFRDECLLTAPS----SDNVVRILPPLTITAEEIHEGLERIERTAIKLS  391 (392)
Q Consensus       326 vRG~Gl~~~i-e~-~~~~~~~~~~l~~~Gll~~~~----~~~~irl~Ppl~it~~eid~~i~~l~~al~~L~  391 (392)
                      ++..|.|+.+ .. ..+...+++.++++||.+.|.    +++.+||+  +..++++|++++++|++.++++.
T Consensus       325 ~~P~Gafyl~~~~p~~d~~~f~~~l~e~gV~vvPG~~Fg~~g~vRls--~a~~~e~i~eal~rl~~~~~e~k  394 (396)
T PRK06836        325 VKPQGAFYLFPKSPIEDDVAFVEKAQKYNILLVPGSGFGAPGYFRLA--YCVDTEQIERSLPAFEKLAKEYK  394 (396)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHCCEEEEECCCCCCCCCEEEE--ECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             17881689986189999999999999699999827435999808999--70899999999999999999863


No 172
>TIGR03402 FeS_nifS cysteine desulfurase NifS. Members of this protein family are NifS, one of several related families of cysteine desulfurase involved in iron-sulfur (FeS) cluster biosynthesis. NifS is part of the NIF system, usually associated with other nif genes involved in nitrogenase expression and nitrogen fixation. The protein family is given a fairly broad interpretation here. It includes a clade nearly always found in extended nitrogen fixation genomic regions, plus a second clade more closely related to the first than to IscS and also part of NifS-like/NifU-like systems. This model does not extend to a more distantly clade found in the epsilon proteobacteria such as Helicobacter pylori, also named NifS in the literature, built instead in TIGR03403.
Probab=99.54  E-value=1.7e-12  Score=102.20  Aligned_cols=324  Identities=21%  Similarity=0.220  Sum_probs=180.1

Q ss_pred             EEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHH------HHH-HHHHHCC--CCCCCCCCCCCCCHHH
Q ss_conf             464102267435787899999999999973145068757818999------998-6520101--3331235655540356
Q gi|254780432|r   34 FLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI------FAN-HLIHSTF--ADRVFFTNSGAESVEC  104 (392)
Q Consensus        34 yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~------la~-~L~~~~~--~~~v~f~~SGseA~e~  104 (392)
                      |+|-.++      -.-.|++++++.+.+.+.. .++...+....+      -++ ++.+..+  .+.+.|+.|+||++-.
T Consensus         2 YlD~AAt------t~~~~~V~~a~~~~~~~~~-~np~~~h~~~~~a~~~~e~aR~~iA~~lga~~~eIvFt~~~T~a~n~   74 (379)
T TIGR03402         2 YLDNNAT------TRVDPEVLEAMLPYFTEYF-GNPSSMHSFGGEVGKAVEEAREQVAKLLGAEPDEIIFTSGGTESDNT   74 (379)
T ss_pred             CCCCCCC------CCCCHHHHHHHHHHHHHCC-CCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHH
T ss_conf             4417665------8899999999999999658-99776589999999999999999999829996739992887999999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             77766543200134786002343546565432123455321134799986433322210026887541012332222333
Q gi|254780432|r  105 AIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP  184 (392)
Q Consensus       105 Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~Ep  184 (392)
                      +++-....     .+++..||...-- |...+..+.   .. -++++.-..-.+.....-|++++++.+.+++..|.+--
T Consensus        75 ~i~~~~~~-----~~~~d~Ii~s~~e-H~a~~~~~~---~l-~~~g~~v~~~~~~~~g~id~~~l~~~l~~~T~lvs~~~  144 (379)
T TIGR03402        75 AIKSALAA-----QPEKRHIITTAVE-HPAVLSLCQ---HL-EKQGYKVTYLPVDEEGRLDLEELRAAITDDTALVSVMW  144 (379)
T ss_pred             HHHHHHHH-----CCCCCEEEEECCH-HHHHHHHHH---HH-HHCCCEEEEEECCCCCCCCHHHHHHHHCCCCEEEEEEC
T ss_conf             99999986-----7999999980131-045667999---99-96598899970378982642667887267862899612


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCCCCCCCCCCCCC
Q ss_conf             222211246210123221102234572131011003444455531011124545302103--444444344321000111
Q gi|254780432|r  185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA--KGMGGGFPIGACLATNEV  262 (392)
Q Consensus       185 v~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g--K~l~gG~P~sav~~~~~i  262 (392)
                      +.+.-|.+.|    ++++.++|+++|+++++|=+|. +|..  .+-.+.+  ..|+++++  | +.|-.=+|++..+++.
T Consensus       145 ~sn~tG~i~p----v~~I~~~~~~~g~~~~vDa~Q~-~g~~--pidv~~~--~~D~~~~S~hK-~~GP~G~G~Ly~r~~~  214 (379)
T TIGR03402       145 ANNETGTIFP----IEEIGEIAKERGALFHTDAVQA-VGKI--PIDLKEM--NIDMLSLSGHK-LHGPKGVGALYIRKGT  214 (379)
T ss_pred             CCCCCCHHHH----HHHHHHHHHHCCCEEEEECCCC-CCCC--CCCHHHH--CCCCEECCHHH-CCCCCCEEEEEECCCC
T ss_conf             5788870178----9999999976398899453112-4664--6403441--57721202111-3688725999982676


Q ss_pred             CCCCCCCCCCCCC-----CC--CCCCHHHHHHHHHHHHC--CCCCCHHHHHCCHHHHHHHHHHHHCCCEEE--E--ECCC
Q ss_conf             2222233223453-----21--11100123345543201--222101121000026889999886797075--5--0464
Q gi|254780432|r  263 AACMNQGSHGSTY-----GG--NVLAMVLGEKVLNIIQS--DGFLENVINIAKILFEGLTAIKNRFPNMFL--E--VRGQ  329 (392)
Q Consensus       263 ~~~~~~~~~~~T~-----~g--npl~~aaa~a~L~~l~~--~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~--~--vRG~  329 (392)
                        .++|...|...     .|  |..++++..+++++..+  ++..++.+.+.++|.+++   .+..|++..  +  -|--
T Consensus       215 --~~~P~~~Gg~~e~~~~~GT~n~~~i~gl~~a~~~~~~~~~~~~~~~~~l~~~l~~~l---l~~~~~~~i~g~~~~r~p  289 (379)
T TIGR03402       215 --RFRPLLRGGHQERGRRAGTENVPGIVGLGKAAELATEHLEEENTRVRALRDRLEAGL---LARIPDARLNGDPTKRLP  289 (379)
T ss_pred             --CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHCCCCEEECCCHHHCCC
T ss_conf             --668767888877776789712999999999999999759999999999999999999---850898275478666488


Q ss_pred             E-EEEEEEECCCHHHHHHHHHHCCEEEEEC-----------------------CCCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             0-0999872499899999999689899626-----------------------898899558986889999999999999
Q gi|254780432|r  330 G-LLIGLKTVFSPALLAAKFRDECLLTAPS-----------------------SDNVVRILPPLTITAEEIHEGLERIER  385 (392)
Q Consensus       330 G-l~~~ie~~~~~~~~~~~l~~~Gll~~~~-----------------------~~~~irl~Ppl~it~~eid~~i~~l~~  385 (392)
                      + +-+.++. .+.+.+...+-++|+.++..                       ....||+++...-|++|||++++.|++
T Consensus       290 ~~~~~~~~~-~~~~~i~~~L~~~gI~v~~G~~Ca~~~~~ps~vL~a~g~~~~~~~g~iRvS~~~ynT~edId~li~aL~~  368 (379)
T TIGR03402       290 NTVNISFEY-IEGEAILLLLDMEGICASSGSACTSGSLEPSHVLRAMGVPHTAAHGSIRFSLSRYNTEEDIDYVLEVLPP  368 (379)
T ss_pred             CCEEECCCC-CCHHHHHHHHCCCCEEEECCHHCCCCCCCHHHHHHHCCCCHHHCCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             730323699-8999999984518929975032159998624999975998333395699973899999999999999999


Q ss_pred             HHHHH
Q ss_conf             99985
Q gi|254780432|r  386 TAIKL  390 (392)
Q Consensus       386 al~~L  390 (392)
                      ++.+|
T Consensus       369 iv~~l  373 (379)
T TIGR03402       369 IIARL  373 (379)
T ss_pred             HHHHH
T ss_conf             99999


No 173
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed
Probab=99.54  E-value=6.3e-13  Score=104.97  Aligned_cols=314  Identities=16%  Similarity=0.135  Sum_probs=176.5

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC-----CCCCCCCCCCCCCHH
Q ss_conf             799764641022674357878999999999999731450687578189999986520101-----333123565554035
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF-----ADRVFFTNSGAESVE  103 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~-----~~~v~f~~SGseA~e  103 (392)
                      ..|...||+.-|  . .-.--.|.|++|+.+..+...|.......+.++.+++.+.+..+     .+.++.+++++|+..
T Consensus        24 ~~~~~vI~l~iG--~-Pd~p~P~~v~~a~~~a~~~~~Y~~~~G~~~LReAIa~~~~~~~g~~~~~~~~V~vt~Ga~~~l~  100 (364)
T PRK07865         24 AHPDGIVDLSVG--T-PVDPVPPVIQEALAAAADAPGYPTTAGTPELREAIVAWLARRYGVTGLDPAAVLPVIGSKELVA  100 (364)
T ss_pred             HCCCCEEECCCC--C-CCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHH
T ss_conf             789983985698--9-9899899999999962489998998887999999999999983989899687997698899999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             67776654320013478600234354656543212345532113479998643332221002688754101233222233
Q gi|254780432|r  104 CAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE  183 (392)
Q Consensus       104 ~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~E  183 (392)
                      ...++.-   .   .+| +.||..+-+|.....++......        |       ++.   +.+.+...+..+.+++-
T Consensus       101 ~l~~~l~---~---~pG-D~Vlip~P~Yp~y~~~~~~~g~~--------~-------v~~---d~~~~~~~~~~~li~ln  155 (364)
T PRK07865        101 WLPTLLG---L---GPG-DVVVVPELAYPTYEVGARLAGAT--------V-------VRA---DSLTELGPQTPALIWLN  155 (364)
T ss_pred             HHHHHHC---C---CCC-CEEEECCCCCCHHHHHHHHCCCE--------E-------EEC---CCHHHCCCCCCEEEEEC
T ss_conf             9999970---7---999-98998667860199999981986--------5-------610---78877598775299989


Q ss_pred             -CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCC---CCCCCC-EE---ECCCCCC-CCCCCC
Q ss_conf             -32222112462101232211022345721310110034444555310111---245453-02---1034444-443443
Q gi|254780432|r  184 -PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW---ANVKPD-IM---TIAKGMG-GGFPIG  254 (392)
Q Consensus       184 -pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~---~gi~PD-i~---~~gK~l~-gG~P~s  254 (392)
                       | +.-.|. ..+.+.+++|.++|++||+++|.||+...|.--|.....-.   .+...| ++   .+||..+ .|+-+|
T Consensus       156 sP-~NPTG~-v~s~e~l~~l~~la~~~~i~vi~DE~Y~~l~~~~~~~s~l~p~~~~~~~~~vi~i~S~SK~~~~~GlRiG  233 (364)
T PRK07865        156 SP-SNPTGR-VLGVDHLRKVVAWARERGAVVASDECYLGLGWDAEPVSVLDPRVCGGDHTGLLAVHSLSKQSNLAGYRAG  233 (364)
T ss_pred             CC-CCCCCC-CCCHHHHHHHHHHHHHCEEEEEECCCHHHHCCCCCCCCCCCHHHCCCCCCCEEEEECCCCCCCCCCCEEE
T ss_conf             99-698551-1769999999999776718998254257642589886513864427775757999436523067774489


Q ss_pred             CCCCCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHCCCCC----CHHHHHCCHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             2100011122222332-2345321111001233455432012221----0112100002688999988679707550464
Q gi|254780432|r  255 ACLATNEVAACMNQGS-HGSTYGGNVLAMVLGEKVLNIIQSDGFL----ENVINIAKILFEGLTAIKNRFPNMFLEVRGQ  329 (392)
Q Consensus       255 av~~~~~i~~~~~~~~-~~~T~~gnpl~~aaa~a~L~~l~~~~l~----~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~  329 (392)
                      .+++.+++++.+.... +..+....|+ -.++.+.|+   ++..+    ++.+++-+.+.+.|++    . ++-. .+..
T Consensus       234 ~i~~~~~li~~l~~~~~~~~~~~~~~~-Q~a~~aal~---~~~~~~~~~~~y~~rr~~l~~~L~~----~-g~~~-~~p~  303 (364)
T PRK07865        234 FVAGDPALVAELLAVRKHAGMMVPAPV-QAAMVAALG---DDAHVREQRERYARRRAVLLPALEA----A-GFTV-DHSE  303 (364)
T ss_pred             EEECCHHHHHHHHHHHHHCCCCCCHHH-HHHHHHHHC---CCHHHHHHHHHHHHHHHHHHHHHHH----C-CCEE-CCCC
T ss_conf             996799999999999985502378999-999999957---9399999999999999999999986----7-9766-2699


Q ss_pred             E-EEEEEEECCCHHHHHHHHHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             0-0999872499899999999689899626------89889955898688999999999999
Q gi|254780432|r  330 G-LLIGLKTVFSPALLAAKFRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIE  384 (392)
Q Consensus       330 G-l~~~ie~~~~~~~~~~~l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~  384 (392)
                      | +++=++...+.....+.+.++||.+.|.      +.+.+||+  +..++++|++++++|.
T Consensus       304 G~fylw~~~~~~~~~~~~~l~e~gV~v~PG~~Fg~~g~~~vRls--~~~~~e~l~ea~~RLa  363 (364)
T PRK07865        304 AGLYLWATRGEDCWDTVAWLAERGILVAPGDFYGPAGAQHVRVA--LTATDERIAAAVERLT  363 (364)
T ss_pred             CEEEEEEECCCCHHHHHHHHHHCCEEEECCCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHC
T ss_conf             22799888899999999999979989918874368999869999--6598999999999868


No 174
>PRK07392 threonine-phosphate decarboxylase; Validated
Probab=99.53  E-value=6.3e-13  Score=105.00  Aligned_cols=324  Identities=17%  Similarity=0.168  Sum_probs=185.3

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHH
Q ss_conf             99764641022674357878999999999999731450687578189999986520101--3331235655540356777
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIK  107 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aik  107 (392)
                      .-.++|||.++  .+.+|-. |.+++|+++++..+.    .|..+...+|.+.|.+..+  .+.+..+|+.+|....+.+
T Consensus        20 ~~~~iidlSsN--~NP~gpp-p~v~~ai~~~~~~~~----~YPd~~~~~Lr~aiA~~~gv~~e~I~~gnGs~Eli~~~~~   92 (358)
T PRK07392         20 PPSAILDFSAS--INPLGPP-ESVIAAIQSALSALR----HYPDPDYRELREALAQHHQLPPEWILPGNGAAELLTWAGR   92 (358)
T ss_pred             CHHHCEECCCC--CCCCCCC-HHHHHHHHHHHHHHH----HCCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHH
T ss_conf             99984660899--9998989-899999999888886----4899568999999999859588889877579999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             66543200134786002343546565432123455321134799986433322210026887541012332222333222
Q gi|254780432|r  108 TARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQG  187 (392)
Q Consensus       108 lar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~Epv~g  187 (392)
                      .   .    + .++ +++....+|---...+. +.|-....-   |...... ....+.+.+.......-..+|.-|=-=
T Consensus        93 ~---~----~-~~~-~v~i~~Ptf~~Y~~~~~-~~g~~v~~v---pl~~~~~-~~~~~~~~~~~~~~~~~~i~l~nPNNP  158 (358)
T PRK07392         93 E---L----A-QLR-EVYLLTPAFGDYRRALR-AFGATVKEL---PLPLSGE-ASLTELQLLPPQLTPNDGLLLNNPHNP  158 (358)
T ss_pred             H---H----C-CCC-EEEEECCCCHHHHHHHH-HCCCEEEEE---ECCCCCC-CCCCHHHHHHHCCCCCCEEEECCCCCC
T ss_conf             9---7----5-898-69995785189999999-839889998---5775556-782056788755899878997689999


Q ss_pred             CCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCC-CCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCCC
Q ss_conf             2112462101232211022345721310110034444555310-11124545302---1034444-44344321000111
Q gi|254780432|r  188 EGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA-YEWANVKPDIM---TIAKGMG-GGFPIGACLATNEV  262 (392)
Q Consensus       188 ~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~-~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~i  262 (392)
                      . |.. .+.+   .|++++++++ ++|+||...-|-..+.... .....-.|.++   +++|..+ .|+-+|.+++++++
T Consensus       159 T-G~~-~~~~---~l~~l~~~~~-~vvvDEaY~ef~~~~~~~s~~~~~~~~~n~iv~rSfSK~~glaGlRlGy~ia~~~~  232 (358)
T PRK07392        159 T-GKL-WSRE---AILPLLEQFA-LVVVDEAFMDFLPPAAEQSLIPCLAEYPNLIILRSLTKFYSLPGLRLGYAIAHPDR  232 (358)
T ss_pred             C-CCC-CCHH---HHHHHHHCCC-EEEEECHHHHHCCCCCCCCHHHHHHCCCCEEEEEECHHHHHCCCCCCEEEECCHHH
T ss_conf             7-765-6879---9998863289-99995715541688655678999753586799961628765744100000239999


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCHH
Q ss_conf             22222332234532111100123345543201222101121000026889999886797075504640099987249989
Q gi|254780432|r  263 AACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA  342 (392)
Q Consensus       263 ~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~~~  342 (392)
                      ++.++...  ..|.-|.++.+++.+.|+   +.++.++..+.-..-++.|.+...+.+++ .-.-..+-++-++...+..
T Consensus       233 i~~l~~~~--~p~~vn~~a~~aa~aal~---~~~~~~~~~~~~~~~R~~l~~~L~~l~g~-~v~ps~anF~l~~~~~~~~  306 (358)
T PRK07392        233 LQRWQQWR--DPWPVNGLAAAAAIAALA---DRDFQQQTWAWLPPAREALFQGLASLPGL-TPLPSAANFLLVQSQGSAL  306 (358)
T ss_pred             HHHHHHHC--CCCCCCHHHHHHHHHHCC---CHHHHHHHHHHHHHHHHHHHHHHHCCCCC-EECCCCCEEEEEECCCCHH
T ss_conf             99999853--887778999999999825---99999999999999999999999718997-7888850499997699999


Q ss_pred             HHHHHHHH-CCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999996-89899626------8988995589868899999999999999998
Q gi|254780432|r  343 LLAAKFRD-ECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       343 ~~~~~l~~-~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      .++.++.+ +|++++++      +++.+|++   +=|.+|-+++++.|++.|+.
T Consensus       307 ~~~~~ll~~~gI~Vr~~~~f~~~g~~~iRis---vgt~een~~li~al~~iLa~  357 (358)
T PRK07392        307 QLQEELLQQHRILIRDCLSFPELGDRYFRVA---VRTEAENQRLLSALAAILAN  357 (358)
T ss_pred             HHHHHHHHCCCEEEEECCCCCCCCCCEEEEE---ECCHHHHHHHHHHHHHHHHC
T ss_conf             9999999719889986888888899989998---39999999999999999706


No 175
>PRK10534 L-threonine aldolase; Provisional
Probab=99.53  E-value=2.3e-13  Score=107.81  Aligned_cols=310  Identities=15%  Similarity=0.231  Sum_probs=173.4

Q ss_pred             EEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCC-HHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             4641022674357878999999999999731450687578-189999986520101333123565554035677766543
Q gi|254780432|r   34 FLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQS-TQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY  112 (392)
Q Consensus        34 yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~-~~~~~la~~L~~~~~~~~v~f~~SGseA~e~Aiklar~~  112 (392)
                      .|||.|-    +.=--+|++.+||.++-  .  ....|.. |...+|.+++.+.++.+..+|+.|||-||-.||+.-   
T Consensus         1 ~id~rSD----tvt~p~~~m~~Am~~A~--~--GddvYgeDptv~~Le~~~A~l~G~eaalFvpsGTmaN~iAl~~~---   69 (333)
T PRK10534          1 MIDLRSD----TVTRPSRAMLEAMMAAP--V--GDDVYGDDPTVNALQDYAAELSGKEAALFLPTGTQANLVALLSH---   69 (333)
T ss_pred             CCCCCCC----CCCCCCHHHHHHHHCCC--C--CCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHH---
T ss_conf             9246544----28999999999997375--5--77545769899999999999858971899578757899999984---


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCC--CCCC-CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHC-CCC-----CCCCCCC
Q ss_conf             20013478600234354656543--2123-4553211347999864333222100268875410-123-----3222233
Q gi|254780432|r  113 HYMAGKTNKFRIVTFEGAFHGRT--LATI-SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SND-----TAAILIE  183 (392)
Q Consensus       113 ~~~~g~t~r~~ii~~~~~yHG~t--~~a~-s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~-~~~-----iAavi~E  183 (392)
                       .   .++- .||+-+.+ |=..  .++. .+++-..  .+..+...+  ..   +++.+...+ +++     +..+-+|
T Consensus        70 -~---~~g~-~vi~~~~s-HI~~~E~Gg~a~l~g~~~--~~i~~~~~g--~~---~~~~v~~~i~~~~~h~~~~~lv~le  136 (333)
T PRK10534         70 -C---ERGE-EYIVGQAA-HNYLYEAGGAAVLGSIQP--QPIDAAADG--TL---PLDKVAAKIKPDDIHFARTRLLSLE  136 (333)
T ss_pred             -C---CCCC-EEEECCCC-CCHHCCCCCHHHHCCCCE--EEECCCCCC--CC---CHHHHHHHCCCCCCCCCCEEEEEEE
T ss_conf             -7---8998-69875777-610114664898769521--551478898--24---8999998618788766762466554


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCC-------CE--EECCCCCCCCCCCC
Q ss_conf             3222211246210123221102234572131011003444455531011124545-------30--21034444443443
Q gi|254780432|r  184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP-------DI--MTIAKGMGGGFPIG  254 (392)
Q Consensus       184 pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~P-------Di--~~~gK~l~gG~P~s  254 (392)
                      -  .++|. .+|.++++.+.++|+++|+.+-.|=-     |.  |-+.-.+|+.|       |.  +|++|+||.  |+|
T Consensus       137 n--T~~G~-v~p~~el~~i~~~a~~~gl~vHlDGA-----Rl--~NA~~a~g~~~~e~~~~~Dsvs~clsKgLGa--p~G  204 (333)
T PRK10534        137 N--THNGK-VLPREYLKEAWEFTRERNLALHVDGA-----RI--FNAVVAYGCELKEITQYCDSFTICLSKGLGT--PVG  204 (333)
T ss_pred             E--CCCCE-ECCHHHHHHHHHHHHHCCCEEEECHH-----HH--HHHHHHCCCCHHHHHHHCCEEEEEEECCCCC--CCC
T ss_conf             0--35885-36899999999999975983762327-----77--6446542999999997589889874067887--332


Q ss_pred             CCC-CCCCCCCCCCC--CCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEE
Q ss_conf             210-00111222223--322345321111001233455432012221011210000268899998867970755046400
Q gi|254780432|r  255 ACL-ATNEVAACMNQ--GSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGL  331 (392)
Q Consensus       255 av~-~~~~i~~~~~~--~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl  331 (392)
                      +++ ++++..+....  ...|+-+.-.-+-.|+++..|+....  .+..-..+.++|.++|+++.-   + +..+. ...
T Consensus       205 svl~g~~~~i~~a~~~RK~~GGgmrQ~g~lAAa~l~aL~~~~~--rl~~dH~nA~~La~~L~~~g~---~-~~~~e-TN~  277 (333)
T PRK10534        205 SLLVGNRDYIKRAIRWRKMTGGGMRQAGILAAAGLYALKHNVA--RLQEDHDNAAWLAQQLREAGA---D-VMRQD-TNM  277 (333)
T ss_pred             EEEECCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCHH--HHHHHHHHHHHHHHHHHHCCC---C-CCCCC-CCE
T ss_conf             1464689999999999998546555899999999999963999--899999989999999997698---7-48997-647


Q ss_pred             EEEEEECC-CHHHHHHHHHHCCEEEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99987249-98999999996898996268988995589868899999999999999998
Q gi|254780432|r  332 LIGLKTVF-SPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       332 ~~~ie~~~-~~~~~~~~l~~~Gll~~~~~~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      ++ +.+.. ....+.+.++++|++...  +..+||.-++-+|++++|++++.+.+.+.+
T Consensus       278 vf-~~~~~~~~~~l~~~~~~~gv~~~~--~~~vR~Vth~~it~~dv~~~i~~~r~~l~~  333 (333)
T PRK10534        278 LF-VRVGEENAAALGEYMRERNVLINA--SPIVRLVTHLDVSREQLAEVVAHWRAFLAR  333 (333)
T ss_pred             EE-EECCHHHHHHHHHHHHHCCEEECC--CCCEEEEEECCCCHHHHHHHHHHHHHHHCC
T ss_conf             99-977877799999999987967579--981899980899999999999999999719


No 176
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to alanine-glyoxylate aminotransferase (AGAT), serine-glyoxylate aminotransferase (SGAT), and 3-hydroxykynurenine transaminase (HKT). AGAT is a homodimeric protein, which catalyses the transamination of glyoxylate to glycine, and SGAT converts serine and glyoxylate to hydroxypyruvate and glycine. HKT catalyzes the PLP-dependent transamination of 3-hydroxykynurenine, a potentially toxic metabolite of the kynurenine pathway.
Probab=99.53  E-value=1.4e-12  Score=102.79  Aligned_cols=280  Identities=18%  Similarity=0.162  Sum_probs=162.1

Q ss_pred             HHHHHHHHCC---CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9986520101---3331235655540356777665432001347860023435465654321234553211347999864
Q gi|254780432|r   79 FANHLIHSTF---ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKI  155 (392)
Q Consensus        79 la~~L~~~~~---~~~v~f~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~  155 (392)
                      ..++|.+..+   .+-++|+-|||.|+|+++.=..        ....+++...++..|.-+.-+.-      +.+.....
T Consensus        37 ~~~~L~~~~~~~~~~~v~~~gsgt~a~ea~~~n~~--------~~~~kvlv~~~G~fg~r~~~~a~------~~g~~~~~  102 (356)
T cd06451          37 ILEGLRYVFQTENGLTFLLSGSGTGAMEAALSNLL--------EPGDKVLVGVNGVFGDRWADMAE------RYGADVDV  102 (356)
T ss_pred             HHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHCC--------CCCCCEEEEEEEECCCCHHHHHH------HCCCCEEE
T ss_conf             99999999589998489995770899999998526--------88881478853040541676441------15972399


Q ss_pred             CCCCCCCCHHHHHHHHHCCC-CC---CCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC
Q ss_conf             33322210026887541012-33---222233322221124621012322110223457213101100344445553101
Q gi|254780432|r  156 EGFDQAKFCDLQSLKNQISN-DT---AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY  231 (392)
Q Consensus       156 ~~~~~~~~~d~~~l~~~~~~-~i---Aavi~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~  231 (392)
                      -.++.-..-|.+.+++.+.+ ++   +.+-.|+.   .|+..+    ++.+.++|++||+++++|=|++ +|-  ...-.
T Consensus       103 i~~~~~~~~~~~~v~~~l~~~~~~~v~~~h~ets---tG~~~~----l~~i~~~~~~~~~~~~vDavss-~g~--~~id~  172 (356)
T cd06451         103 VEKPWGEAVSPEEIAEALEQHDIKAVTLTHNETS---TGVLNP----LEGIGALAKKHDALLIVDAVSS-LGG--EPFRM  172 (356)
T ss_pred             EECCCCCCCCHHHHHHHHHCCCCCEEEEECCCCC---CCCCCC----HHHHHHHHHHCCEEEEEECCHH-HCC--CCCCC
T ss_conf             8689999789899998863389658999665365---101477----5889998741572799725311-055--65025


Q ss_pred             CCCCCCCCEEECC--CCCCCCCC-CCCCCCCCCCCCCCCCC------------------CCCCCCCCCCCC-HHHHHHHH
Q ss_conf             1124545302103--44444434-43210001112222233------------------223453211110-01233455
Q gi|254780432|r  232 EWANVKPDIMTIA--KGMGGGFP-IGACLATNEVAACMNQG------------------SHGSTYGGNVLA-MVLGEKVL  289 (392)
Q Consensus       232 e~~gi~PDi~~~g--K~l~gG~P-~sav~~~~~i~~~~~~~------------------~~~~T~~gnpl~-~aaa~a~L  289 (392)
                      +.||+  |+++.|  |+|++ .| +|.++.+++..+.+.+.                  ....|....|+. ..+-.++|
T Consensus       173 ~~~gi--D~~~~ssqK~l~~-ppGl~~~~vs~~a~~~~~~~~~~~~~y~dl~~~~~~~~~~~~~~~Tp~~~~i~al~~AL  249 (356)
T cd06451         173 DEWGV--DVAYTGSQKALGA-PPGLGPIAFSERALERIKKKTKPKGFYFDLLLLLKYWGEGYSYPHTPPVNLLYALREAL  249 (356)
T ss_pred             CCCCE--EEEEECCCCCCCC-CCCEEEEEECHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
T ss_conf             66660--5999768864458-99668999889999998603899877779899998761489878898806889999999


Q ss_pred             HHHHCCC---CCCHHHHHCCHHHHHHHHHHHHCCCEEE-EECCCEEEEEEEECC--CHHHHHHHHH-HCCEEEEEC----
Q ss_conf             4320122---2101121000026889999886797075-504640099987249--9899999999-689899626----
Q gi|254780432|r  290 NIIQSDG---FLENVINIAKILFEGLTAIKNRFPNMFL-EVRGQGLLIGLKTVF--SPALLAAKFR-DECLLTAPS----  358 (392)
Q Consensus       290 ~~l~~~~---l~~~~~~~g~~l~~~L~~l~~~~~~~v~-~vRG~Gl~~~ie~~~--~~~~~~~~l~-~~Gll~~~~----  358 (392)
                      +.+.++.   ..+|.+++.++++++|+++--+  .+.. +.| ...+.++..+.  +...+.+.+. +.|+.+.+.    
T Consensus       250 ~~i~~~G~~~~~~r~~~l~~~l~~~l~~lGl~--~~~~~~~~-S~~vt~~~~p~g~~~~~~~~~l~~~~~i~i~~g~g~~  326 (356)
T cd06451         250 DLILEEGLENRWARHRRLAKALREGLEALGLK--LLAKPELR-SPTVTAVLVPEGVDGDEVVRRLMKRYNIEIAGGLGPT  326 (356)
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCC--CCCCHHHC-CCEEEEEECCCCCCHHHHHHHHHHHCCEEEECCCCCC
T ss_conf             99986065899999999999999999975996--56893654-9827999799999999999999997899997886656


Q ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             898899558986889999999999999999
Q gi|254780432|r  359 SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       359 ~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      .++++|+.--=.++.++++.+++.|+++|+
T Consensus       327 ~~~~fRIg~mG~~~~~di~~~l~al~~~Lk  356 (356)
T cd06451         327 AGKVFRIGHMGEATREDVLGVLSALEEALK  356 (356)
T ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             895898618989999999999999999859


No 177
>PRK12414 putative aminotransferase; Provisional
Probab=99.53  E-value=1.5e-12  Score=102.53  Aligned_cols=326  Identities=16%  Similarity=0.167  Sum_probs=187.2

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCC-CCCCCCHHHHHHHHHHHHHCC----C-CCCCCCCCCCCCH
Q ss_conf             99764641022674357878999999999999731-450-687578189999986520101----3-3312356555403
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHV-SNLYQSTQQEIFANHLIHSTF----A-DRVFFTNSGAESV  102 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~-~~~~~~~~~~~la~~L~~~~~----~-~~v~f~~SGseA~  102 (392)
                      .+++.|++.-|  .-.+ --.|+|++|+.++++.- .++ ......+.+.++++.+.+..+    . +.++.++++++|.
T Consensus        27 ~~~dvI~l~~G--~Pd~-~~p~~i~~a~~~a~~~~~~~Y~~~~G~~~LReaia~~~~~~~g~~~dp~~~i~vt~G~~~al  103 (384)
T PRK12414         27 AQHDALNLSQG--APNF-APDPALVEGVARAMRDGHNQYAPMAGIAALREALAEKTERLYGARYDPDTEVTVIASASEGL  103 (384)
T ss_pred             CCCCCEECCCC--CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHH
T ss_conf             38996881898--9999-99899999999999619998989987199999999999999689999888099847989999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++..-       .+| +.||..+-+|-+...........+..- +..  .+++    ..|.+++++.+.+++.++++
T Consensus       104 ~~~~~al~-------~pG-D~Vlv~~P~y~~y~~~~~~~Ga~~v~v-~~~--~~~~----~~d~~~l~~~~~~~tk~iil  168 (384)
T PRK12414        104 YAAISALV-------HPG-DEVIYFEPSFDSYAPIVRLQGATPVAI-KLS--PEHF----RVNWDEVAAAITPRTRMIIV  168 (384)
T ss_pred             HHHHHHHC-------CCC-CEEEEECCCCHHHHHHHHHCCCEEEEE-ECC--CCCC----CCCHHHHHHHCCCCCEEEEE
T ss_conf             99999967-------999-989990897065699999859989998-668--5568----88999999627778669997


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-C-CCCCCC---CEEECCCCCC-CCCCCCCC
Q ss_conf             3322221124621012322110223457213101100344445553101-1-124545---3021034444-44344321
Q gi|254780432|r  183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-E-WANVKP---DIMTIAKGMG-GGFPIGAC  256 (392)
Q Consensus       183 Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e-~~gi~P---Di~~~gK~l~-gG~P~sav  256 (392)
                      -.=+.--|. ..+.+.+++|.++|++||+++|.||+...+.=.|..+.+ - .-+...   =+-.+||.++ .|+=+|.+
T Consensus       169 ~~P~NPTG~-v~s~e~l~~l~~la~~~~i~ii~DE~Y~~l~f~g~~~~s~~~~~~~~~~~I~i~S~SK~~~~~G~RvG~~  247 (384)
T PRK12414        169 NTPHNPTAT-VFSEADLARLAQLTRGTDIVVLSDEVYEHVVFDGARHHSMARHRELAERSVIVSSFGKSYHVTGWRVGYC  247 (384)
T ss_pred             CCCCCCCCC-CCCHHHHHHHHHHHHHCCEEEEECCCHHHEECCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEE
T ss_conf             999898771-3756669999998751588999666323303178777664315120113323567750000265127999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCC-CCC---HHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEE
Q ss_conf             0001112222233223453211110012334554320122-210---112100002688999988679707550464009
Q gi|254780432|r  257 LATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDG-FLE---NVINIAKILFEGLTAIKNRFPNMFLEVRGQGLL  332 (392)
Q Consensus       257 ~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~-l~~---~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~  332 (392)
                      ++.+++++.+.......+++.+...-.++.+.|+   +.+ +.+   ..+++-+.+.+.|++    . . +.-+...|.+
T Consensus       248 v~p~~li~~~~~~~~~~~~~~~~~~Q~a~~~~l~---~~~~~~~~~~~y~~rrd~l~~~L~~----~-~-~~~~~p~G~f  318 (384)
T PRK12414        248 LAPAELMDEIRKVHQFMVFSADTPMQYAFAEALA---RPASYLGLSAFYQRKRDLLARELAD----S-R-FELLPSEGSF  318 (384)
T ss_pred             EECHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH---CCHHHHHHHHHHHHHHHHHHHHHHH----C-C-CEEECCCCEE
T ss_conf             8489999999999975657867899999999982---9824999999999999999997675----6-9-8787898079


Q ss_pred             EEE-EEC----CCHHHHHH-HHHHCCEEEEEC------C--CCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             998-724----99899999-999689899626------8--98899558986889999999999999
Q gi|254780432|r  333 IGL-KTV----FSPALLAA-KFRDECLLTAPS------S--DNVVRILPPLTITAEEIHEGLERIER  385 (392)
Q Consensus       333 ~~i-e~~----~~~~~~~~-~l~~~Gll~~~~------~--~~~irl~Ppl~it~~eid~~i~~l~~  385 (392)
                      +-+ .+.    ..+..++. .+.+.||.+.|.      +  .+.|||+  |..++++|.+++++|.+
T Consensus       319 y~~~~~~~~~~~~d~~~~~~ll~e~gV~vvPG~~Fg~~g~~~g~iRls--fa~~~e~l~eg~~RL~~  383 (384)
T PRK12414        319 FMLARFRHFSDESDSDFVLRLIRDARVATIPLSAFYADGTDTGVIRLS--FSKDDATLVEGARRLCS  383 (384)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHHCCEEEEECHHHCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHC
T ss_conf             999976878999999999999985999998263217999989989999--67999999999999703


No 178
>PRK09265 aminotransferase AlaT; Validated
Probab=99.52  E-value=2e-12  Score=101.64  Aligned_cols=337  Identities=18%  Similarity=0.206  Sum_probs=186.7

Q ss_pred             CCCCEEEECHHHHHHHCCCC-CCHHHHHHHHHHHHHC-CCCCCCCCCHHHHHHHHHHHHHCC----CCCCCCCCCCCCCH
Q ss_conf             79976464102267435787-8999999999999731-450687578189999986520101----33312356555403
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGH-SHPELVAILKSQSEKL-WHVSNLYQSTQQEIFANHLIHSTF----ADRVFFTNSGAESV  102 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh-~~p~i~~a~~~q~~~~-~~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~SGseA~  102 (392)
                      ..|++.|++.-|-= ..++. ..+.|++|+.+++.+. .+++.....+.+...|+.+.+..+    .+.++.++++++|.
T Consensus        30 ~~G~~vi~l~iG~P-~~~df~tP~~i~~a~~~a~~~~~~Yt~~~G~~eLReaIA~~~~~~~~~~~~p~~I~vT~Ga~~al  108 (404)
T PRK09265         30 EEGHKILKLNIGNP-APFGFEAPDEILRDVIRNLPTAQGYSDSKGLFSARKAIMQYYQQKGIPDVDVDDIYIGNGVSELI  108 (404)
T ss_pred             HCCCCCEECCCCCC-CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHEEECCCHHHHH
T ss_conf             76997358779799-98899998999999998744489989888889999999999997569998889978758889999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
Q ss_conf             56777665432001347860023435465654321234553211347999864333222100268875410123322223
Q gi|254780432|r  103 ECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI  182 (392)
Q Consensus       103 e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~  182 (392)
                      ..+++..-       .+|- .||..+-+|=..........+.+.+.    +.  ....-...|++++++.+.+++-++++
T Consensus       109 ~~~~~all-------~pGD-eVlvp~P~Yp~Y~~~~~l~g~~~v~~----~~--~~~~~f~~d~~~l~~~i~~~tk~iil  174 (404)
T PRK09265        109 VMAMQALL-------NNGD-EVLVPAPDYPLWTAAVSLSGGKPVHY----LC--DEEAGWFPDLDDIRSKITPRTKAIVI  174 (404)
T ss_pred             HHHHHHHC-------CCCC-EEEEECCCCCHHHHHHHHCCCEEEEE----EC--CCCCCCCCCHHHHHHHCCCCCEEEEE
T ss_conf             99999964-------9989-89994688730689999769889998----52--63237788999999765745559998


Q ss_pred             -CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCE--E---ECCCCCC-CCCCCCC
Q ss_conf             -3322221124621012322110223457213101100344445553101112454530--2---1034444-4434432
Q gi|254780432|r  183 -EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI--M---TIAKGMG-GGFPIGA  255 (392)
Q Consensus       183 -Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi--~---~~gK~l~-gG~P~sa  255 (392)
                       -|= .-.|. ..+++.+++|.++|++||+++|.|||...+---|.-|-+ ...+.||.  +   .+||..+ .|+=+|-
T Consensus       175 ~nP~-NPTG~-v~~~~~l~~l~~~a~~~~i~visDEiY~~l~~d~~~~~s-~~~l~~~~~~I~~~s~SK~~~m~G~RiG~  251 (404)
T PRK09265        175 INPN-NPTGA-VYSKELLEEIVEIARQHNLIIFADEIYDKILYDGAEHIS-IASLAPDLLCVTFNGLSKAYRVAGFRVGW  251 (404)
T ss_pred             CCCC-CCCCC-CCCHHHHHHHHHHHHHCEEEEEECCHHHHHCCCCCCCCC-HHHCCCCCEEEEECCCCCCCCCCCCCEEE
T ss_conf             6897-95120-025046889999763155899850114552369998878-78819860599973677455677552799


Q ss_pred             CCC--CCCCCCCC-CCCC-CCCC-CCCCCCCHHHHHHHHHHHHC-CCCCC---HHHHHCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             100--01112222-2332-2345-32111100123345543201-22210---112100002688999988679707550
Q gi|254780432|r  256 CLA--TNEVAACM-NQGS-HGST-YGGNVLAMVLGEKVLNIIQS-DGFLE---NVINIAKILFEGLTAIKNRFPNMFLEV  326 (392)
Q Consensus       256 v~~--~~~i~~~~-~~~~-~~~T-~~gnpl~~aaa~a~L~~l~~-~~l~~---~~~~~g~~l~~~L~~l~~~~~~~v~~v  326 (392)
                      ++.  .+.....+ +... ..++ ...|-.+-.++.++|.-.+. +++..   +..+.-+.+.+.|+    +.|+ +.-+
T Consensus       252 ~v~~~p~~~~~~~i~~~~~l~~~~~c~~~~~Q~a~~~al~~~~~~~~~~~~~~rl~~~Rd~~~~~L~----~i~g-~~~~  326 (404)
T PRK09265        252 MVLSGPKKHAKGYIEGLDMLASMRLCANVPAQHAIQTALGGYQSINELILPGGRLYEQRDRAWELLN----AIPG-VSCV  326 (404)
T ss_pred             EEECCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH----HCCC-CEEC
T ss_conf             9952919999999999998854015688289999999973831299999999999999999999997----3899-5756


Q ss_pred             CCCEEEEEE-EEC------CCHHHHHH-HHHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             464009998-724------99899999-999689899626------89889955898688999999999999999985
Q gi|254780432|r  327 RGQGLLIGL-KTV------FSPALLAA-KFRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       327 RG~Gl~~~i-e~~------~~~~~~~~-~l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +-.|.|..+ .+.      .++..++. .+.+.||.+.|.      +++.+|++  +..++++|.+++++|++.+.+.
T Consensus       327 ~P~Gafy~f~~l~~~~~~~~d~~~f~~~Ll~e~gV~v~PG~~Fg~~~~~~vRls--f~~~~e~l~eal~Rl~~~l~~~  402 (404)
T PRK09265        327 KPKGALYAFPKLDPKVYPIHDDEKFVLDLLLQEKVLLVQGTGFNWPEPDHFRIV--TLPRVDDLEDAIGRIGRFLSGY  402 (404)
T ss_pred             CCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCCCEEEEE--ECCCHHHHHHHHHHHHHHHHHH
T ss_conf             898389983087733179999999999999869999977850288999989999--7999999999999999999984


No 179
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism]
Probab=99.52  E-value=4.3e-12  Score=99.49  Aligned_cols=333  Identities=20%  Similarity=0.214  Sum_probs=201.9

Q ss_pred             CEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHHCC----CCC-CCCCCCCCCCHHH
Q ss_conf             764641022674357878999999999999731--450687578189999986520101----333-1235655540356
Q gi|254780432|r   32 IPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQEIFANHLIHSTF----ADR-VFFTNSGAESVEC  104 (392)
Q Consensus        32 ~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~--~~~~~~~~~~~~~~la~~L~~~~~----~~~-v~f~~SGseA~e~  104 (392)
                      .+.||+..|--  .+ ..++.+.+++.+++...  .++......+.+...++.+....+    .+. +..+++++||.-.
T Consensus        28 ~~vi~l~iG~P--d~-~~p~~i~~a~~~a~~~~~~~Y~~~~G~~~LReaia~~~~~~~~~~~~~~~eiivt~Ga~~al~~  104 (393)
T COG0436          28 EDVIDLSIGEP--DF-PTPEHIIEAAIEALEEGGTHYTPSAGIPELREAIAEKYKRRYGLDVDPEEEIIVTAGAKEALFL  104 (393)
T ss_pred             CCEEECCCCCC--CC-CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEECCCHHHHHHH
T ss_conf             86797568899--99-9869999999999865677778876779999999999887539988976628982667999999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-C
Q ss_conf             777665432001347860023435465654321234553211347999864333222100268875410123322223-3
Q gi|254780432|r  105 AIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI-E  183 (392)
Q Consensus       105 Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~-E  183 (392)
                      ++..--       .+|.. ||..+.+|-..........+.+..-    |....- .-...|++.+++.+.+++-++++ -
T Consensus       105 a~~al~-------~pGDe-Vlip~P~Y~~y~~~~~~~gg~~v~v----~l~~~~-~~f~~d~~~l~~~i~~ktk~i~ln~  171 (393)
T COG0436         105 AFLALL-------NPGDE-VLIPDPGYPSYEAAVKLAGGKPVPV----PLDEEE-NGFKPDLEDLEAAITPKTKAIILNS  171 (393)
T ss_pred             HHHHHC-------CCCCE-EEECCCCCCCHHHHHHHCCCEEEEE----CCCCCC-CCCCCCHHHHHHHCCCCCEEEEEEC
T ss_conf             999971-------89988-9983899825599998779979872----166665-5874799999864774645999979


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCC--C----EEECCCCCC-CCCCCCCC
Q ss_conf             3222211246210123221102234572131011003444455531011124545--3----021034444-44344321
Q gi|254780432|r  184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP--D----IMTIAKGMG-GGFPIGAC  256 (392)
Q Consensus       184 pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~P--D----i~~~gK~l~-gG~P~sav  256 (392)
                      |=.=. |. .++++.++.+.++|++||+.+|.|||..+|.-.|..+.+ -..+.+  |    +-.+||..+ .|.=+|-+
T Consensus       172 PnNPT-Ga-v~~~~~l~~i~~~a~~~~i~ii~DE~Y~~l~yd~~~~~s-~~~~~~~~~~~I~i~s~SK~~~mtG~RiG~~  248 (393)
T COG0436         172 PNNPT-GA-VYSKEELKAIVELAREHDIIIISDEIYEELVYDGAEHPS-ILELAGARDRTITINSFSKTYGMTGWRIGWV  248 (393)
T ss_pred             CCCCC-CC-CCCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCC-HHHCCCCCCEEEEEECCCCCCCCCCCCEEEE
T ss_conf             99966-77-889999999999999879299996364436268987777-5442787641899945633578836121899


Q ss_pred             CCC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHH----HHHCCHHHHHHHHHHHHCCCEEEEEC-CCE
Q ss_conf             000-111222223322345321111001233455432012221011----21000026889999886797075504-640
Q gi|254780432|r  257 LAT-NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV----INIAKILFEGLTAIKNRFPNMFLEVR-GQG  330 (392)
Q Consensus       257 ~~~-~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~----~~~g~~l~~~L~~l~~~~~~~v~~vR-G~G  330 (392)
                      ++. +++.+.........+++.+..+-.+|.++|+.-++.+..+..    +++-+.+.+.|.+    .++ +.-+. -.|
T Consensus       249 v~~~~~l~~~~~~l~~~~~~~~~~~~Q~aa~~aL~~~~~~~~~~~~~~~~~~rr~~l~~~l~~----~~g-~~~~~~p~G  323 (393)
T COG0436         249 VGPPEELIAALRKLKSYLTSCAPTPAQYAAIAALNGPQSDEVVEEMREEYRERRDLLVEALNE----IGG-LSVVKPPEG  323 (393)
T ss_pred             EECHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHH----CCC-EEEECCCCC
T ss_conf             727699999999999872368778999999999567663058999999999999999999975----588-665138886


Q ss_pred             EEEEE-EEC--CCHHHHHHHHH-HCCEEEEEC-------CCCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             09998-724--99899999999-689899626-------89889955898688999999999999999985
Q gi|254780432|r  331 LLIGL-KTV--FSPALLAAKFR-DECLLTAPS-------SDNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       331 l~~~i-e~~--~~~~~~~~~l~-~~Gll~~~~-------~~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      -|..+ ++.  .++..++.+++ +.||.+.|.       +.+.+|++  +.-+++++.++++++.+.+.+.
T Consensus       324 a~y~~~~i~~~~d~~~f~~~Ll~~~gV~v~PG~~Fg~~~g~~~vRis--~~~~~~~l~~a~~rl~~~~~~~  392 (393)
T COG0436         324 AFYLFPKIPELLDSEEFAKKLLEEAGVAVVPGSGFGEPPGEGYVRLS--LATSEETLEEALRRLARFLAEY  392 (393)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCEEEECHHHHCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHC
T ss_conf             45997657998998999999998679999572574978779879999--7368999999999999998610


No 180
>PRK08153 histidinol-phosphate aminotransferase; Provisional
Probab=99.51  E-value=4.5e-12  Score=99.38  Aligned_cols=317  Identities=14%  Similarity=0.194  Sum_probs=194.7

Q ss_pred             EECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             641022674357878999999999999731450687578189999986520101--333123565554035677766543
Q gi|254780432|r   35 LDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRY  112 (392)
Q Consensus        35 iD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aiklar~~  112 (392)
                      +-+.++  =+.+|-+ |++++||++.+..+    +.|..+...+|-+.|.+..+  .+.+..+|+.+|..+..++..-  
T Consensus        36 ikL~sN--ENP~gps-p~v~~Ai~~~~~~~----~rYPd~~~~~Lr~~lA~~~gv~~e~I~~gnGSdeli~~~~~a~~--  106 (370)
T PRK08153         36 ARIGAN--ESGFGPS-PSVIAAMREAAAEV----WKYGDPENHDLRHALAAHHGVAPENIMVGEGIDGLLGLIVRLYV--  106 (370)
T ss_pred             EEECCC--CCCCCCC-HHHHHHHHHHHHHC----CCCCCCCHHHHHHHHHHHHCCCHHHEEEECCHHHHHHHHHHHHH--
T ss_conf             786899--9998989-99999999768645----67999778999999999868786679980888999999999985--


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHC-CCCCCC-CCCCCCCCCCC
Q ss_conf             2001347860023435465654321234553211347999864333222100268875410-123322-22333222211
Q gi|254780432|r  113 HYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SNDTAA-ILIEPIQGEGG  190 (392)
Q Consensus       113 ~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~-~~~iAa-vi~Epv~g~~G  190 (392)
                           .+|+. ++....+|---...+....+.. ..-   |...     .+.|++.+.+.. .+++.. +|..|=.=. |
T Consensus       107 -----~~g~~-vv~~~p~y~~y~~~~~~~g~~~-~~v---p~~~-----~~~d~~~~l~~~~~~~~klv~l~nPNNPT-G  170 (370)
T PRK08153        107 -----EPGDA-VVTSLGAYPTFNYHVAGFGGRL-VTV---PYRD-----DHEDLDALLDAARRENAPLVYLANPDNPM-G  170 (370)
T ss_pred             -----CCCCC-CCCCCCCCCHHHHHHHHHCCEE-EEE---ECCC-----CCCCHHHHHHHCCCCCCCEEEECCCCCCC-C
T ss_conf             -----59992-3437887516999999819669-999---4456-----54486999986037897389976895985-7


Q ss_pred             CCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             246210123221102234572131011003444455531011124545302---1034444-443443210001112222
Q gi|254780432|r  191 VRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GGFPIGACLATNEVAACM  266 (392)
Q Consensus       191 ~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~i~~~~  266 (392)
                      . ..+.+.+..+.+.|.+ ++++|+||-.--|..-..+-  ....-.|.++   ||||..| .|+=+|..+++.++.+.+
T Consensus       171 ~-~~~~~~l~~l~~~~~~-~~lvVvDEAY~ef~~~~~~~--~l~~~~~NliVlRTfSK~ygLAGlRlGY~ia~~~li~~l  246 (370)
T PRK08153        171 S-WHPAADIVAFIEALPE-TTLLVLDEAYCETAPASAAP--PIDPDDPNVIRMRTFSKAYGLAGARVGYAIGTPGTIKAF  246 (370)
T ss_pred             C-CCCHHHHHHHHHHCCC-CCEEEEEHHHHHHCCCCCHH--HHHHCCCCEEEEEECCHHCCCCCCCCCCCCCCHHHHHHH
T ss_conf             7-6786889999984777-73896215356435642177--887439988999826220378887432013899999999


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCC---HHH
Q ss_conf             23322345321111001233455432012221011210000268899998867970755046400999872499---899
Q gi|254780432|r  267 NQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS---PAL  343 (392)
Q Consensus       267 ~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~~~---~~~  343 (392)
                      ....  ..|+-|.++.+||.++|+   +.+++++..+.-..-++++.+..... ++ .-.-..+=++-+++..+   ...
T Consensus       247 ~k~r--~p~~vn~~aq~aa~aaL~---d~~~~~~~~~~i~~~R~~l~~~l~~~-g~-~~~pS~aNFil~~~~~~~~~a~~  319 (370)
T PRK08153        247 DKVR--NHFGMNRIAQAAALAALK---DQAYLAEVVAKIAAARDRIAAIARAN-GL-TPLPSATNFVAIDCGRDGAFARA  319 (370)
T ss_pred             HHHC--CCCCCCHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCCEEEEECCCCHHHHHH
T ss_conf             9864--898877999999999977---99999999999999999999999868-58-47999787799984897469999


Q ss_pred             HHHHHHHCCEEEEECC----CCEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9999996898996268----9889955898688999999999999999985
Q gi|254780432|r  344 LAAKFRDECLLTAPSS----DNVVRILPPLTITAEEIHEGLERIERTAIKL  390 (392)
Q Consensus       344 ~~~~l~~~Gll~~~~~----~~~irl~Ppl~it~~eid~~i~~l~~al~~L  390 (392)
                      +.+.|+++||+++..+    ++.||++   +=|.+|.++++++|.++|++.
T Consensus       320 l~~~L~~~GIlVR~~~~~~l~~~lRIs---iGt~een~~~l~aL~eiLk~~  367 (370)
T PRK08153        320 VLDGLIARDIFVRMPGVAPLDRCIRVS---VGPEEELDLFAEALPEALKAA  367 (370)
T ss_pred             HHHHHHHCCEEECCCCCCCCCCEEEEE---CCCHHHHHHHHHHHHHHHHHH
T ss_conf             999999789199449988899989997---399999999999999999986


No 181
>PRK08056 threonine-phosphate decarboxylase; Provisional
Probab=99.51  E-value=1.5e-12  Score=102.45  Aligned_cols=320  Identities=17%  Similarity=0.187  Sum_probs=189.4

Q ss_pred             CCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHHH
Q ss_conf             99764641022674357878999999999999731450687578189999986520101--3331235655540356777
Q gi|254780432|r   30 NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIK  107 (392)
Q Consensus        30 dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Aik  107 (392)
                      +-.++|||.++  .+.+|. .|.+.+|+.++++.+    +.|..+...+|.+.|.+..+  .+.+..+|+.+|.....++
T Consensus        18 ~~~~iidlssN--eNP~g~-p~~v~~ai~~~~~~~----~rYPd~~~~~Lr~~iA~~~gv~~~~I~vgnGs~Eli~~i~~   90 (356)
T PRK08056         18 SPDQLLDFSAN--INPLGM-PVSVKRALIDNLDCI----ERYPDADYFHLHQALARHHQVPASWILAGNGETESIFTVAS   90 (356)
T ss_pred             CHHHEEEECCC--CCCCCC-CHHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHH
T ss_conf             97667773799--999899-999999999747577----41998248999999999829888998875878999999998


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCC-CCCCCCC
Q ss_conf             665432001347860023435465654321234553211347999864333222100268875410123322-2233322
Q gi|254780432|r  108 TARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAA-ILIEPIQ  186 (392)
Q Consensus       108 lar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAa-vi~Epv~  186 (392)
                         ..     .+++..|  ...+|-.-...+ ...|-....-   |..+.   ..+...+.+.+.+..++.. +|.-|=-
T Consensus        91 ---~~-----~~~~~~i--~~Ptf~~Y~~~a-~~~g~~v~~~---~l~~~---~~~~~~~~~~~~~~~~~~lv~i~nPNN  153 (356)
T PRK08056         91 ---GL-----KPRRAMI--VTPGFAEYGRAL-AQVGCEIRRW---SLREA---DGWQLTDAILEALTPDLDCLFLCTPNN  153 (356)
T ss_pred             ---HC-----CCCCEEE--ECCCHHHHHHHH-HHCCCEEEEE---ECCHH---HCCCCCHHHHHHCCCCCCEEEECCCCC
T ss_conf             ---54-----8996699--788749999999-9859769998---67733---158976999973367888899818999


Q ss_pred             CCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCCC-CCCCCCCCCCCC-
Q ss_conf             2211246210123221102234572131011003444455531011124545302---10344444-434432100011-
Q gi|254780432|r  187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMGG-GFPIGACLATNE-  261 (392)
Q Consensus       187 g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~g-G~P~sav~~~~~-  261 (392)
                      =. | ..++.+-++.+.+.|+++++++|+||...-|-.-..-+. ....--|.++   +|+|..|- |+-+|.+++.++ 
T Consensus       154 PT-G-~~~~~~~l~~l~~~~~~~~~~vvvDEAY~ef~~~~~s~~-~~~~~~~nlivlrTfSK~~glaGlRiGy~i~~~~~  230 (356)
T PRK08056        154 PT-G-LLPERQLLQAIADRCKSLNINLILDEAFIDFIPHETGFI-PALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDA  230 (356)
T ss_pred             CC-C-CCCCHHHHHHHHHHHHCCCEEEEEEHHHHHHCCCCCCHH-HHHHCCCCEEEEEECCHHCCCCCCCHHHHHCCCHH
T ss_conf             98-8-758999999999872404939997445576435861357-99845997899841416406852000111058899


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHH----HHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEE
Q ss_conf             12222233223453211110012334554320122210112----10000268899998867970755046400999872
Q gi|254780432|r  262 VAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI----NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT  337 (392)
Q Consensus       262 i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~----~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~  337 (392)
                      +.+.++...  ..|+-|.++.++|.++|+   +.++++...    +-.+++.+.|++    .+++ .-.....-++-+++
T Consensus       231 ~i~~l~~~~--~p~~vn~~a~~aa~~al~---d~~~~~~~~~~i~~~r~~l~~~L~~----l~g~-~v~ps~aNFil~~~  300 (356)
T PRK08056        231 AVARMRRQQ--MPWSINALAALAGEVALQ---DSAWQQATWHWLREEGARFYQALCQ----LPLL-TVYPGRANYLLLRC  300 (356)
T ss_pred             HHHHHHHHC--CCCCCCHHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHC----CCCC-EECCCCCCEEEEEC
T ss_conf             999999615--899811999999999836---9999999999999999999999865----8997-88989887899988


Q ss_pred             CCCHHHHHHHHHHCCEEEEECC------CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             4998999999996898996268------988995589868899999999999999998
Q gi|254780432|r  338 VFSPALLAAKFRDECLLTAPSS------DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       338 ~~~~~~~~~~l~~~Gll~~~~~------~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      ..+...+.+.|+++|++++.+.      ++.+|++   +=|.+|-++++++|++.|..
T Consensus       301 ~~~~~~~~~~L~~~gIlVR~~~~f~gl~~~~lRis---igt~~en~~ll~aL~~iL~g  355 (356)
T PRK08056        301 EREDIDLQRRLLTQRILIRSCANYPGLDSRYYRVA---IRSAAQNERLLAALRNVLTG  355 (356)
T ss_pred             CCCHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE---CCCHHHHHHHHHHHHHHHCC
T ss_conf             99999999999968909976788899999989997---59999999999999999737


No 182
>PRK02948 cysteine desulfurase; Provisional
Probab=99.50  E-value=1.9e-12  Score=101.80  Aligned_cols=324  Identities=17%  Similarity=0.202  Sum_probs=179.7

Q ss_pred             EEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHH-------HHHHHHHHHCC--CCCCCCCCCCCCCHHH
Q ss_conf             46410226743578789999999999997314506875781899-------99986520101--3331235655540356
Q gi|254780432|r   34 FLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE-------IFANHLIHSTF--ADRVFFTNSGAESVEC  104 (392)
Q Consensus        34 yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~-------~la~~L~~~~~--~~~v~f~~SGseA~e~  104 (392)
                      |+|-.+.   +   .-.|++++++.+.+...+. ++...|....       +.-+++.+..+  .+.+.|+.++||++-.
T Consensus         3 YlD~aAt---t---p~~~~v~~a~~~~~~~~~~-N~~s~h~~~~~a~~~~e~aR~~ia~~lga~~~~IvFTsg~Tes~nl   75 (381)
T PRK02948          3 YLDYAAT---T---PMSEEALQTYQKAASQYFG-NESSLHDIGGTASSLLQVCRKTFAEMIGGKEQGVYFTSGGTESNYL   75 (381)
T ss_pred             ECCCCCC---C---CCCHHHHHHHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHH
T ss_conf             5476245---9---9999999999999987068-9851417999999999999999999809997808992887699999


Q ss_pred             HHHHH-HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             77766-54320013478600234354656543212345532113479998643332221002688754101233222233
Q gi|254780432|r  105 AIKTA-RRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE  183 (392)
Q Consensus       105 Aikla-r~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAavi~E  183 (392)
                      |++-. +.+    ...++ .||+- .-=|-.-...+    ....+.++.-..-.++....-|++.+++.+.+++..|.+-
T Consensus        76 ai~~~~~~~----~~~g~-~ii~s-~~EH~sv~~~~----~~l~~~G~~v~~i~~d~~G~id~~~l~~~l~~~t~LV~v~  145 (381)
T PRK02948         76 AIQSLLNAL----PQNKK-HIITT-PMEHASIHSYF----QSLESQGYTVTEIPVDKSGLIRLVDLERAITEDTVLASIQ  145 (381)
T ss_pred             HHHHHHHHH----CCCCC-EEEEC-CCCCCHHHHHH----HHHHHCCCEEEEECCCCCCCCCHHHHHHHCCCCCEEEEEE
T ss_conf             999999970----57999-89974-64220078999----9999729989996778888769999997568994699997


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECC--CCCCCCCCCCCCCCCCC
Q ss_conf             3222211246210123221102234572131011003444455531011124545302103--44444434432100011
Q gi|254780432|r  184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA--KGMGGGFPIGACLATNE  261 (392)
Q Consensus       184 pv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~g--K~l~gG~P~sav~~~~~  261 (392)
                      -+..+-|.+.|    ++.+.++|+++|+++++|=+|. +|+.-  .-.+.  +..|+++++  | +.|-.=+|++..+++
T Consensus       146 ~asN~tG~i~p----i~~I~~~a~~~g~~~~vDa~Q~-~g~~~--idv~~--l~~D~~~fS~HK-~~GP~GiG~L~~~~~  215 (381)
T PRK02948        146 HANSEIGTIQP----IAEIGALLKKYNVLFHSDCVQT-FGKLP--IDVFE--MGIDSLSVSAHK-IYGPKGVGAVYINPQ  215 (381)
T ss_pred             CEEECCCCCCC----HHHHHHHHHHHCCEEEEEHHHH-CCCCC--CCCCC--CCCCEEEEEHHC-CCCCCCEEEEEECCC
T ss_conf             50206864775----8899999987098798465661-46516--65344--677625620000-458872599998789


Q ss_pred             CC-CCCCC-CCC-----CCCCCCCCCCHHHHHHHHHHHHCC--CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCE--
Q ss_conf             12-22223-322-----345321111001233455432012--22101121000026889999886797075504640--
Q gi|254780432|r  262 VA-ACMNQ-GSH-----GSTYGGNVLAMVLGEKVLNIIQSD--GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQG--  330 (392)
Q Consensus       262 i~-~~~~~-~~~-----~~T~~gnpl~~aaa~a~L~~l~~~--~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G--  330 (392)
                      +. ..+-+ +.+     .+|.  |..++++..++++.+.+.  ...++.+++.+++.++|.++.   ..+  .+.|..  
T Consensus       216 ~~~~~~~~g~~~e~~~~~GT~--nv~gi~~l~~A~~~~~~~~~~~~~~~~~L~~~l~~~l~~~~---~~~--~~~~~~~~  288 (381)
T PRK02948        216 VRWKPVFPGTSHEKGFRPGTV--NVPGIAAFLTAAENILKNMQEESLRFKELRSYFLEQIQTLP---LPI--EVEGHSTS  288 (381)
T ss_pred             CCCCCCCCCCCCCCCCCCCCH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC---CCE--EECCCCCC
T ss_conf             865556689887897667867--59999999999999986499999999999999999985479---974--65688634


Q ss_pred             ---EEEEEEEC-CCHHHHHHHHHHCCEEEEEC-----------------C------CCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             ---09998724-99899999999689899626-----------------8------988995589868899999999999
Q gi|254780432|r  331 ---LLIGLKTV-FSPALLAAKFRDECLLTAPS-----------------S------DNVVRILPPLTITAEEIHEGLERI  383 (392)
Q Consensus       331 ---l~~~ie~~-~~~~~~~~~l~~~Gll~~~~-----------------~------~~~irl~Ppl~it~~eid~~i~~l  383 (392)
                         -..++.+. .+...+...+-++|+.++..                 +      ...||++....-|++|||++++.|
T Consensus       289 ~~p~i~~~~~~~~~~~~~~~~l~~~gI~v~~GsaCa~~~~~~s~~l~a~g~~~~~a~~~vRvS~g~ynT~eeId~~i~al  368 (381)
T PRK02948        289 CLPHIIGVTIKGFEGQYTMLECNRRGIAISTGSACQVGKQEPSKTMLAIGKTYEEAKQFVRFSFGQQTTKDQIDTTIHAL  368 (381)
T ss_pred             CCCCEEEEECCCCCHHHHHHHCCCCCCEEECCHHHCCCCCCCCHHHHHCCCCHHHCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             56867887338868899998542168189780452789887008999759987880925999747999999999999999


Q ss_pred             HHHHHHHC
Q ss_conf             99999852
Q gi|254780432|r  384 ERTAIKLS  391 (392)
Q Consensus       384 ~~al~~L~  391 (392)
                      ++...+..
T Consensus       369 ~~i~~~f~  376 (381)
T PRK02948        369 ETIGNQFY  376 (381)
T ss_pred             HHHHHHHH
T ss_conf             99999982


No 183
>PRK09105 putative aminotransferase; Provisional
Probab=99.49  E-value=4.1e-12  Score=99.64  Aligned_cols=315  Identities=17%  Similarity=0.158  Sum_probs=185.9

Q ss_pred             CCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCHHHHH
Q ss_conf             799764641022674357878999999999999731450687578189999986520101--333123565554035677
Q gi|254780432|r   29 ENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAI  106 (392)
Q Consensus        29 ~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~--~~~v~f~~SGseA~e~Ai  106 (392)
                      .+|---|+.  +  =+.+|-+ |.+++|+++++...    +.|..+...+|-+.|.+..+  .+.+.+.|+.+|..+..+
T Consensus        45 ~~g~ikL~s--N--ENP~Gps-p~v~~Ai~~~~~~~----~rYPd~~~~~Lr~~lA~~~gv~~~~I~~gnGSdE~i~~l~  115 (374)
T PRK09105         45 AEGAVFLNF--N--ENPLGPS-AAARAAAARSAALS----GRYLFEMQDELRTLFAAQLGLPVDHLHAYAGSSEPLNYAV  115 (374)
T ss_pred             CCCCEEEEC--C--CCCCCCC-HHHHHHHHHHHHHC----CCCCCCCHHHHHHHHHHHHCCCHHHEEEECCHHHHHHHHH
T ss_conf             999978458--8--8888989-99999999765245----7798986899999999997859024999369999999999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCC-CCCCCCC
Q ss_conf             766543200134786002343546565432123455321134799986433322210026887541012332-2223332
Q gi|254780432|r  107 KTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTA-AILIEPI  185 (392)
Q Consensus       107 klar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iA-avi~Epv  185 (392)
                      +.   +    ..+|+. |+..+.+|---...+. ..|-....   -|..+++    ..|++++.+. ..+.. -+|..|=
T Consensus       116 ~a---f----~~~g~~-vv~~~Ptf~~Y~~~a~-~~g~~v~~---vpl~~d~----~~dl~~l~~~-~~~tklv~l~nPN  178 (374)
T PRK09105        116 LA---F----TSPEAG-LVTADPTYEAGWRAAD-AQGAKVIK---VPLRADG----AHDVRAMLAA-DPNAGLIYICNPN  178 (374)
T ss_pred             HH---H----HCCCCE-EEECCCCHHHHHHHHH-HCCCEEEE---EEECCCC----CCCHHHHHHC-CCCCCEEEECCCC
T ss_conf             99---8----079986-8958887799999999-82977999---8616555----8586889735-7898789978899


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCC
Q ss_conf             22211246210123221102234572131011003444455531011124545302---1034444-4434432100011
Q gi|254780432|r  186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GGFPIGACLATNE  261 (392)
Q Consensus       186 ~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~  261 (392)
                      -= -|.. .+.+-++++.+. ...++++|+||.+.-|..-  ....+...--|+++   ||||..| .|+=+|..+++.+
T Consensus       179 NP-TG~~-~~~~el~~~~~~-~~~~~lvvvDEAY~ef~~~--~s~~~l~~~~~NvivlRTfSKaygLAGlRvGY~ia~~~  253 (374)
T PRK09105        179 NP-TGSV-TPRADIEWLLAH-KPAGSVVLVDEAYIHFSDA--PSVVDLVAQRKDVVVLRTFSKLYGMAGMRLGLAAARPD  253 (374)
T ss_pred             CC-CCCC-CCHHHHHHHHHH-CCCCCEEEEEHHHHHHCCC--CCCHHHHHCCCCEEEEEHHHHHHCCCCCCCCHHHCCHH
T ss_conf             99-8765-799999999971-8988189986267662578--64325674289889982223762665100223108999


Q ss_pred             CCCCCCCCCCCCCCCCCCC---CHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEEC
Q ss_conf             1222223322345321111---0012334554320122210112100002688999988679707550464009998724
Q gi|254780432|r  262 VAACMNQGSHGSTYGGNVL---AMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV  338 (392)
Q Consensus       262 i~~~~~~~~~~~T~~gnpl---~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~  338 (392)
                      +.+.+.+.      ..|++   +.+||.++|   ++++++++..+.-..-++++.+...+. ++ .-....+=++-++..
T Consensus       254 li~~l~~~------~~~~~~~~a~aaa~aaL---~d~~~~~~~~~~~~~~R~~l~~~L~~~-g~-~~~pS~aNFil~~~~  322 (374)
T PRK09105        254 LLAKLARF------GGNPLPVPAAAAGLASL---RDPKLVPQRRAQNAAVREDTIAWLRKQ-GY-ACTPSQANCFMVDVK  322 (374)
T ss_pred             HHHHHHHC------CCCCCCHHHHHHHHHHH---HCHHHHHHHHHHHHHHHHHHHHHHHHC-CC-EECCCCCCEEEEECC
T ss_conf             99999735------88988799999999996---299999999999999999999999978-39-589987857999559


Q ss_pred             CCHHHHHHHHHHCCEEEEEC---CCCEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             99899999999689899626---898899558986889999999999999999
Q gi|254780432|r  339 FSPALLAAKFRDECLLTAPS---SDNVVRILPPLTITAEEIHEGLERIERTAI  388 (392)
Q Consensus       339 ~~~~~~~~~l~~~Gll~~~~---~~~~irl~Ppl~it~~eid~~i~~l~~al~  388 (392)
                      .+...+.+.|.++|++++..   .++.+|++.   =|++|.++++++|+++++
T Consensus       323 ~~a~~~~~~L~~~gIlV~r~~~~~~~~lRISi---Gt~een~~fl~AL~evL~  372 (374)
T PRK09105        323 RPAEVFADAMAKQGVFIGRSWPIWPNWVRVTV---GTEEEMAAFRSAFAKVMR  372 (374)
T ss_pred             CCHHHHHHHHHHCCEEEECCCCCCCCEEEEEC---CCHHHHHHHHHHHHHHHC
T ss_conf             99999999999699799379998899799946---999999999999999866


No 184
>PRK03317 histidinol-phosphate aminotransferase; Provisional
Probab=99.49  E-value=3.6e-12  Score=100.04  Aligned_cols=319  Identities=14%  Similarity=0.159  Sum_probs=191.9

Q ss_pred             EECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHH--------CCCCCCCCCCCCCCCHHHHH
Q ss_conf             6410226743578789999999999997314506875781899999865201--------01333123565554035677
Q gi|254780432|r   35 LDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHS--------TFADRVFFTNSGAESVECAI  106 (392)
Q Consensus        35 iD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~--------~~~~~v~f~~SGseA~e~Ai  106 (392)
                      |.+.++  -+.+|-+ |.+++|+.+.++......+.|..+...+|-+.|.+.        ...+.++.+|+..|+.+..+
T Consensus        29 IkL~~N--ENP~gps-p~~~~ai~~a~~~~~~~~nrYPd~~~~~Lr~alA~~l~~~~~~gv~~e~Ii~gnGSdE~i~~i~  105 (369)
T PRK03317         29 VRLNTN--ENPYPPS-PALVDDIARAVREAAAGLNRYPDRDAVALRTDLAAYLTAQTGVGLGVENVWAANGSNEILQQLL  105 (369)
T ss_pred             EEEECC--CCCCCCC-HHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHEEECCCHHHHHHHHH
T ss_conf             660078--8999999-9999999999997665247289974899999999875030267978778788268999999999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC-CCCC-CCCCC
Q ss_conf             766543200134786002343546565432123455321134799986433322210026887541012-3322-22333
Q gi|254780432|r  107 KTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-DTAA-ILIEP  184 (392)
Q Consensus       107 klar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~-~iAa-vi~Ep  184 (392)
                      +.-       ..+|+ .++....+|-.-...+. ..+-....   -|..++|    .-|++.+.+.+.+ +... +|..|
T Consensus       106 ~af-------~~pGd-~vl~~~Ptf~~Y~~~a~-~~g~~~v~---v~~~~df----~~d~d~l~~ai~~~~~klv~l~nP  169 (369)
T PRK03317        106 QAF-------GGPGR-SALGFVPSYSMHPIIAR-GTHTEWVA---APRAADF----GLDVDAAVAAIREHRPDVVFLTSP  169 (369)
T ss_pred             HHH-------CCCCC-EEEECCCCHHHHHHHHH-HCCCEEEE---ECCCCCC----CCCHHHHHHHHHCCCCCEEEECCC
T ss_conf             998-------28999-89974786027999998-70977999---3678788----839999999863269858997589


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCC
Q ss_conf             222211246210123221102234572131011003444455531011124545302---1034444-443443210001
Q gi|254780432|r  185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GGFPIGACLATN  260 (392)
Q Consensus       185 v~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~  260 (392)
                      =.=. |.. .+.+-++.+.+.|.+  .++|+||...-|-.-+...+.+...--|.++   +|||+.| .|+=+|.+++++
T Consensus       170 NNPT-G~~-~~~~~l~~i~~~~~~--~~vvvDEAY~ef~~~~~~s~~~l~~~~~nlivlRTfSK~~gLAGlRlGy~ia~~  245 (369)
T PRK03317        170 NNPT-GTA-LPLDDVEALLDAAPP--GIVVVDEAYAEFSRQGTPSALTLLPGYPRLVVSRTMSKAFAFAGGRLGYLAAAP  245 (369)
T ss_pred             CCCC-CEE-CCHHHHHHHHHHCCC--CEEEECCCHHHHHCCCCCCHHHHHHCCCCEEEEECCHHHHCCCCHHHEEEECCH
T ss_conf             9987-712-378999999985887--779943877986156887667886137978999410586446653314100699


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCH---HHHHCCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEE
Q ss_conf             1122222332234532111100123345543201222101---1210000268899998867970755046400999872
Q gi|254780432|r  261 EVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN---VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT  337 (392)
Q Consensus       261 ~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~---~~~~g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~  337 (392)
                      ++.+.+....  ..|.-|-++.++|.++|+--  +.+.+.   +++.-+++.+.|+++     ++ .-.-..+=++-+..
T Consensus       246 ~~i~~l~~~~--~p~~vn~~a~~aa~aaL~d~--~~~~~~~~~i~~~R~~l~~~L~~l-----g~-~v~pS~aNFil~~~  315 (369)
T PRK03317        246 AVIDALRLVR--LPYHLSAVTQAAARAALRHA--DETLASVAALRAERDRVVAWLREL-----GF-RVAPSDANFVLFGR  315 (369)
T ss_pred             HHHHHHHHHC--CCCCCCHHHHHHHHHHHHCH--HHHHHHHHHHHHHHHHHHHHHHHC-----CC-EECCCCCCEEEEEC
T ss_conf             9999999844--89886799999999997499--999999999999999999999978-----39-78889887799963


Q ss_pred             CCCHHHHHHHHHHCCEEEEECC-CCEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             4998999999996898996268-988995589868899999999999999998
Q gi|254780432|r  338 VFSPALLAAKFRDECLLTAPSS-DNVVRILPPLTITAEEIHEGLERIERTAIK  389 (392)
Q Consensus       338 ~~~~~~~~~~l~~~Gll~~~~~-~~~irl~Ppl~it~~eid~~i~~l~~al~~  389 (392)
                      ..+...+.++|+++|++++..+ ++.+|++   +=|.+|.+.+++.|++++.+
T Consensus       316 ~~~~~~~~~~L~~~gIlVR~~g~~~~lRis---igt~een~~~l~al~~il~~  365 (369)
T PRK03317        316 FADAHAVWQRLLDRGVLIRDVGIPGWLRVT---IGTPEENDAFLDALAEVLAT  365 (369)
T ss_pred             CCCHHHHHHHHHHCCCEECCCCCCCCEEEE---CCCHHHHHHHHHHHHHHHHC
T ss_conf             799999999999689689228998937996---19999999999999999722


No 185
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones]
Probab=99.47  E-value=2e-11  Score=95.15  Aligned_cols=330  Identities=15%  Similarity=0.175  Sum_probs=192.1

Q ss_pred             CCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCCC-CCCCHH----HHHHHHHHH-HHCC---CCCCCCCCCCCC
Q ss_conf             9764641022674357878999999999999731-45068-757818----999998652-0101---333123565554
Q gi|254780432|r   31 GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL-WHVSN-LYQSTQ----QEIFANHLI-HSTF---ADRVFFTNSGAE  100 (392)
Q Consensus        31 G~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~-~~~~~-~~~~~~----~~~la~~L~-~~~~---~~~v~f~~SGse  100 (392)
                      +--|+|...      .+..+..+++++.+..... ..++. .+....    ..+-+++.+ +..+   .+.+.|+.+-||
T Consensus        22 ~~vylD~aa------~~~~p~~V~~a~~~~~~~~~an~~r~~~~~~~~~t~~~e~aRe~va~~~~a~~~~eIvft~~tT~   95 (405)
T COG0520          22 PLVYLDNAA------TSQKPQAVLDAVAEYYRRYNANVHRGAHTLAEEATDLYEAAREAVARFLNADSSDEIVFTRGTTE   95 (405)
T ss_pred             CCEECCCCC------CCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHH
T ss_conf             847636765------66678899999999999740245755441279999999999999999819998772999598379


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             03567776654320013478600234354656543212345532113479998643332221002688754101233222
Q gi|254780432|r  101 SVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       101 A~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      |.-...+.   +... -..| ..||...--||....--..+..    +.+..-..-.+.....-+++.+++.+.+++-.|
T Consensus        96 aln~va~~---l~~~-~~~g-deIv~s~~EH~sn~~pw~~~~~----~~Ga~v~~i~~~~~g~~~~d~~~~~i~~~Tklv  166 (405)
T COG0520          96 ALNLVARG---LGRS-LKPG-DEIVVSDLEHHSNIVPWQELAK----RTGAKVRVIPLDDDGLLDLDALEKLITPKTKLV  166 (405)
T ss_pred             HHHHHHHH---HHHH-HCCC-CEEEEECCCCCCCHHHHHHHHH----HCCCEEEEEECCCCCCCCHHHHHHHCCCCCEEE
T ss_conf             99999997---0241-0689-9899804655200899999998----759689998418999728899986469994499


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCC---CCCEEECC--CCCCCCCCCCC
Q ss_conf             23332222112462101232211022345721310110034444555310111245---45302103--44444434432
Q gi|254780432|r  181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANV---KPDIMTIA--KGMGGGFPIGA  255 (392)
Q Consensus       181 i~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi---~PDi~~~g--K~l~gG~P~sa  255 (392)
                      .+--++..-|...|    ++.|.++|+++|+++++|=+|.-        ++...++   -.|++++|  |.|.|--.+|+
T Consensus       167 ais~vSn~tG~~~p----v~~I~~la~~~ga~v~VDaaq~~--------~h~~idv~~l~~Df~afsgHKwl~gP~GiGv  234 (405)
T COG0520         167 ALSHVSNVTGTVNP----VKEIAELAHEHGALVLVDAAQAA--------GHLPIDVQELGCDFLAFSGHKWLLGPTGIGV  234 (405)
T ss_pred             EEECCCCCCCCCCC----HHHHHHHHHHCCCEEEEECCCCC--------CCCCCCHHHCCCCEEEECCCCCCCCCCCEEE
T ss_conf             99664167554040----99999999984998999771334--------7566885561898999767432579985299


Q ss_pred             CCCCCCCCCCCCCCCC------------CCCCC--------CC--CCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHH
Q ss_conf             1000111222223322------------34532--------11--11001233455432012221011210000268899
Q gi|254780432|r  256 CLATNEVAACMNQGSH------------GSTYG--------GN--VLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLT  313 (392)
Q Consensus       256 v~~~~~i~~~~~~~~~------------~~T~~--------gn--pl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~  313 (392)
                      +.+++++.+.+.|...            ..|+.        |.  ..+.....++++++++-. .+++.+..+.+.+.+.
T Consensus       235 Ly~r~~~l~~l~P~~~gg~~~~~~~~~~~~~~~~~p~rfe~gTpn~~~~i~l~aAl~~~~~ig-~~~i~~~e~~L~~~~~  313 (405)
T COG0520         235 LYVRKELLEELEPFLGGGGMIEYVSRDEGVTLAELPLRFEAGTPNIAGAIGLAAALDYLLEIG-MEAIEAHERELTEYLL  313 (405)
T ss_pred             EEECHHHHHHCCCCCCCCCCEEECCCCCCCEECCCHHHCCCCCCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHH
T ss_conf             998665584378977788724401445553015641531557843788986999999999857-9999999999999999


Q ss_pred             HHHHHCCCE--EEEEC-CCEEEEEEEECC-CHHHHHHHHHHCCEEEEECCC------------CEEEECCCCCCCHHHHH
Q ss_conf             998867970--75504-640099987249-989999999968989962689------------88995589868899999
Q gi|254780432|r  314 AIKNRFPNM--FLEVR-GQGLLIGLKTVF-SPALLAAKFRDECLLTAPSSD------------NVVRILPPLTITAEEIH  377 (392)
Q Consensus       314 ~l~~~~~~~--v~~vR-G~Gl~~~ie~~~-~~~~~~~~l~~~Gll~~~~~~------------~~irl~Ppl~it~~eid  377 (392)
                      +..++.|++  +..-. .++-++++.+.. .+..+...+-++|+.++....            ..+|.+|.+.-|++|||
T Consensus       314 ~~L~~~~~v~i~g~~~~~r~~~vsF~v~~~~~~dv~~~L~~~gI~vr~g~~ca~p~~~~~~~~~~iR~S~~~YNt~edid  393 (405)
T COG0520         314 EGLSELPGVEIYGPPDADRGGIVSFNVKGIHPHDVATLLDEKGIAVRAGHHCAQPLHRLLGVDATIRASLHLYNTEEDVD  393 (405)
T ss_pred             HHHHCCCCEEEECCCCCCCCCEEEEEECCCCHHHHHHHHHHCCEEEEECCCCCHHHHHHCCCCCCEEEEEECCCCHHHHH
T ss_conf             99854898499646634677469999789598999999986786998256443267875377775799974259999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254780432|r  378 EGLERIERTAI  388 (392)
Q Consensus       378 ~~i~~l~~al~  388 (392)
                      ++++.|++...
T Consensus       394 ~l~~aL~~~~~  404 (405)
T COG0520         394 RLLEALKKALA  404 (405)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999998741


No 186
>PRK07590 L,L-diaminopimelate aminotransferase; Validated
Probab=99.47  E-value=8.3e-12  Score=97.67  Aligned_cols=335  Identities=15%  Similarity=0.165  Sum_probs=175.0

Q ss_pred             EECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCC-------CCCCCCCCHHHHHHHHHHHHHCC----CCCCCCC
Q ss_conf             967997646410226743578789999999999997314-------50687578189999986520101----3331235
Q gi|254780432|r   27 FSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW-------HVSNLYQSTQQEIFANHLIHSTF----ADRVFFT   95 (392)
Q Consensus        27 ~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~-------~~~~~~~~~~~~~la~~L~~~~~----~~~v~f~   95 (392)
                      ...-|++.||+.-|  ---+ -..+.|++|++++++...       +++.....+.+.+.++++.+..+    .+.++.+
T Consensus        29 ~~~~~~dvI~L~iG--ePdf-~tP~~i~eA~~~a~~~~~~~~~~~gYt~~~G~~eLReAIa~~~~~~~g~~~~~~~I~vt  105 (409)
T PRK07590         29 EANPEAKIIRLGIG--DVTQ-PLPPAVIEAMHKAVDEMGTAETFRGYGPEQGYDFLREKIAENDYQARGCDIDAEEIFVS  105 (409)
T ss_pred             HHCCCCCEEECCCC--CCCC-CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHEEEC
T ss_conf             75899986678898--9789-99999999999999830126887858987474999999999999984899876886874


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCHHHHHHH-HHC
Q ss_conf             6555403567776654320013478600234354656543212345532-11347999864333222100268875-410
Q gi|254780432|r   96 NSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK-LQYLEGFGPKIEGFDQAKFCDLQSLK-NQI  173 (392)
Q Consensus        96 ~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~-~~~~~~~~p~~~~~~~~~~~d~~~l~-~~~  173 (392)
                      +++.++.- ++ ++ ..     .+| ..||..+-+|..-.... .+.|. +.... .+ ...++..+|...-..+. +..
T Consensus       106 ~Ga~~~l~-~i-~~-ll-----~pG-DeViip~P~Yp~Y~~~~-~laG~~~~~~~-~~-~~~~~~~~~~~~e~~f~~~~~  173 (409)
T PRK07590        106 DGAKCDTG-NI-LD-IF-----GPD-NTIAVTDPVYPVYVDTN-VMAGRTGEANE-DG-RYEGIVYLPCTAENNFIPELP  173 (409)
T ss_pred             CCHHHHHH-HH-HH-HH-----CCC-CEEEECCCCCCCHHHHH-HHCCCCCCCCC-CC-CCCCEEECCCCHHHCCCCCCC
T ss_conf             86799999-99-99-83-----999-98996688774469899-87488530135-66-556724655883435474356


Q ss_pred             CCCCCCCCC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCC-CC-CCCCCCCC----EEECCCC
Q ss_conf             123322223-33222211246210123221102234572131011003444455531-01-11245453----0210344
Q gi|254780432|r  174 SNDTAAILI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF-AY-EWANVKPD----IMTIAKG  246 (392)
Q Consensus       174 ~~~iAavi~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f-~~-e~~gi~PD----i~~~gK~  246 (392)
                      .+++-++++ -| ..-.| .+.+++.|++|.++|++||+++|.|||...|-.-+... +. +.-+. .|    +-.+||.
T Consensus       174 ~~ktk~iilnsP-~NPTG-~V~s~eel~~i~~~a~~~~i~iisDEiY~~~~~~~~~p~si~~~~~~-~~~~I~i~s~SK~  250 (409)
T PRK07590        174 SEKVDIIYLCFP-NNPTG-TVATKEQLKAWVDYAKANGSLILFDAAYEAFISDPSIPHSIYEIEGA-KECAIEFRSFSKN  250 (409)
T ss_pred             CCCEEEEEECCC-CCCCC-CCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCHHHCCCC-CCCEEEEEECHHH
T ss_conf             546029998489-89956-55799999999999987497899707620013689877577654655-0146897135264


Q ss_pred             CC-CCCCCCCCCCCCCCCCCCCC-----------CCCCCCCCCCC-CCHHHHHHHHHHHHC---CCCCCHHHHHCCHHHH
Q ss_conf             44-44344321000111222223-----------32234532111-100123345543201---2221011210000268
Q gi|254780432|r  247 MG-GGFPIGACLATNEVAACMNQ-----------GSHGSTYGGNV-LAMVLGEKVLNIIQS---DGFLENVINIAKILFE  310 (392)
Q Consensus       247 l~-gG~P~sav~~~~~i~~~~~~-----------~~~~~T~~gnp-l~~aaa~a~L~~l~~---~~l~~~~~~~g~~l~~  310 (392)
                      .+ -|+=+|.+++.++++.....           ..+..||+|-| ..-.||.+.+..-.+   +.+.+..+++-+.+.+
T Consensus       251 ~~mtGwRiG~~v~P~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q~aa~a~l~~~~~~~~~~~~~~y~~rr~~~~~  330 (409)
T PRK07590        251 AGFTGTRCAYTVVPKELKGKDSEGEIVDLNSLWNRRQSTKFNGVSYIVQRGAEAVYSPEGQAQIKELISYYMENAKIIRE  330 (409)
T ss_pred             CCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             07864436989757999988644469999999998750255786899999999996548789999999999999999999


Q ss_pred             HHHHHHHHCCCEEEEECCCEEEE-EEEEC--CCHHHHHHHHH-HCCEEEEEC------CCCEEEECCCCCCCHHHHHHHH
Q ss_conf             89999886797075504640099-98724--99899999999-689899626------8988995589868899999999
Q gi|254780432|r  311 GLTAIKNRFPNMFLEVRGQGLLI-GLKTV--FSPALLAAKFR-DECLLTAPS------SDNVVRILPPLTITAEEIHEGL  380 (392)
Q Consensus       311 ~L~~l~~~~~~~v~~vRG~Gl~~-~ie~~--~~~~~~~~~l~-~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i  380 (392)
                      .|+++     + +.-..+.|.+. =+++.  .++..++.++. +.||.+.|.      +.+.+||+  +..++++|.+++
T Consensus       331 ~L~~~-----g-~~~~~p~gafY~w~~~~~~~~~~ef~~~Ll~e~~Vav~PG~~FG~~g~g~vRls--~a~~~e~l~ea~  402 (409)
T PRK07590        331 GLEAA-----G-FTVYGGVNAPYIWVKTPDGLSSWDFFDKLLQEANVVGTPGSGFGPAGEGYFRLS--AFGSRENVLEAM  402 (409)
T ss_pred             HHHHC-----C-CEEECCCCCEEEEEECCCCCCHHHHHHHHHHHCCEEEECCHHHCCCCCCEEEEE--ECCCHHHHHHHH
T ss_conf             99975-----9-767279972389888999989899999999869999968646589998969999--728999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780432|r  381 ERIERTA  387 (392)
Q Consensus       381 ~~l~~al  387 (392)
                      ++|++.|
T Consensus       403 ~Ri~~~L  409 (409)
T PRK07590        403 ERIKKLL  409 (409)
T ss_pred             HHHHHHC
T ss_conf             9999859


No 187
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism]
Probab=99.46  E-value=9.2e-12  Score=97.38  Aligned_cols=324  Identities=22%  Similarity=0.258  Sum_probs=187.4

Q ss_pred             EEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCC----CCCHHH--HHHHH-HHHHHCC--CCCCCCCCCCCCCHH
Q ss_conf             64641022674357878999999999999731450687----578189--99998-6520101--333123565554035
Q gi|254780432|r   33 PFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL----YQSTQQ--EIFAN-HLIHSTF--ADRVFFTNSGAESVE  103 (392)
Q Consensus        33 ~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~----~~~~~~--~~la~-~L~~~~~--~~~v~f~~SGseA~e  103 (392)
                      -|+|...   ++.   -.|+++++|...++.. +.|+.    +.....  .+-|+ .+.+..+  ...++|+.+|||+|-
T Consensus         3 iYlD~~A---TTp---~~~~v~~~m~~~~~~~-fgNPsS~H~~G~~A~~~ve~AR~~iA~llga~~~eIiFTSG~TEsnN   75 (386)
T COG1104           3 IYLDNAA---TTP---VDPEVLEAMLPYLTEV-FGNPSSLHSFGREARKAVEEAREQIAKLLGADPEEIIFTSGATESNN   75 (386)
T ss_pred             CCCCCCC---CCC---CCHHHHHHHHHHHHHH-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHH
T ss_conf             2555435---688---9899999999998753-18961155757999999999999999983999780899569847777


Q ss_pred             HHHHHH-HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             677766-54320013478600234354656543212345532113--479998643332221002688754101233222
Q gi|254780432|r  104 CAIKTA-RRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQY--LEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI  180 (392)
Q Consensus       104 ~Aikla-r~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~--~~~~~p~~~~~~~~~~~d~~~l~~~~~~~iAav  180 (392)
                      .|||=+ ..+...  ..++ .||+-.= =|=      ++...-.+  +++|.-..-++...-.-|++.+++.+.++...|
T Consensus        76 laI~g~~~a~~~~--~~~~-HIIts~i-EH~------aVl~~~~~Le~~g~~Vtyl~v~~~G~v~~e~L~~al~~~T~LV  145 (386)
T COG1104          76 LAIKGAALAYRNA--QKGK-HIITSAI-EHP------AVLNTCRYLERQGFEVTYLPVDSNGLVDLEQLEEALRPDTILV  145 (386)
T ss_pred             HHHHHHHHHHHCC--CCCC-EEEECCC-CCH------HHHHHHHHHHHCCCEEEEECCCCCCEECHHHHHHHCCCCCEEE
T ss_conf             9998648764235--6898-5887554-349------9999999998669757996888897287999998638884599


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC-CCCCCCCC
Q ss_conf             23332222112462101232211022345721310110034444555310111245453021034444443-44321000
Q gi|254780432|r  181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLAT  259 (392)
Q Consensus       181 i~Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~~~gK~l~gG~-P~sav~~~  259 (392)
                      -+.-+.++-|.+.|    ++.+.++|++++++|.+|=||. +||.=  .-.+.++  -|+++++--==+|. .+|++..+
T Consensus       146 Sim~aNnE~G~IQp----I~ei~~i~k~~~i~fHvDAvQa-~Gkip--i~~~~~~--vD~ls~SaHK~~GpkGiGaLyv~  216 (386)
T COG1104         146 SIMHANNETGTIQP----IAEIGEICKERGILFHVDAVQA-VGKIP--IDLEELG--VDLLSFSAHKFGGPKGIGALYVR  216 (386)
T ss_pred             EEEECCCCEEECCC----HHHHHHHHHHCCCEEEEEHHHH-CCCEE--CCCCCCC--CCEEEEEHHHCCCCCCEEEEEEC
T ss_conf             99850268201120----9999999997598179761332-57600--4602157--65687311213699842799987


Q ss_pred             CCCCCCCCCCCCCCCCC-------CCCCCHHHHHHHHHHHHCC--CCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCCE
Q ss_conf             11122222332234532-------1111001233455432012--22101121000026889999886797075504640
Q gi|254780432|r  260 NEVAACMNQGSHGSTYG-------GNVLAMVLGEKVLNIIQSD--GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQG  330 (392)
Q Consensus       260 ~~i~~~~~~~~~~~T~~-------gnpl~~aaa~a~L~~l~~~--~l~~~~~~~g~~l~~~L~~l~~~~~~~v~~vRG~G  330 (392)
                      +.+  .+.|..||+.+.       -|..+.++.-+++++..++  ...+++..+-++|.++|.+..   |+++  +-|..
T Consensus       217 ~~~--~~~p~i~GGgQE~g~RsGTenv~~Ivg~~~A~~~a~~~~~~~~~~~~~lr~~l~~~l~~~~---p~~~--~~g~~  289 (386)
T COG1104         217 PGV--RLEPLIHGGGQERGLRSGTENVPGIVGFGKAAEIAVEELEEENARLRKLRDRLEDGLLEII---PDVY--LNGDD  289 (386)
T ss_pred             CCC--CCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCEE--ECCCC
T ss_conf             998--7374460476789978887557999999999999998778889999999999999998509---9689--86885


Q ss_pred             -------EEEEEEECCCHHHHHHHHHHCCEEEEE-----CC------------------CCEEEECCCCCCCHHHHHHHH
Q ss_conf             -------099987249989999999968989962-----68------------------988995589868899999999
Q gi|254780432|r  331 -------LLIGLKTVFSPALLAAKFRDECLLTAP-----SS------------------DNVVRILPPLTITAEEIHEGL  380 (392)
Q Consensus       331 -------l~~~ie~~~~~~~~~~~l~~~Gll~~~-----~~------------------~~~irl~Ppl~it~~eid~~i  380 (392)
                             +-++|+.. +.+.+.-.|-.+|+.+..     .+                  ...|||+=.-.-|++|+|.++
T Consensus       290 ~~rlP~~~~~~f~gv-~gE~ll~~L~~~gI~vStGSACsS~~~~pShVL~AmG~~~e~a~~siR~S~g~~tt~eei~~~~  368 (386)
T COG1104         290 EPRLPNILNFSFPGV-EGESLLLALDLAGIAVSTGSACSSGSLEPSHVLRAMGISEELAHGSIRFSLGRFTTEEEIDAAA  368 (386)
T ss_pred             CCCCCCEEEEEECCC-CHHHHHHHCCCCCEEEECCCCCCCCCCCCCHHHHHCCCCHHHHCCCEEEECCCCCCHHHHHHHH
T ss_conf             457898689996897-5789998610408687336434589987149999809996883724899737999899999999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999985
Q gi|254780432|r  381 ERIERTAIKL  390 (392)
Q Consensus       381 ~~l~~al~~L  390 (392)
                      +.+.+.+.+|
T Consensus       369 ~~l~~~i~~l  378 (386)
T COG1104         369 EALKEIIKRL  378 (386)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999998


No 188
>PRK04870 histidinol-phosphate aminotransferase; Provisional
Probab=99.45  E-value=1.7e-11  Score=95.68  Aligned_cols=314  Identities=18%  Similarity=0.204  Sum_probs=189.4

Q ss_pred             CCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCC--C-CCCCCCCCCCCHHHHHH
Q ss_conf             97646410226743578789999999999997314506875781899999865201013--3-31235655540356777
Q gi|254780432|r   31 GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFA--D-RVFFTNSGAESVECAIK  107 (392)
Q Consensus        31 G~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~~~~~~~~~~~la~~L~~~~~~--~-~v~f~~SGseA~e~Aik  107 (392)
                      ....|++.++  -+.+|-. |++.+|+.+.+....  -+.|..+...+|.+.|.+..+.  + .+..+|+.+|+.+..++
T Consensus        25 ~~~~ikL~~N--Enp~g~~-~~v~~ai~~~~~~~~--lnrYPd~~~~~Lr~~lA~~~gv~~~~~Ii~GnGSdElI~~i~~   99 (356)
T PRK04870         25 AAGFVKLDAM--ENPYPLP-AELQAELGERLAEVA--LNRYPDPRAAALKAALRAAMGVPAGADVLLGNGSDELIQLIAL   99 (356)
T ss_pred             CCCCEEEECC--CCCCCCC-HHHHHHHHHHHHCCC--CCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHH
T ss_conf             9998883278--8999989-999999999751224--3779899899999999998687987769981679999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC-CCCCC-CCCCC
Q ss_conf             66543200134786002343546565432123455321134799986433322210026887541012-33222-23332
Q gi|254780432|r  108 TARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-DTAAI-LIEPI  185 (392)
Q Consensus       108 lar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~~-~iAav-i~Epv  185 (392)
                      ..-       .+| ..|+....+|---...+.....+. ..-   |..+++    .-|++++.+.+.+ +...| |.-|=
T Consensus       100 ~~~-------~pg-d~vl~~~Ptf~~Y~~~a~~~g~~~-~~v---pl~~d~----~~d~~~~~~~i~~~~~klv~i~nPN  163 (356)
T PRK04870        100 ACA-------KPG-AKVLAPVPGFVMYRMSAKFAGLEF-VGV---PLTADF----TLDLPAMLAAIAEHRPALVYLAYPN  163 (356)
T ss_pred             HHH-------CCC-CEEEECCCCHHHHHHHHHHCCCEE-EEE---ECCCCC----CCCHHHHHHHHCCCCCCEEEECCCC
T ss_conf             981-------898-989976777668999999829879-998---468765----6212889987414687389976899


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEE---ECCCCCC-CCCCCCCCCCCCC
Q ss_conf             22211246210123221102234572131011003444455531011124545302---1034444-4434432100011
Q gi|254780432|r  186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM---TIAKGMG-GGFPIGACLATNE  261 (392)
Q Consensus       186 ~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~e~~gi~PDi~---~~gK~l~-gG~P~sav~~~~~  261 (392)
                      .= -|.. .+.+   .|+++|++.+.++|+||-..-|..  .-+ .....-.|.++   +||| .| .|+-+|..+++++
T Consensus       164 NP-TG~~-~~~~---~l~~l~~~~~~lvVvDEAY~eF~~--~s~-~~~~~~~~nlivlRTfSK-~glaGlRvGy~ia~~~  234 (356)
T PRK04870        164 NP-TGNL-FDDA---DVEAIIAAAPGLVVIDEAYQPFAG--RSW-LPRAAEFPNVLVMRTVSK-LGLAGLRLGYLAGHPA  234 (356)
T ss_pred             CC-CCCC-CCHH---HHHHHHHCCCCEEEEECCCHHHCC--CCC-CHHHHCCCCEEEEECCCC-CCCCCCCEEEEEECHH
T ss_conf             97-6633-6878---899998506986552254075567--862-101203796899860541-0136566277750999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHH---CCHHHHHHHHHHHHCCCEEEEECCCEEEEEEEEC
Q ss_conf             1222223322345321111001233455432012221011210---0002688999988679707550464009998724
Q gi|254780432|r  262 VAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI---AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV  338 (392)
Q Consensus       262 i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~---g~~l~~~L~~l~~~~~~~v~~vRG~Gl~~~ie~~  338 (392)
                      +.+.+....  ..|.-|.++.++|.++|+--  +.+.+.++.+   -+++.+.|+++    +++ .-....+-++-+++.
T Consensus       235 ~i~~l~k~~--~p~~vn~~a~~aa~~aL~d~--~~~~~~~~~~~~~R~~l~~~L~~l----~g~-~v~pS~aNFil~~~~  305 (356)
T PRK04870        235 WIAELDKVR--PPYNVNVLTQATALFALEHV--DVLDAQAAELRAERTRLAAALAAL----PGV-TVFPSAANFILVRVP  305 (356)
T ss_pred             HHHHHHHHC--CCCCCHHHHHHHHHHHHHCH--HHHHHHHHHHHHHHHHHHHHHHHC----CCC-EECCCCCEEEEEECC
T ss_conf             999997734--89873399999999997495--889999999999999999999836----997-888998808999889


Q ss_pred             CCHHHHHHHHHHCCEEEEEC------CCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99899999999689899626------89889955898688999999999999999
Q gi|254780432|r  339 FSPALLAAKFRDECLLTAPS------SDNVVRILPPLTITAEEIHEGLERIERTA  387 (392)
Q Consensus       339 ~~~~~~~~~l~~~Gll~~~~------~~~~irl~Ppl~it~~eid~~i~~l~~al  387 (392)
                       +...+.+.|+++|++++.+      .++.+|++   +=|.+|.+++++.|+++|
T Consensus       306 -~a~~l~~~L~~~gIlVR~~~~~~~~~~~~lRIs---igt~een~~ll~aLk~~L  356 (356)
T PRK04870        306 -DAAAVFDGLKTRRVLVKNVSGMHPLLANCLRVT---VGSPEENAQFLAALKLAL  356 (356)
T ss_pred             -CHHHHHHHHHHCCEEEEECCCCCCCCCCEEEEE---CCCHHHHHHHHHHHHHHC
T ss_conf             -999999999969909998898888899989998---399999999999999859


No 189
>PRK05839 hypothetical protein; Provisional
Probab=99.45  E-value=5.7e-12  Score=98.72  Aligned_cols=337  Identities=14%  Similarity=0.081  Sum_probs=177.3

Q ss_pred             EECCCEEEECCCCEEEECHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCC-CCCCCHHHHHHHHHHHHHCC----CCCCCC
Q ss_conf             5010379967997646410226743578789999999999997314506-87578189999986520101----333123
Q gi|254780432|r   20 KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-NLYQSTQQEIFANHLIHSTF----ADRVFF   94 (392)
Q Consensus        20 ~a~G~~i~d~dG~~yiD~~~g~~~~~lGh~~p~i~~a~~~q~~~~~~~~-~~~~~~~~~~la~~L~~~~~----~~~v~f   94 (392)
                      ++.-..+.-..|++.||+.-|-  -.+ -..|.|++|+++..+.....+ .....+.+.++++.+.+..+    .+.++.
T Consensus        12 ~~~~~~~~~~~~~dvi~L~iG~--pdf-~~P~~i~~A~~~~~~~~~~Y~~~~G~peLR~Aia~~~~~~~g~~v~~~~I~v   88 (376)
T PRK05839         12 RALLKEITPNKKGELLDLTIGE--PQF-ETPKFIQDALKNNAHLLNKYPKSAGEEELREAQRGFFKRRFNIELKENELIP   88 (376)
T ss_pred             HHHHHHCCCCCCCCEEECCCCC--CCC-CCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             9999741404899848796889--999-9899999999986444897799878299999999999998689998024998


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             56555403567776654320013478600234354656543212345532113479998643332221002688754101
Q gi|254780432|r   95 TNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQIS  174 (392)
Q Consensus        95 ~~SGseA~e~Aiklar~~~~~~g~t~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~~p~~~~~~~~~~~d~~~l~~~~~  174 (392)
                      ++++++|.-....++-.      ......|+..+-.|......+....++...    -|....-..  ..|++..+   .
T Consensus        89 t~Ga~~al~~~~~~~l~------~~~~~~i~~p~P~y~~y~~~~~~~g~~~v~----v~l~~e~~~--~~~l~~~~---~  153 (376)
T PRK05839         89 TFGTREVLFNFPQFVLF------DKQNPTIAYPNPFYQIYEGAAIASRAKSLY----MNLTKENDF--TPSLNEKE---L  153 (376)
T ss_pred             CCCHHHHHHHHHHHHHC------CCCCCEEEECCCCCHHHHHHHHHCCCCCEE----ECCCCCCCC--CCCCCHHH---H
T ss_conf             17889999999999845------799988997898763258999861686324----246402588--86411876---5


Q ss_pred             CCCCCCCC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCC-CCCCC--CC---CEE---ECC
Q ss_conf             23322223-3322221124621012322110223457213101100344445553101-11245--45---302---103
Q gi|254780432|r  175 NDTAAILI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY-EWANV--KP---DIM---TIA  244 (392)
Q Consensus       175 ~~iAavi~-Epv~g~~G~~~~~~~~l~~l~~lc~~~g~llI~DEV~tG~GRtG~~f~~-e~~gi--~P---Di~---~~g  244 (392)
                      .++-++++ -| +.-.|. ..+++-+++|.++|++||+++|.|||...+..-+..... +....  ..   .++   .+|
T Consensus       154 ~~tk~iilnsP-~NPTG~-v~s~eel~~i~~la~~~~~~iisDEiY~~l~~~~~~~s~~~~~~~~~~~~~~~vi~i~s~S  231 (376)
T PRK05839        154 QEVDLVILNSP-NNPTGR-TLSLEELISWVKLALKYDFILINDECYSEIYENTPPPSLLEASILAGNESFKNVLVINSIS  231 (376)
T ss_pred             HCCCEEEECCC-CCCCCC-CCCHHHHHHHHHHHCCCEEEEEEECCHHHHHCCCCCCCHHHHHHHHCCCCCCCEEEEECCH
T ss_conf             05899998899-899882-3639999999875147369999806828863799987688865651455325379992320


Q ss_pred             CCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHCCCEE
Q ss_conf             44444-43443210001112222233223453211110012334554320122210112100002688999988679707
Q gi|254780432|r  245 KGMGG-GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMF  323 (392)
Q Consensus       245 K~l~g-G~P~sav~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~L~~l~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~v  323 (392)
                      |..+. |+=+|.+++.+++++.+.......++ .+|..+.  .++...+.+++.++   .+-+.++++++-+.+ ..+. 
T Consensus       232 K~~~~~G~RiG~i~~~~~~i~~~~~~~~~~~~-~~~~~~q--~aa~~a~~~~~~~~---~~r~~~~~~~~~~~~-~l~~-  303 (376)
T PRK05839        232 KRSSAPGLRSGFIAGDSSILKKYKAYRTYLGC-ASPLPLQ--KAAAVAWLDDEH