BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780432|ref|YP_003064845.1| acetylornithine transaminase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (392 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780432|ref|YP_003064845.1| acetylornithine transaminase protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040109|gb|ACT56905.1| acetylornithine transaminase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 392

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/392 (100%), Positives = 392/392 (100%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ
Sbjct: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN
Sbjct: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI
Sbjct: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI
Sbjct: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN
Sbjct: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD
Sbjct: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTAIKLSH 392
           NVVRILPPLTITAEEIHEGLERIERTAIKLSH
Sbjct: 361 NVVRILPPLTITAEEIHEGLERIERTAIKLSH 392


>gi|315122120|ref|YP_004062609.1| acetylornithine transaminase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495522|gb|ADR52121.1| acetylornithine transaminase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 393

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/391 (82%), Positives = 364/391 (93%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           MN +D LFNTYD++ IRF KGKG+WLFSE+G PFLDFASGIAVNSLGHSHPELV++LKSQ
Sbjct: 1   MNNSDCLFNTYDRAKIRFTKGKGSWLFSEDGTPFLDFASGIAVNSLGHSHPELVSVLKSQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           SEKLWHVSNLYQST+Q+IFANHLI+STFAD+VFFTNSG ESVECAIKTARRYHY  GKTN
Sbjct: 61  SEKLWHVSNLYQSTEQDIFANHLINSTFADKVFFTNSGTESVECAIKTARRYHYTRGKTN 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           KFRIVTFEGAFHGR+LATISA GKL+YLEGFGPKIEGFDQAKFCDLQSL+  I N+TAAI
Sbjct: 121 KFRIVTFEGAFHGRSLATISASGKLKYLEGFGPKIEGFDQAKFCDLQSLEKIIGNETAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEPIQGEGG+RKVP EFLQ+LR+IC++IDALLIFDE+QTG GRTGKLFAYEWA+VKPDI
Sbjct: 181 LIEPIQGEGGIRKVPPEFLQKLREICNNIDALLIFDEIQTGSGRTGKLFAYEWADVKPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           MTIAKG+GGGFP+GACLAT++VA+CM  GSHGSTYGGNVLAMV+G+KVL+IIQSDGFLEN
Sbjct: 241 MTIAKGLGGGFPVGACLATHKVASCMGMGSHGSTYGGNVLAMVIGKKVLDIIQSDGFLEN 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V N++KILFEGLT IKNRFPN+FLEVRGQGLL GL+T FSPA++  + R+E LLTAP+S+
Sbjct: 301 VRNLSKILFEGLTLIKNRFPNVFLEVRGQGLLSGLETAFSPAIVTKELRNERLLTAPASN 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           NVVRILPPLT+TA+EI EGL+RIE  AIKLS
Sbjct: 361 NVVRILPPLTVTADEIREGLKRIESAAIKLS 391


>gi|15887775|ref|NP_353456.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Agrobacterium tumefaciens str. C58]
 gi|28376915|sp|Q8UI71|ARGD_AGRT5 RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|15155347|gb|AAK86241.1| acetylornithine aminotransferase [Agrobacterium tumefaciens str.
           C58]
          Length = 399

 Score =  503 bits (1296), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/385 (60%), Positives = 297/385 (77%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF+T+ ++ +RFE+G+G WLF+E+G  +LDFA+G+AVNSLGH+HP LV  +K+Q+EK+WH
Sbjct: 8   LFDTFARAPLRFERGEGVWLFTESGERYLDFAAGVAVNSLGHAHPHLVEAIKTQAEKVWH 67

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+   QE  A  L  +TFAD+VFFTNSGAE++ECAIKTARRYHY  G   KFRI+T
Sbjct: 68  VSNLYEVPGQEKLAKRLTEATFADKVFFTNSGAEALECAIKTARRYHYSKGHPEKFRIIT 127

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D+ +LK  I+ +TAA+LIEPIQ
Sbjct: 128 FEGAFHGRTLATIAAGGQQKYLEGFGPKVEGFDQVPFGDVDALKAAITAETAALLIEPIQ 187

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R   +EFLQ LR +CD+ D LLIFDEVQTG GRTGK FAYE   V PDIM +AKG
Sbjct: 188 GEGGIRAPAKEFLQLLRSLCDEHDLLLIFDEVQTGVGRTGKFFAYEQTGVAPDIMAVAKG 247

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A+ M  G HG+TYGGN LAM +G  VL+++ +DGFLE V ++A 
Sbjct: 248 IGGGFPLGACLATADAASGMTAGVHGTTYGGNPLAMAVGNAVLDVVLADGFLEKVRDVAL 307

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  +GL ++K+R+P++  E+RG+GLL+G+K       L    R E LL  P+ DNV+R+L
Sbjct: 308 VFRQGLASLKDRYPDVIEEIRGEGLLLGIKARVPSGELLQAMRAEHLLGVPAGDNVIRLL 367

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL  TAEE  EGL R+E  A  L+
Sbjct: 368 PPLVTTAEEAREGLARVEAAAASLT 392


>gi|239831153|ref|ZP_04679482.1| acetylornithine and succinylornithine aminotransferase
           [Ochrobactrum intermedium LMG 3301]
 gi|239823420|gb|EEQ94988.1| acetylornithine and succinylornithine aminotransferase
           [Ochrobactrum intermedium LMG 3301]
          Length = 403

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/385 (60%), Positives = 300/385 (77%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L++TY+++ +RFE+G+G WL +E+G  +LDFA+GIAVNSLGHSHP LV  LK+Q++KLWH
Sbjct: 10  LYDTYNRAALRFERGEGIWLITESGERYLDFAAGIAVNSLGHSHPHLVETLKAQADKLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+Y+   QE     L+ STFAD+VFFTNSGAE++ECAIKTARRYHY++G   +FRIVT
Sbjct: 70  LSNVYEIPAQEKLGRRLVESTFADKVFFTNSGAEALECAIKTARRYHYVSGHPERFRIVT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK++GFDQ  F D  +L+  I+++TA IL+EP+Q
Sbjct: 130 FEGAFHGRTLATIAAGGQAKYLEGFGPKVDGFDQVPFGDEAALRAAITDETAGILLEPVQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  PEEF++ LR+ICD+   LLI DEVQTG GRTGKLFA+EWA +KPDIM +AKG
Sbjct: 190 GEGGLRGFPEEFMRMLRQICDEKGLLLILDEVQTGVGRTGKLFAHEWAGIKPDIMAVAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G HG+TYGGN LAM +G  VL+++ +DGFLENV   A 
Sbjct: 250 IGGGFPMGACLATAEAAKGMTAGVHGTTYGGNPLAMAVGNAVLDVVLADGFLENVQATAL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL +I +R+P++  EVRG+GLLIG+K V     L    RDE  L+  + DNVVR+L
Sbjct: 310 VMKQGLASIIDRYPDVVSEVRGRGLLIGIKCVVPNTSLIQALRDEHFLSVGAGDNVVRLL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL  T EE  E L+RIE    +L+
Sbjct: 370 PPLITTPEEAREALKRIEMAVERLA 394


>gi|153007739|ref|YP_001368954.1| acetylornithine transaminase protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151559627|gb|ABS13125.1| acetylornithine and succinylornithine aminotransferase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 403

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 299/385 (77%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L++TY+++ +RFE+G+G WL +E+G  +LDFA+GIAVNSLGHSHP LV  LK+Q+EKLWH
Sbjct: 10  LYDTYNRAALRFERGEGIWLITESGERYLDFAAGIAVNSLGHSHPHLVETLKTQAEKLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+Y+   QE     L+ STFAD+VFFTNSGAE++ECAIKTARRY Y++G   ++RIVT
Sbjct: 70  LSNVYEIPAQEKLGRRLVESTFADKVFFTNSGAEALECAIKTARRYQYVSGHPERYRIVT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK++GFDQ  F D  +L+  I+++TA IL+EP+Q
Sbjct: 130 FEGAFHGRTLATIAAGGQAKYLEGFGPKVDGFDQVPFGDEAALRAAITDETAGILLEPVQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  PEEF++ LR+ICD+   LLI DEVQTG GRTGKLFA+EWA +KPDIM +AKG
Sbjct: 190 GEGGLRGFPEEFMRMLRQICDEKGLLLILDEVQTGVGRTGKLFAHEWAGIKPDIMAVAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G HG+TYGGN LAM +G  VL+++ +DGFLENV   A 
Sbjct: 250 IGGGFPMGACLATAEAAKGMTAGVHGTTYGGNPLAMAVGNAVLDVVLADGFLENVQATAL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL +I +R+P++  E+RG+GLLIG+K V     L    RDE  L+  + DNVVR+L
Sbjct: 310 VMKQGLASIVDRYPSVVSEIRGRGLLIGIKCVVPNTSLIQALRDEHFLSVGAGDNVVRLL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL  T EE  E L+RIE    +L+
Sbjct: 370 PPLVTTPEEAREALKRIETAVERLA 394


>gi|325291861|ref|YP_004277725.1| acetylornithine aminotransferase [Agrobacterium sp. H13-3]
 gi|325059714|gb|ADY63405.1| acetylornithine aminotransferase [Agrobacterium sp. H13-3]
          Length = 400

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 231/385 (60%), Positives = 297/385 (77%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF+T+ ++ +RFE+G+G WLF+E+G  +LDFA+G+AVNSLGH+HP LV  +K+Q+EK+WH
Sbjct: 8   LFDTFSRAPLRFERGEGVWLFTESGERYLDFAAGVAVNSLGHAHPHLVDAIKTQAEKVWH 67

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+   QE  A  L  +TFAD+VFFTNSGAE++ECAIKTARRYHY  G   KFRIV+
Sbjct: 68  VSNLYEVPGQEKLARRLTEATFADKVFFTNSGAEALECAIKTARRYHYTKGHPEKFRIVS 127

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D+ +LK  I+ +TAA+LIEPIQ
Sbjct: 128 FEGAFHGRTLATIAAGGQQKYLEGFGPKVEGFDQVPFGDVDALKAVITAETAALLIEPIQ 187

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R   +EFLQ LR +CD+   LLIFDEVQTG GRTGKLFAYE   V PDIM +AKG
Sbjct: 188 GEGGIRSPSKEFLQILRGLCDEHGLLLIFDEVQTGVGRTGKLFAYEHTGVAPDIMAVAKG 247

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A+ M  G HG+TYGGN LAM +G  VL+++ S+GFLE V ++A 
Sbjct: 248 IGGGFPLGACLATADAASGMTAGVHGTTYGGNPLAMAVGNAVLDVVLSEGFLEKVRDVAL 307

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  +GL ++K+R+P++  E+RG+GLL+G+K       L    R E LL  P+ DNV+R+L
Sbjct: 308 VFRQGLASLKDRYPDVIEEIRGEGLLLGIKAKIPSGELLQAMRAEHLLGVPAGDNVIRLL 367

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL  TAEE  EGL RI+  A  L+
Sbjct: 368 PPLVTTAEEAREGLARIDAAAASLT 392


>gi|163842586|ref|YP_001626990.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Brucella suis ATCC 23445]
 gi|163673309|gb|ABY37420.1| acetylornithine and succinylornithine aminotransferase [Brucella
           suis ATCC 23445]
          Length = 403

 Score =  496 bits (1276), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 297/385 (77%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L++TY+++ +RFE+G+G WL +E+G  ++DFA+GIAVNSLGHSHP LV  LK+Q+EKLWH
Sbjct: 10  LYDTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEKLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+Y+   QE     L+ STFAD+VFFTNSGAE++ECAIKTARRY Y++G   +FRI+T
Sbjct: 70  LSNVYEIPAQEKLGRRLVESTFADKVFFTNSGAEALECAIKTARRYQYVSGHPERFRIIT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D  +L+  I+ +TA IL+EPIQ
Sbjct: 130 FEGAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQVPFGDEAALRAAITPETAGILLEPIQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  PEEFL+ +R+ICD+   LL+ DEVQTG GRTGKLFA+EWA ++PDIM IAKG
Sbjct: 190 GEGGLRAFPEEFLRLVRQICDENGLLLLLDEVQTGVGRTGKLFAHEWAGIRPDIMAIAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A  M  G HG+TYGGN L M +G  VL+++ +DGF+ENV   A 
Sbjct: 250 IGGGFPIGACLATAEAAKGMTAGMHGTTYGGNPLGMAVGNAVLDVVLADGFMENVQATAL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL ++ +R+PN+  E+RG+GLL+GLK V     L    RDE +L+  + DNVVR+L
Sbjct: 310 VMKQGLASLVDRYPNVVSEIRGRGLLVGLKCVVPNTSLIQALRDEHILSVGAGDNVVRLL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL  T EE  E L+ IE    +LS
Sbjct: 370 PPLITTPEEAREALKHIETAVERLS 394


>gi|17987904|ref|NP_540538.1| acetylornithine transaminase protein [Brucella melitensis bv. 1
           str. 16M]
 gi|23501208|ref|NP_697335.1| acetylornithine transaminase protein [Brucella suis 1330]
 gi|62289295|ref|YP_221088.1| acetylornithine transaminase protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699225|ref|YP_413799.1| acetylornithine transaminase protein [Brucella melitensis biovar
           Abortus 2308]
 gi|148560080|ref|YP_001258338.1| acetylornithine transaminase protein [Brucella ovis ATCC 25840]
 gi|161618282|ref|YP_001592169.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Brucella canis ATCC 23365]
 gi|189023548|ref|YP_001934316.1| acetylornithine transaminase protein [Brucella abortus S19]
 gi|225626827|ref|ZP_03784866.1| acetylornithine and succinylornithine aminotransferase [Brucella
           ceti str. Cudo]
 gi|225851847|ref|YP_002732080.1| acetylornithine transaminase protein [Brucella melitensis ATCC
           23457]
 gi|237814785|ref|ZP_04593783.1| acetylornithine and succinylornithine aminotransferase [Brucella
           abortus str. 2308 A]
 gi|254688613|ref|ZP_05151867.1| acetylornithine transaminase protein [Brucella abortus bv. 6 str.
           870]
 gi|254693095|ref|ZP_05154923.1| acetylornithine transaminase protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696736|ref|ZP_05158564.1| acetylornithine transaminase protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701119|ref|ZP_05162947.1| acetylornithine transaminase protein [Brucella suis bv. 5 str. 513]
 gi|254703668|ref|ZP_05165496.1| acetylornithine transaminase protein [Brucella suis bv. 3 str. 686]
 gi|254707958|ref|ZP_05169786.1| acetylornithine transaminase protein [Brucella pinnipedialis
           M163/99/10]
 gi|254709463|ref|ZP_05171274.1| acetylornithine transaminase protein [Brucella pinnipedialis B2/94]
 gi|254729646|ref|ZP_05188224.1| acetylornithine transaminase protein [Brucella abortus bv. 4 str.
           292]
 gi|256030957|ref|ZP_05444571.1| acetylornithine transaminase protein [Brucella pinnipedialis
           M292/94/1]
 gi|256044028|ref|ZP_05446939.1| acetylornithine transaminase protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256060448|ref|ZP_05450619.1| acetylornithine transaminase protein [Brucella neotomae 5K33]
 gi|256112824|ref|ZP_05453745.1| acetylornithine transaminase protein [Brucella melitensis bv. 3
           str. Ether]
 gi|256159003|ref|ZP_05456840.1| acetylornithine transaminase protein [Brucella ceti M490/95/1]
 gi|256254361|ref|ZP_05459897.1| acetylornithine transaminase protein [Brucella ceti B1/94]
 gi|256256861|ref|ZP_05462397.1| acetylornithine transaminase protein [Brucella abortus bv. 9 str.
           C68]
 gi|256264638|ref|ZP_05467170.1| aminotransferase class-III [Brucella melitensis bv. 2 str. 63/9]
 gi|256368762|ref|YP_003106268.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Brucella microti CCM 4915]
 gi|260168092|ref|ZP_05754903.1| acetylornithine transaminase protein [Brucella sp. F5/99]
 gi|260545950|ref|ZP_05821691.1| aminotransferase [Brucella abortus NCTC 8038]
 gi|260563388|ref|ZP_05833874.1| aminotransferase class-III [Brucella melitensis bv. 1 str. 16M]
 gi|260567079|ref|ZP_05837549.1| aminotransferase class-III [Brucella suis bv. 4 str. 40]
 gi|260754085|ref|ZP_05866433.1| acetylornithine transaminase [Brucella abortus bv. 6 str. 870]
 gi|260757306|ref|ZP_05869654.1| acetylornithine transaminase [Brucella abortus bv. 4 str. 292]
 gi|260761129|ref|ZP_05873472.1| acetylornithine transaminase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883112|ref|ZP_05894726.1| acetylornithine transaminase [Brucella abortus bv. 9 str. C68]
 gi|261213331|ref|ZP_05927612.1| acetylornithine transaminase [Brucella abortus bv. 3 str. Tulya]
 gi|261221523|ref|ZP_05935804.1| acetylornithine transaminase [Brucella ceti B1/94]
 gi|261315449|ref|ZP_05954646.1| acetylornithine transaminase [Brucella pinnipedialis M163/99/10]
 gi|261316986|ref|ZP_05956183.1| acetylornithine transaminase [Brucella pinnipedialis B2/94]
 gi|261324440|ref|ZP_05963637.1| acetylornithine transaminase [Brucella neotomae 5K33]
 gi|261751654|ref|ZP_05995363.1| acetylornithine transaminase [Brucella suis bv. 5 str. 513]
 gi|261754308|ref|ZP_05998017.1| acetylornithine transaminase [Brucella suis bv. 3 str. 686]
 gi|261757543|ref|ZP_06001252.1| aminotransferase class-III [Brucella sp. F5/99]
 gi|265988023|ref|ZP_06100580.1| acetylornithine transaminase [Brucella pinnipedialis M292/94/1]
 gi|265990440|ref|ZP_06102997.1| acetylornithine transaminase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994268|ref|ZP_06106825.1| acetylornithine transaminase [Brucella melitensis bv. 3 str. Ether]
 gi|265997486|ref|ZP_06110043.1| acetylornithine transaminase [Brucella ceti M490/95/1]
 gi|294851689|ref|ZP_06792362.1| acetylornithine aminotransferase [Brucella sp. NVSL 07-0026]
 gi|297247712|ref|ZP_06931430.1| argD; bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase [Brucella
           abortus bv. 5 str. B3196]
 gi|54036739|sp|P63567|ARGD_BRUSU RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|54040811|sp|P63566|ARGD_BRUME RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|17983639|gb|AAL52802.1| acetylornithine aminotransferase [Brucella melitensis bv. 1 str.
           16M]
 gi|23347088|gb|AAN29250.1| acetylornithine aminotransferase, putative [Brucella suis 1330]
 gi|62195427|gb|AAX73727.1| acetylornithine aminotransferase, hypothetical [Brucella abortus
           bv. 1 str. 9-941]
 gi|82615326|emb|CAJ10287.1| Acetylornithine and succinylornithine
           aminotransferase:Aminotransferase class-III [Brucella
           melitensis biovar Abortus 2308]
 gi|148371337|gb|ABQ61316.1| putative acetylornithine aminotransferase [Brucella ovis ATCC
           25840]
 gi|161335093|gb|ABX61398.1| acetylornithine and succinylornithine aminotransferase [Brucella
           canis ATCC 23365]
 gi|189019120|gb|ACD71842.1| Aminotransferase class-III [Brucella abortus S19]
 gi|225618484|gb|EEH15527.1| acetylornithine and succinylornithine aminotransferase [Brucella
           ceti str. Cudo]
 gi|225640212|gb|ACO00126.1| acetylornithine and succinylornithine aminotransferase [Brucella
           melitensis ATCC 23457]
 gi|237789622|gb|EEP63832.1| acetylornithine and succinylornithine aminotransferase [Brucella
           abortus str. 2308 A]
 gi|255998920|gb|ACU47319.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Brucella microti CCM 4915]
 gi|260097357|gb|EEW81232.1| aminotransferase [Brucella abortus NCTC 8038]
 gi|260153404|gb|EEW88496.1| aminotransferase class-III [Brucella melitensis bv. 1 str. 16M]
 gi|260156597|gb|EEW91677.1| aminotransferase class-III [Brucella suis bv. 4 str. 40]
 gi|260667624|gb|EEX54564.1| acetylornithine transaminase [Brucella abortus bv. 4 str. 292]
 gi|260671561|gb|EEX58382.1| acetylornithine transaminase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674193|gb|EEX61014.1| acetylornithine transaminase [Brucella abortus bv. 6 str. 870]
 gi|260872640|gb|EEX79709.1| acetylornithine transaminase [Brucella abortus bv. 9 str. C68]
 gi|260914938|gb|EEX81799.1| acetylornithine transaminase [Brucella abortus bv. 3 str. Tulya]
 gi|260920107|gb|EEX86760.1| acetylornithine transaminase [Brucella ceti B1/94]
 gi|261296209|gb|EEX99705.1| acetylornithine transaminase [Brucella pinnipedialis B2/94]
 gi|261300420|gb|EEY03917.1| acetylornithine transaminase [Brucella neotomae 5K33]
 gi|261304475|gb|EEY07972.1| acetylornithine transaminase [Brucella pinnipedialis M163/99/10]
 gi|261737527|gb|EEY25523.1| aminotransferase class-III [Brucella sp. F5/99]
 gi|261741407|gb|EEY29333.1| acetylornithine transaminase [Brucella suis bv. 5 str. 513]
 gi|261744061|gb|EEY31987.1| acetylornithine transaminase [Brucella suis bv. 3 str. 686]
 gi|262551954|gb|EEZ07944.1| acetylornithine transaminase [Brucella ceti M490/95/1]
 gi|262765381|gb|EEZ11170.1| acetylornithine transaminase [Brucella melitensis bv. 3 str. Ether]
 gi|263001224|gb|EEZ13799.1| acetylornithine transaminase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095005|gb|EEZ18713.1| aminotransferase class-III [Brucella melitensis bv. 2 str. 63/9]
 gi|264660220|gb|EEZ30481.1| acetylornithine transaminase [Brucella pinnipedialis M292/94/1]
 gi|294820278|gb|EFG37277.1| acetylornithine aminotransferase [Brucella sp. NVSL 07-0026]
 gi|297174881|gb|EFH34228.1| argD; bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase [Brucella
           abortus bv. 5 str. B3196]
 gi|326408343|gb|ADZ65408.1| Aminotransferase class-III [Brucella melitensis M28]
 gi|326538057|gb|ADZ86272.1| acetylornithine and succinylornithine aminotransferase [Brucella
           melitensis M5-90]
          Length = 403

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 297/385 (77%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L++TY+++ +RFE+G+G WL +E+G  ++DFA+GIAVNSLGHSHP LV  LK+Q+EKLWH
Sbjct: 10  LYDTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEKLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+Y+   QE     L+ STFAD+VFFTNSGAE++ECAIKTARRY Y++G   +FRI+T
Sbjct: 70  LSNVYEIPAQEKLGRRLVESTFADKVFFTNSGAEALECAIKTARRYQYVSGHPERFRIIT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D  +L+  I+ +TA IL+EPIQ
Sbjct: 130 FEGAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQVPFGDEAALRAAITPETAGILLEPIQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  PEEFL+ +R+ICD+   LL+ DEVQTG GRTGKLFA+EWA ++PDIM IAKG
Sbjct: 190 GEGGLRAFPEEFLRLVRQICDENGLLLLLDEVQTGVGRTGKLFAHEWAGIRPDIMAIAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A  M  G HG+TYGGN L M +G  VL+++ +DGF+ENV   A 
Sbjct: 250 IGGGFPIGACLATAEAAKGMTAGMHGTTYGGNPLGMAVGNAVLDVVLADGFMENVQATAL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL ++ +R+PN+  E+RG+GLL+GLK V     L    RDE +L+  + DNVVR+L
Sbjct: 310 VMKQGLASLVDRYPNVVSEIRGRGLLMGLKCVVPNTSLIQALRDEHILSVGAGDNVVRLL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL  T EE  E L+ IE    +LS
Sbjct: 370 PPLITTPEEAREALKHIETAVERLS 394


>gi|254718494|ref|ZP_05180305.1| acetylornithine transaminase protein [Brucella sp. 83/13]
 gi|265983464|ref|ZP_06096199.1| acetylornithine transaminase [Brucella sp. 83/13]
 gi|306838301|ref|ZP_07471147.1| acetylornithine and succinylornithine aminotransferase [Brucella
           sp. NF 2653]
 gi|264662056|gb|EEZ32317.1| acetylornithine transaminase [Brucella sp. 83/13]
 gi|306406592|gb|EFM62825.1| acetylornithine and succinylornithine aminotransferase [Brucella
           sp. NF 2653]
          Length = 403

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 227/385 (58%), Positives = 297/385 (77%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L++TY+++ +RFE+G+G WL +E+G  ++DFA+GIAVNSLGHSHP LV  LK+Q+EKLWH
Sbjct: 10  LYDTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEKLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+Y+   QE     L+ STFAD+VFFTNSGAE++ECAIKTARRY Y++G   +FRI+T
Sbjct: 70  LSNIYEIPAQEKLGRRLVESTFADKVFFTNSGAEALECAIKTARRYQYVSGHPERFRIIT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D  +L+  I+ +TA IL+EPIQ
Sbjct: 130 FEGAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQVPFGDEAALRAAITPETAGILLEPIQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  PEEFL+ +R+ICD+   LL+ DEVQTG GRTGKLFA+EWA ++PDIM +AKG
Sbjct: 190 GEGGLRAFPEEFLRLVRQICDENGLLLLLDEVQTGVGRTGKLFAHEWAGIRPDIMAVAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A  M  G HG+TYGGN L M +G  VL+++ +DGF+ENV   A 
Sbjct: 250 IGGGFPIGACLATAEAAKGMTAGMHGTTYGGNPLGMAVGNAVLDVVLADGFMENVQATAL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL ++ +R+PN+  E+RG+GLL+GLK V     L    RDE +L+  + DNVVR+L
Sbjct: 310 VMKQGLASLVDRYPNVVSEIRGRGLLMGLKCVVPNTSLIQALRDEHVLSVGAGDNVVRLL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL  T EE  E L+ IE    +LS
Sbjct: 370 PPLITTPEEAREALKHIETAVERLS 394


>gi|254713118|ref|ZP_05174929.1| acetylornithine transaminase protein [Brucella ceti M644/93/1]
 gi|254716528|ref|ZP_05178339.1| acetylornithine transaminase protein [Brucella ceti M13/05/1]
 gi|261218324|ref|ZP_05932605.1| acetylornithine transaminase [Brucella ceti M13/05/1]
 gi|261320827|ref|ZP_05960024.1| acetylornithine transaminase [Brucella ceti M644/93/1]
 gi|260923413|gb|EEX89981.1| acetylornithine transaminase [Brucella ceti M13/05/1]
 gi|261293517|gb|EEX97013.1| acetylornithine transaminase [Brucella ceti M644/93/1]
          Length = 403

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 227/385 (58%), Positives = 296/385 (76%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L++TY+++ +RFE+G+G WL +E+G  ++DFA+GIAVNSLGHSHP LV  LK+Q+EKLWH
Sbjct: 10  LYDTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEKLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+Y+   QE     L+ STFAD+VFFTNSGAE++ECAIKTARRY Y++G   +FRI+T
Sbjct: 70  LSNVYEIPAQEKLGRRLVESTFADKVFFTNSGAEALECAIKTARRYQYVSGHPERFRIIT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D  +L+  I+ +TA IL+EPIQ
Sbjct: 130 FEGAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQVPFGDEAALRAAITPETAGILLEPIQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  PEEFL+ +R+ICD+   LL+ DEVQTG GRTGKLFA+EWA ++PDIM IAKG
Sbjct: 190 GEGGLRAFPEEFLRLVRQICDENGLLLLLDEVQTGVGRTGKLFAHEWAGIRPDIMAIAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A  M  G HG+TYGGN L M +G  VL+++ +DGF+ENV   A 
Sbjct: 250 IGGGFPIGACLATAEAAKGMTAGMHGTTYGGNPLGMAVGNAVLDVVLADGFMENVQATAL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL ++ +R+PN+  E+RG+ LL+GLK V     L    RDE +L+  + DNVVR+L
Sbjct: 310 VMKQGLASLVDRYPNVVSEIRGRSLLMGLKCVVPNTSLIQALRDEHILSVGAGDNVVRLL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL  T EE  E L+ IE    +LS
Sbjct: 370 PPLITTPEEAREALKHIETAVERLS 394


>gi|306844940|ref|ZP_07477521.1| acetylornithine and succinylornithine aminotransferase [Brucella
           sp. BO1]
 gi|306274572|gb|EFM56361.1| acetylornithine and succinylornithine aminotransferase [Brucella
           sp. BO1]
          Length = 403

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 226/385 (58%), Positives = 296/385 (76%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L++TY+++ +RFE+G+G WL +E+G  ++DFA+GIAVNSLGHSHP LV  LK+Q+EKLWH
Sbjct: 10  LYDTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEKLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+Y+   QE     L+ +TFAD+VFFTNSGAE++ECAIKTARRY Y++G   +FRI+T
Sbjct: 70  LSNIYEIPAQEKLGRRLVENTFADKVFFTNSGAEALECAIKTARRYQYVSGHPERFRIIT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D  +L+  I+ +TA IL+EPIQ
Sbjct: 130 FEGAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQVPFGDEAALRAAITPETAGILLEPIQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  PEEFL+ +R+ICD+   LL+ DEVQTG GRTGK FA+EWA ++PDIM IAKG
Sbjct: 190 GEGGLRAFPEEFLRLVRQICDENGLLLLLDEVQTGVGRTGKFFAHEWAGIRPDIMAIAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A  M  G HG+TYGGN L M +G  VL+++ +DGF+ENV   A 
Sbjct: 250 IGGGFPIGACLATAEAAKGMTAGMHGTTYGGNPLGMAVGNAVLDVVLADGFMENVQATAL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL ++ +R+PN+  E+RG+GLL+GLK V     L    RDE +L+  + DNVVR+L
Sbjct: 310 VMKQGLASLVDRYPNVVSEIRGRGLLMGLKCVVPNTSLIQALRDEHVLSVGAGDNVVRLL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL  T EE  E L+ IE    +LS
Sbjct: 370 PPLITTPEEAREALKHIETAVERLS 394


>gi|222147384|ref|YP_002548341.1| acetylornithine transaminase protein [Agrobacterium vitis S4]
 gi|221734374|gb|ACM35337.1| acetylornithine aminotransferase [Agrobacterium vitis S4]
          Length = 402

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 226/378 (59%), Positives = 290/378 (76%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LFNT+ ++ +RFE+G+G WL++E G  +LDFA G+AV S GHSHP LV  LKSQ+EK+WH
Sbjct: 8   LFNTFSRAPLRFERGEGPWLYTETGEQYLDFAGGVAVTSCGHSHPHLVEALKSQAEKVWH 67

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNLY+   QE  A  L+ +TFAD+VFFTNSGAE++ECAIKTARRYHY  G   KF I+T
Sbjct: 68  LSNLYEVPGQERLAARLVEATFADKVFFTNSGAEALECAIKTARRYHYSKGHPEKFHIIT 127

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRT+ATI+AGG+ +YLEGFGPK  GFDQ  F DL +LK  I++ TAA+LIEPIQ
Sbjct: 128 FEGAFHGRTIATIAAGGQEKYLEGFGPKAPGFDQVPFGDLDALKAAITDSTAALLIEPIQ 187

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R V  EFL++LR ICD+   LLI DEVQ+G GRTGK FA+EWA + PDIM +AKG
Sbjct: 188 GEGGIRVVGSEFLRELRAICDEKGLLLILDEVQSGVGRTGKFFAHEWAGLTPDIMAVAKG 247

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP GACLAT E A+ M  G HG+TYGGN LAM +G  VL+++ +D FL+NV ++A 
Sbjct: 248 IGGGFPFGACLATEEAASGMTAGVHGTTYGGNPLAMAVGNAVLDLVLADDFLQNVRDVAL 307

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           I  +GL  +K+RFP +  +VRG+GL++G+K     + L    R E +L  P+ DNV+R+L
Sbjct: 308 IFRQGLAGLKDRFPGVIEDVRGEGLMLGIKAAVPSSELLHAMRHEHILGVPAGDNVIRLL 367

Query: 367 PPLTITAEEIHEGLERIE 384
           PPLT+TAE+  EGL+RIE
Sbjct: 368 PPLTLTAEQAREGLKRIE 385


>gi|222084786|ref|YP_002543315.1| diaminobutyrate--pyruvate aminotransferase protein [Agrobacterium
           radiobacter K84]
 gi|221722234|gb|ACM25390.1| diaminobutyrate--pyruvate aminotransferase protein [Agrobacterium
           radiobacter K84]
          Length = 399

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 223/387 (57%), Positives = 297/387 (76%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M +   L++TY ++ +RFE+G+G WLF+E G  +LDFA+G+AVNSLGH+HP LVA LK+Q
Sbjct: 1   MAETAPLYDTYMRAPLRFERGEGVWLFTETGERYLDFAAGVAVNSLGHAHPHLVAELKAQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SNLY+   QE  +  L  +TFAD+VFFTNSGAE++ECAIKTARRY +  G   
Sbjct: 61  ADKVWHLSNLYEVPGQEKLSKRLTEATFADKVFFTNSGAEALECAIKTARRYQFSKGHPE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           KF I+TFEGAFHGRT+ATI+AGG+ +YLEGFGPK  GFDQ  F DL +++  +++ TA I
Sbjct: 121 KFHIITFEGAFHGRTIATIAAGGQEKYLEGFGPKAPGFDQVPFGDLDAVRAAVTDATAGI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEP+QGEGG+R    EFL+ LR+ICD+   LLI DEVQ G GRTGKLFA+EW+ V PDI
Sbjct: 181 LIEPVQGEGGIRPATNEFLRGLRQICDEHGLLLILDEVQCGVGRTGKLFAHEWSGVTPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT E A+ M  G+HGSTYGGN LAM +G  VL+I+ +DGFL++
Sbjct: 241 MAVAKGIGGGFPLGACLATAEAASGMKAGTHGSTYGGNPLAMAVGNAVLDIVLADGFLDH 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V +IA +  +GL ++++RFP++  ++RG+GL++G+K     A L    R E LL  P+ D
Sbjct: 301 VRDIALVFRQGLASLQDRFPDIIEDIRGEGLMLGIKAAIPQAELLQAIRAEYLLGVPAGD 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NV+R+LPPL +TAEE  EG+ RIER A
Sbjct: 361 NVIRLLPPLVVTAEEAREGIARIERAA 387


>gi|241202939|ref|YP_002974035.1| acetylornithine transaminase protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856829|gb|ACS54496.1| acetylornithine and succinylornithine aminotransferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 399

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 293/387 (75%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M +   L++TY ++ +RFE+G+G WL +E G  +LDF +G+AV S+GHS+P +V  LK Q
Sbjct: 1   MAEAAPLYDTYSRAPLRFERGEGVWLITETGERYLDFGAGVAVTSVGHSNPHVVGALKEQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SN+Y+   QE  A  L  +TFAD+VFFTNSGAE++ECAIKTARRY +  G   
Sbjct: 61  ADKVWHLSNIYEIPGQERLAKRLTDATFADKVFFTNSGAEALECAIKTARRYQFSKGHPE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +F I+TFEGAFHGRTLATI+AGG+ +YLEGFGPK  GFDQ  F D+++++  I++ TA I
Sbjct: 121 RFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAFGDIEAVRAAITDATAGI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEP+QGEGGVR    EF++ LR++CD+   LLI DEVQTG GRTGKLFA+EW+ V PDI
Sbjct: 181 LIEPVQGEGGVRPATPEFMKALRQLCDENGLLLILDEVQTGVGRTGKLFAHEWSGVTPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT+E A+ M  G+HGSTYGGN LAM +G  VL+II +DGFL+ 
Sbjct: 241 MAVAKGIGGGFPLGACLATSEAASGMKAGTHGSTYGGNPLAMAVGSAVLDIILADGFLQQ 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V ++A +  +GL ++K+R+P++  +VRG+GLL+G+K     A L    R   LL  P+ D
Sbjct: 301 VRDVALVFRQGLASLKDRYPDVIEDVRGEGLLLGIKAAVPSAELLQAIRAAHLLGVPAGD 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NV+R+LPPL +TAEE  EGL R+ER A
Sbjct: 361 NVIRLLPPLVVTAEEAREGLSRVERAA 387


>gi|110632371|ref|YP_672579.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Mesorhizobium sp. BNC1]
 gi|110283355|gb|ABG61414.1| acetylornithine aminotransferase apoenzyme [Chelativorans sp. BNC1]
          Length = 401

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 288/379 (75%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF+T+ +  + FE+G+G+WL + +G  +LDFA+GIAVNSLGH+HP LVA L  Q+ KLWH
Sbjct: 6   LFDTFARLPLSFERGEGSWLITADGTRYLDFAAGIAVNSLGHAHPHLVAALTEQAGKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+   Q      L   +FAD+VFFTNSGAE++ECAIKTARRYHY+ G+ N+FRI+T
Sbjct: 66  VSNLYEIPGQRRLGERLAEHSFADKVFFTNSGAEALECAIKTARRYHYVNGQENRFRIIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F DL++++N I+ +TAAILIEPIQ
Sbjct: 126 FEGAFHGRTLATIAAGGQKKYLEGFGPKVEGFDQLPFGDLRAVENAITPETAAILIEPIQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  P +F+Q LR++CD    LLIFDEVQTG GRTGKLFAYEW  V PDI  IAKG
Sbjct: 186 GEGGIRMPPAQFIQGLRELCDKHGLLLIFDEVQTGIGRTGKLFAYEWTGVAPDIAAIAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G HG+T+GGN LAM +G  VL+++   GFL+ V     
Sbjct: 246 IGGGFPMGACLATEEAAKGMTPGVHGTTFGGNPLAMAVGNAVLDVVLEPGFLDEVSRRGL 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L +GL AI + FP++  E+RG GLL+G++     + L    R+E +L AP+ +NV+R+L
Sbjct: 306 LLKQGLAAIADTFPDIVDEIRGTGLLLGIRCKSPTSALQQALREEGILVAPAGENVLRLL 365

Query: 367 PPLTITAEEIHEGLERIER 385
           PPL +T E+I EGLERI R
Sbjct: 366 PPLNVTDEDIQEGLERIHR 384


>gi|13474700|ref|NP_106269.1| acetylornithine transaminase protein [Mesorhizobium loti
           MAFF303099]
 gi|28376932|sp|Q98BB7|ARGD_RHILO RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|14025455|dbj|BAB52055.1| acetylornithine aminotransferase [Mesorhizobium loti MAFF303099]
          Length = 399

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/384 (57%), Positives = 286/384 (74%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+ T+ ++ + F+ G+G WL ++ G  +LDFA GIAVNSLGHSHP LVA L  Q+ KLWH
Sbjct: 6   LYETFARAPLAFDHGEGTWLVTDKGERYLDFAGGIAVNSLGHSHPHLVAALTEQAAKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+   Q      L+ +TFAD+VFFTNSGAE++ECAIKTARRYH++ G   +FR++T
Sbjct: 66  VSNLYEIPGQSRLGQRLVDATFADKVFFTNSGAEALECAIKTARRYHFVKGHPERFRVIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D+ + +  I+ +TAAILIEP+Q
Sbjct: 126 FEGAFHGRTLATIAAGGQYKYLEGFGPKVEGFDQVGFDDIDAAEKAITPETAAILIEPVQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP + L++LR++CD    LLI+DEVQ G GRTGKLFA+EW+ V PDIM IAKG
Sbjct: 186 GEGGIRPVPTQSLKRLRQLCDQHGLLLIYDEVQCGIGRTGKLFAHEWSGVAPDIMAIAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT+E A  M  G HG+T+GGN LAM +G  VL+++  DGFLE+V   A 
Sbjct: 246 IGGGFPMGACLATDEAAVGMTAGVHGTTFGGNPLAMAVGNAVLDVVLEDGFLEDVQRKAL 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL AI + FP++  ++RG GL++GLK       +    RD+ LL  P+ DNV+R+L
Sbjct: 306 LMKQGLAAIADEFPDVVEDIRGTGLMLGLKCAMPNTKVNMALRDQHLLAVPAGDNVIRLL 365

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPLT+T  EIHE L RI   A  L
Sbjct: 366 PPLTVTDAEIHEALNRIRAGAKGL 389


>gi|260461909|ref|ZP_05810154.1| acetylornithine and succinylornithine aminotransferase
           [Mesorhizobium opportunistum WSM2075]
 gi|259032156|gb|EEW33422.1| acetylornithine and succinylornithine aminotransferase
           [Mesorhizobium opportunistum WSM2075]
          Length = 399

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 217/384 (56%), Positives = 286/384 (74%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF T+ ++ + F+ G+G+WL ++ G  +LDFA GIAVNSLGH HP L+A L  Q+ KLWH
Sbjct: 6   LFETFSRAPLAFDHGEGSWLVTDKGERYLDFAGGIAVNSLGHGHPHLIAALTEQAAKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+   Q      L  +TFAD+VFFTNSGAE++ECAIKTARRYH++ G   +FR +T
Sbjct: 66  VSNLYEIPGQSRLGERLADATFADKVFFTNSGAEALECAIKTARRYHFVKGHPERFRTIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D+ + +  I+ +TAAILIEP+Q
Sbjct: 126 FEGAFHGRTLATIAAGGQYKYLEGFGPKVEGFDQVGFDDIDAAEKAITPETAAILIEPVQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP + L++LR++CD  D LLI+DEVQ G GRTGKLFA+EW+ V PDIM IAKG
Sbjct: 186 GEGGIRPVPVQSLKRLRQLCDQHDLLLIYDEVQCGIGRTGKLFAHEWSGVTPDIMAIAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT+E A  M  G HG+T+GGN LAM +G  VL+++  +GFLE+V   A 
Sbjct: 246 IGGGFPMGACLATDEAAVGMTAGVHGTTFGGNPLAMAVGNAVLDVVLEEGFLEDVQRKAL 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL A+ + FP +  ++RG GL++GLK     A +    RD+ LL  P+ DNV+R+L
Sbjct: 306 LIKQGLAAVADEFPEVIEDIRGTGLMLGLKCAMPNAKVNMALRDQHLLAVPAGDNVIRLL 365

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPLT+T  EIH+ L+RI   A  L
Sbjct: 366 PPLTVTDSEIHDALDRIRAGAKGL 389


>gi|150395355|ref|YP_001325822.1| acetylornithine transaminase [Sinorhizobium medicae WSM419]
 gi|150026870|gb|ABR58987.1| acetylornithine and succinylornithine aminotransferase
           [Sinorhizobium medicae WSM419]
          Length = 399

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 223/387 (57%), Positives = 296/387 (76%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M     L++TY ++ +RFE+G+G WL +E+G  +LDFA+G+AVNSLGH+HP LV  LK+Q
Sbjct: 1   MAATTPLYDTYMRAPLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SNLY+   QE  A  L   TFADRVFFTNSGAE++ECAIKTARRYHY  G   
Sbjct: 61  ADKVWHLSNLYEIPGQESLARRLTQVTFADRVFFTNSGAEALECAIKTARRYHYAKGHVE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           KF ++TFEGAFHGRT+ATI+AGG+ +Y+EGFGPK  GF Q  F D+ ++K+ I+++TAAI
Sbjct: 121 KFHVITFEGAFHGRTIATIAAGGQQKYIEGFGPKAPGFYQVPFGDIAAVKDAINDETAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           L+EPIQGEGG+R  P+EF+Q LR++CD+   LLI DEVQ+G GRTGKLFA+EWA +KPDI
Sbjct: 181 LVEPIQGEGGIRLAPKEFMQGLRELCDEFGLLLILDEVQSGVGRTGKLFAHEWAGIKPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT   AA M  G+HGSTYGGN LAM +G  VL+++ ++GFLE+
Sbjct: 241 MAVAKGIGGGFPLGACLATEAAAAGMAAGTHGSTYGGNPLAMAVGNAVLDVVLAEGFLEH 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V  +A +  +GL ++K+RFP++  E+RG GL++G+K     A L    RDE LL  P+ +
Sbjct: 301 VREVALVFRQGLASLKDRFPDVIEEIRGDGLMLGIKAKVPTADLLKAIRDEKLLAVPAGE 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NV+R+LPPL  T  E  EGL R+ER A
Sbjct: 361 NVLRLLPPLITTPAEAREGLARLERAA 387


>gi|116250321|ref|YP_766159.1| acetylornithine transaminase protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115254969|emb|CAK06043.1| putative acetylornithine aminotransferase/succinylornithine
           transaminase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 409

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 219/387 (56%), Positives = 293/387 (75%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M +   L++TY ++ +RFE+G+G WL +E+G  +LDF +G+AV S+GHS+P +V  LK Q
Sbjct: 11  MAEAAPLYDTYSRAPLRFERGEGVWLITESGERYLDFGAGVAVTSVGHSNPHVVGALKEQ 70

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SN+Y+   QE  A  L  +TFAD+VFFTNSGAE++ECAIKTARRY +  G   
Sbjct: 71  ADKVWHLSNIYEIPGQERLAKRLTDATFADKVFFTNSGAEALECAIKTARRYQFSKGHPE 130

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +F I+TFEGAFHGRTLATI+AGG+ +YLEGFGPK  GFDQ  F D+++++  I+  TAAI
Sbjct: 131 RFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAFGDIEAVRAAITEATAAI 190

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEP+QGEGGVR    EF++ LR++CDD   LLI DEVQTG GRTGKLFA+EW+ + PDI
Sbjct: 191 LIEPVQGEGGVRPATPEFMKALRQLCDDNGLLLILDEVQTGVGRTGKLFAHEWSGITPDI 250

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT E A+ M  G+HGSTYGGN LAM +G  VL+II +DGFL+ 
Sbjct: 251 MAVAKGIGGGFPLGACLATAEAASGMKAGTHGSTYGGNPLAMAVGSAVLDIILADGFLQQ 310

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V ++A +  +GL ++K+R+P++  ++RG+GLL+G+K     A L    R   LL  P+ D
Sbjct: 311 VRDVALVFRQGLASLKDRYPDVIEDIRGEGLLLGIKAAVPSAELLQAIRAAHLLGVPAGD 370

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NV+R+LPPL +TAEE  EGL RIER A
Sbjct: 371 NVIRLLPPLVVTAEEAREGLVRIERAA 397


>gi|15964270|ref|NP_384623.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Sinorhizobium meliloti 1021]
 gi|307307007|ref|ZP_07586746.1| acetylornithine and succinylornithine aminotransferase
           [Sinorhizobium meliloti BL225C]
 gi|28376926|sp|Q92SA0|ARGD_RHIME RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|15073447|emb|CAC45089.1| Acetylornithine aminotransferase [Sinorhizobium meliloti 1021]
 gi|306901947|gb|EFN32546.1| acetylornithine and succinylornithine aminotransferase
           [Sinorhizobium meliloti BL225C]
          Length = 399

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/391 (56%), Positives = 294/391 (75%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M     L++TY ++ +RFE+G+G WL +E+G  +LDFA+G+AVNSLGH+HP LV  LK+Q
Sbjct: 1   MAATTPLYDTYLRAPLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SNLY+   QE  A  L   TFADRVFFTNSGAE++ECAIKTARRYH+  G   
Sbjct: 61  ADKVWHLSNLYEIAGQESLARRLTQVTFADRVFFTNSGAEALECAIKTARRYHFAKGHVE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           KF ++TFEGAFHGRTLATI+AGG+ +Y+EGFGPK  GF Q  F D+ ++KN I+ +TAAI
Sbjct: 121 KFHVITFEGAFHGRTLATIAAGGQQKYIEGFGPKAPGFYQVPFGDIGAVKNAINEETAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           L+EPIQGEGG+R   +EF+Q LR++CD+   LLI DEVQ+G GRTGKLFA+EWA +KPDI
Sbjct: 181 LVEPIQGEGGIRTASKEFMQGLRELCDEFGLLLILDEVQSGVGRTGKLFAHEWAGIKPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT   AA M  G+HGSTYGGN LAM +G  VL+++ ++GFL+ 
Sbjct: 241 MAVAKGIGGGFPLGACLATEAAAAGMVAGTHGSTYGGNPLAMAVGNAVLDVVLAEGFLDQ 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V  +A +  +GL ++K+RFP++  E+RG GL++G+K     A L    R E LL  P+ +
Sbjct: 301 VREVALVFRQGLASLKDRFPDVIEEIRGDGLMLGIKAKVPSADLLKAIRAEKLLVVPAGE 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           NV+R+LPPL  T  E  EGL R+ER A  +S
Sbjct: 361 NVLRLLPPLITTPAEAREGLARLERAAEAVS 391


>gi|86356170|ref|YP_468062.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Rhizobium etli CFN 42]
 gi|86280272|gb|ABC89335.1| diaminobutyrate--pyruvate aminotransferase protein [Rhizobium etli
           CFN 42]
          Length = 399

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 217/387 (56%), Positives = 295/387 (76%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M +   L++TY ++ +RFE+G+G WL +E+G  +LDF +G+AV S+GH +P +VA LK Q
Sbjct: 1   MAEAAPLYDTYSRAPLRFERGEGVWLITESGERYLDFGAGVAVTSVGHGNPHVVAALKEQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SN+Y+   QE  A  L  +TFAD+VFFTNSGAE++ECAIKTARRY +  G   
Sbjct: 61  ADKVWHLSNIYEIPGQERLAKRLTDATFADKVFFTNSGAEALECAIKTARRYQFSKGHPE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +F I+TFEGAFHGRTLATI+AGG+ +YLEGFGPK  GFDQ  F D+++++  I++ TAAI
Sbjct: 121 RFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVPFGDIEAVRAAITDATAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEP+QGEGGVR    EF++ LR+ICD+   LLI DEVQTG GRTGKLFA+EW+ + PDI
Sbjct: 181 LIEPVQGEGGVRPATTEFMKALRRICDENGLLLILDEVQTGVGRTGKLFAHEWSGITPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT E A+ M  G+HGSTYGGN LAM +G  VL++I ++GFLE+
Sbjct: 241 MAVAKGIGGGFPLGACLATAEAASGMKAGTHGSTYGGNPLAMAVGSAVLDVILAEGFLEH 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V ++A +  +GL ++K+R+P++  ++RG+GLL+G+K     A L    R   LL  P+ D
Sbjct: 301 VRDVALVFRQGLASLKDRYPDVIEDIRGEGLLLGVKAAVPSAELLQAIRAAHLLGVPAGD 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NV+R+LPPL +TAEE  EGL R+ER A
Sbjct: 361 NVIRLLPPLVVTAEEAREGLARLERAA 387


>gi|327190079|gb|EGE57195.1| acetylornithine transaminase protein (diaminobutyrate--pyruvate
           aminotransferase) [Rhizobium etli CNPAF512]
          Length = 399

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 293/387 (75%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M +   L++TY ++ +RFE+G+G WL +E G  +LDF +G+AV S+GHS+P +VA LK Q
Sbjct: 1   MAEAAPLYDTYSRAPLRFERGEGVWLITEGGERYLDFGAGVAVTSVGHSNPHVVAALKEQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SN+Y+   QE  A  L  +TFAD+VFFTNSGAE++ECAIKTARRY +  G   
Sbjct: 61  ADKVWHLSNIYEIPGQERLAKRLTDATFADKVFFTNSGAEALECAIKTARRYQFSKGHPE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +F I+TFEGAFHGRTLATI+AGG+ +YLEGFGPK  GFDQ  F D+ +++  I++ TAAI
Sbjct: 121 RFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAFGDIAAVRAAITDATAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEP+QGEGGVR    EF++ LR+ICD+   LLI DEVQTG GRTGKLFA+EW+ + PDI
Sbjct: 181 LIEPVQGEGGVRPATPEFMKALRQICDENGLLLILDEVQTGVGRTGKLFAHEWSGITPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT E A+ M  G+HGSTYGGN LAM +G  VL++I +DGFL+ 
Sbjct: 241 MAVAKGIGGGFPLGACLATAEAASGMKAGTHGSTYGGNPLAMAVGSAVLDVILADGFLQQ 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V ++A +  +GL ++K+R+P++  ++RG+GLL+G+K     A L    R   LL  P+ D
Sbjct: 301 VRDVALVFRQGLASLKDRYPDVIEDIRGEGLLLGVKAAVPSAELLQAIRAAHLLGVPAGD 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NV+R+LPPL +TAEE  EGL R+ER A
Sbjct: 361 NVIRLLPPLVVTAEEAREGLARLERAA 387


>gi|209547784|ref|YP_002279701.1| acetylornithine transaminase protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533540|gb|ACI53475.1| acetylornithine and succinylornithine aminotransferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 399

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 294/387 (75%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M +   L++TY ++ +RFE+G+G WL +E+G  +LDF +G+AV S+GHS+P +V  LK Q
Sbjct: 1   MAEAAPLYDTYSRAPLRFERGEGVWLITESGERYLDFGAGVAVTSVGHSNPHVVGALKEQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SN+Y+   QE  A  L  +TFAD+VFFTNSGAE++ECAIKTARRY +  G   
Sbjct: 61  ADKVWHLSNIYEIPGQERLAKRLTEATFADKVFFTNSGAEALECAIKTARRYQFSKGHPE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +F I+TFEGAFHGRTLATI+AGG+ +YLEGFGPK  GFDQ  F D+ +++  I++ TAAI
Sbjct: 121 RFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAFGDIDAVRAAITDATAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEP+QGEGGVR    EF++ LR++CD+   LLI DEVQTG GRTGKLFA+EW+ + PDI
Sbjct: 181 LIEPVQGEGGVRPATPEFMKALRQLCDENGLLLILDEVQTGVGRTGKLFAHEWSGITPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT+E A+ M  G+HGSTYGGN LAM +G  VL+II +DGFL+ 
Sbjct: 241 MAVAKGIGGGFPLGACLATSEAASGMKAGTHGSTYGGNPLAMAVGGAVLDIILADGFLQQ 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V ++A +  +GL ++K+R+P++  ++RG+GLL+G+K     A L    R   LL  P+ D
Sbjct: 301 VRDVALVFRQGLASLKDRYPDVIEDIRGEGLLLGVKAAVPSADLLQAIRAAHLLGVPAGD 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NV+R+LPPL +TAEE  EGL RIER A
Sbjct: 361 NVIRLLPPLVVTAEEAREGLARIERAA 387


>gi|190890219|ref|YP_001976761.1| acetylornithine transaminase (diaminobutyrate--pyruvate
           aminotransferase) [Rhizobium etli CIAT 652]
 gi|190695498|gb|ACE89583.1| acetylornithine transaminase protein (diaminobutyrate--pyruvate
           aminotransferase) [Rhizobium etli CIAT 652]
          Length = 399

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 293/387 (75%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M +   L++TY ++ +RFE+G+G WL +E G  +LDF +G+AV S+GHS+P +VA LK Q
Sbjct: 1   MAEAAPLYDTYSRAPLRFERGEGVWLITEGGERYLDFGAGVAVTSVGHSNPHVVAALKEQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SN+Y+   QE  A  L  +TFAD+VFFTNSGAE++ECAIKTARRY +  G   
Sbjct: 61  ADKVWHLSNIYEIPGQERLAKRLTDATFADKVFFTNSGAEALECAIKTARRYQFSKGHPE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +F I+TFEGAFHGRTLATI+AGG+ +YLEGFGPK  GFDQ  F D+ +++  I++ TAAI
Sbjct: 121 RFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAFGDIAAVRAAITDATAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEP+QGEGGVR    EF++ LR+ICD+   LLI DEVQTG GRTGKLFA+EW+ + PDI
Sbjct: 181 LIEPVQGEGGVRPATPEFMKALRQICDENGLLLILDEVQTGVGRTGKLFAHEWSGIAPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT E A+ M  G+HGSTYGGN LAM +G  VL++I +DGFL+ 
Sbjct: 241 MAVAKGIGGGFPLGACLATAEAASGMKAGTHGSTYGGNPLAMAVGSAVLDVILADGFLQQ 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V ++A +  +GL ++K+R+P++  ++RG+GLL+G+K     A L    R   LL  P+ D
Sbjct: 301 VRDVALVFRQGLASLKDRYPDVIEDIRGEGLLLGVKGAVPSAELLQAIRAAHLLGVPAGD 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NV+R+LPPL +TAEE  EGL R+ER A
Sbjct: 361 NVIRLLPPLVVTAEEAREGLARLERAA 387


>gi|307320661|ref|ZP_07600074.1| acetylornithine and succinylornithine aminotransferase
           [Sinorhizobium meliloti AK83]
 gi|306893696|gb|EFN24469.1| acetylornithine and succinylornithine aminotransferase
           [Sinorhizobium meliloti AK83]
          Length = 399

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 221/391 (56%), Positives = 294/391 (75%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M     L++TY ++ +RFE+G+G WL +E+G  +LDFA+G+AVNSLGH+HP LV  LK+Q
Sbjct: 1   MAATTPLYDTYLRAPLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++K+WH+SNLY+   QE  A  L   TFADR+FFTNSGAE++ECAIKTARRYH+  G   
Sbjct: 61  ADKVWHLSNLYEIAGQESLARRLTQVTFADRLFFTNSGAEALECAIKTARRYHFAKGHVE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           KF ++TFEGAFHGRTLATI+AGG+ +Y+EGFGPK  GF Q  F D+ ++KN I+ +TAAI
Sbjct: 121 KFHVITFEGAFHGRTLATIAAGGQQKYIEGFGPKAPGFYQVPFGDIGAVKNAINEETAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           L+EPIQGEGG+R   +EF+Q LR++CD+   LLI DEVQ+G GRTGKLFA+EWA +KPDI
Sbjct: 181 LVEPIQGEGGIRTASKEFMQGLRELCDEFGLLLILDEVQSGVGRTGKLFAHEWAGIKPDI 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT   AA M  G+HGSTYGGN LAM +G  VL+++ ++GFL+ 
Sbjct: 241 MAVAKGIGGGFPLGACLATEAAAAGMVAGTHGSTYGGNPLAMAVGNAVLDVVLAEGFLDQ 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V  +A +  +GL ++K+RFP++  E+RG GL++G+K     A L    R E LL  P+ +
Sbjct: 301 VREVALVFRQGLASLKDRFPDVIEEIRGDGLMLGIKAKVPSADLLKAIRAEKLLVVPAGE 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           NV+R+LPPL  T  E  EGL R+ER A  +S
Sbjct: 361 NVLRLLPPLITTPAEAREGLARLERAAEAVS 391


>gi|319785568|ref|YP_004145044.1| acetylornithine and succinylornithine aminotransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317171456|gb|ADV14994.1| acetylornithine and succinylornithine aminotransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 399

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 216/384 (56%), Positives = 284/384 (73%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+ T+ ++ + F+ G+G WL ++ G  +LDFA GIAVNSLGHSHP LVA L  Q+ KLWH
Sbjct: 6   LYETFARAPLAFDHGEGTWLITDKGERYLDFAGGIAVNSLGHSHPHLVAALTEQAAKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+   Q      L  +TFAD+VFFTNSGAE++ECAIKTARRYH++ G   +FRI+T
Sbjct: 66  VSNLYEIPGQSRLGERLADATFADKVFFTNSGAEALECAIKTARRYHFVKGHPERFRIIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D+ + +  I+ +TAAILIEP+Q
Sbjct: 126 FEGAFHGRTLATIAAGGQYKYLEGFGPKVEGFDQVGFDDIDAAEKAITPETAAILIEPVQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP + L++LR++C+    LLI+DEVQ G GRTGKLFA+EW+ V PDIM IAKG
Sbjct: 186 GEGGIRPVPTQSLKRLRQLCEQHGLLLIYDEVQCGIGRTGKLFAHEWSGVTPDIMAIAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT+E A  M  G HG+T+GGN LAM +G  VL+++  DGFLE+V   A 
Sbjct: 246 IGGGFPMGACLATDEAAVGMTAGVHGTTFGGNPLAMAVGNAVLDVVLEDGFLEDVQRKAL 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ +GL ++ + FP +  ++RG GL++GLK       +    RD+ LL  P+ DNV+R+L
Sbjct: 306 LMKQGLASVADEFPEIIEDIRGAGLMLGLKCAMPNTKVNMALRDQHLLAVPAGDNVIRLL 365

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPLT+T  EIH+ L RI   A  L
Sbjct: 366 PPLTVTDAEIHDALNRIRAGAKGL 389


>gi|163761279|ref|ZP_02168354.1| diaminobutyrate--pyruvate aminotransferase protein [Hoeflea
           phototrophica DFL-43]
 gi|162281436|gb|EDQ31732.1| diaminobutyrate--pyruvate aminotransferase protein [Hoeflea
           phototrophica DFL-43]
          Length = 395

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/385 (56%), Positives = 286/385 (74%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+ TY +S I FE+G G WL +  G  +LDFA GIAV SLGH+HP LV  LKSQ++KLWH
Sbjct: 7   LYETYSRSPIVFERGHGVWLETPAGERYLDFAGGIAVTSLGHTHPHLVEALKSQADKLWH 66

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL +   Q   A  L  +TFAD+VFFTNSGAE++ECAIKTARR+ Y+ G+  ++RI+T
Sbjct: 67  LSNLQEIPDQTRLAERLTEATFADKVFFTNSGAEALECAIKTARRHFYVNGQPQRYRIIT 126

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            EGAFHGRTLATI+AGG+ +YLEGFGPK+EGFDQ  F D +++K  I+++TAAIL+EP+Q
Sbjct: 127 IEGAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQVPFGDHEAIKAAINDETAAILVEPVQ 186

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P+E L+ LR +CD+   LLI DEVQ+G GRTG LFA+EWA + PDIM +AKG
Sbjct: 187 GEGGIRPLPKECLRGLRDLCDEHGILLILDEVQSGVGRTGMLFAHEWAGITPDIMAVAKG 246

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP GACLAT E A  M  G+HG+TYGGN LAM +G  VL+++  D FL +V ++  
Sbjct: 247 IGGGFPFGACLATAEAADGMTLGTHGTTYGGNPLAMAVGNAVLDVVLEDSFLTHVNDVTL 306

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L +GL ++K+R+P++  ++RG GLL G+K   S A L    R+E LL  P+ DNVVR+L
Sbjct: 307 VLRQGLASLKDRYPDLIEDIRGIGLLTGIKCAKSNADLVTAMRNEHLLAVPAGDNVVRLL 366

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL ++ EE+ E L RIE     LS
Sbjct: 367 PPLIVSVEEVREALHRIEAALEMLS 391


>gi|227820736|ref|YP_002824706.1| acetylornithine transaminase protein [Sinorhizobium fredii NGR234]
 gi|227339735|gb|ACP23953.1| acetylornithine aminotransferase [Sinorhizobium fredii NGR234]
          Length = 431

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/383 (57%), Positives = 290/383 (75%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M     L++TY ++ +RFE+G+G WL +E+G  +LDFA+G+AVNSLGH+HP LV  LK+Q
Sbjct: 33  MAATTPLYDTYLRAPLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQ 92

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           +EKLWHVSNLY    QE  A  L   TFADRVFFTNSGAE++ECAIKTARRYH+  G   
Sbjct: 93  AEKLWHVSNLYDVPGQESLARRLTAVTFADRVFFTNSGAEALECAIKTARRYHFAKGHPE 152

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +F ++TFEGAFHGRT+ATI+AGG+ +Y+EGFGPK  GF Q  F D+ ++KN I+++TAAI
Sbjct: 153 RFHVITFEGAFHGRTIATIAAGGQQKYIEGFGPKAPGFYQVPFGDIAAVKNAINDETAAI 212

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           LIEPIQGEGG+R   +EF+Q+LR +CD+   LLI DEVQ G GRTGKLFA+EW+ + PDI
Sbjct: 213 LIEPIQGEGGIRLASKEFMQELRALCDEYGLLLILDEVQCGVGRTGKLFAHEWSGITPDI 272

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M +AKG+GGGFP+GACLAT   AA M  G+HGSTYGGN LAM +G  VL+++ ++GFLEN
Sbjct: 273 MAVAKGIGGGFPLGACLATEAAAAGMVAGTHGSTYGGNPLAMAVGNAVLDVVLAEGFLEN 332

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V ++A +  +GL ++K+RFP++  E+RG GL++G+K     A +    R E LL  P+ +
Sbjct: 333 VRDVALVFRQGLASLKDRFPDVIEEIRGDGLMLGIKAKVPCADVLKAIRAEKLLAVPAGE 392

Query: 361 NVVRILPPLTITAEEIHEGLERI 383
           NV+R+LPPL  TA E  EGL R+
Sbjct: 393 NVLRLLPPLITTAAEAREGLARL 415


>gi|90418943|ref|ZP_01226854.1| acetylornithine aminotransferase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337023|gb|EAS50728.1| acetylornithine aminotransferase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 404

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/386 (55%), Positives = 282/386 (73%), Gaps = 1/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF TY ++ + FE+G G WL + +G  F+DF  GIAVN LGH+HP LV  +K+Q+EKLWH
Sbjct: 11  LFETYARAPLAFERGSGVWLETRDGRRFMDFGGGIAVNCLGHAHPHLVETMKAQAEKLWH 70

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+   Q   A  L  +TFADR FF NSGAE+VECAIKTARRYHY+ G   ++RI+T
Sbjct: 71  VSNLYEIPDQTRMAERLTAATFADRAFFANSGAEAVECAIKTARRYHYVNGAPERYRILT 130

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-DTAAILIEPI 185
           FEGAFHGRTLATI+AGG+ +YLEG+GPK+EGFDQ  F D  +L+   +  D AAILIEPI
Sbjct: 131 FEGAFHGRTLATIAAGGQKKYLEGYGPKVEGFDQLPFGDHDALREAAAQPDVAAILIEPI 190

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+R VP   L  LR++CD++  LLI+DEVQTG GRTGK FAY+ +   PDI+  AK
Sbjct: 191 QGEGGIRSVPPMCLTGLREMCDNLGILLIYDEVQTGVGRTGKFFAYQHSGAAPDILASAK 250

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+G CLAT   A+ M  GSHG+TYGG+ LAM +G  VL+++  DGFL++V +++
Sbjct: 251 GIGGGFPLGVCLATERAASGMTPGSHGTTYGGSPLAMAIGNAVLDVVLDDGFLDHVRDMS 310

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
             L + L ++ +R+P++   VRG+GLLIGLK       L A+ R+E LL  P+ DNVVR+
Sbjct: 311 LQLKQSLASLSDRYPDVIEAVRGEGLLIGLKAKVPNGELVAQMREEGLLAVPAGDNVVRL 370

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPL +TA+E+ + ++RIE     +S
Sbjct: 371 LPPLNVTADEVRQAMDRIEAAVAAMS 396


>gi|220927195|ref|YP_002502497.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium nodulans ORS 2060]
 gi|219951802|gb|ACL62194.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium nodulans ORS 2060]
          Length = 397

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 214/384 (55%), Positives = 280/384 (72%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ + FE+G+GAWL + +G  +LDF +GIAVN+LGH+HP LVA L  Q+ K+WH
Sbjct: 5   LLPTYARAKVSFERGEGAWLVARDGSRYLDFGAGIAVNALGHAHPHLVAALTEQARKVWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++  + E FA  L+ +TFAD  FF+NSGAE+ E AIK AR+YH   G   +FRIVT
Sbjct: 65  VSNLFEIPEGERFAQRLVEATFADVAFFSNSGAEANEAAIKMARKYHAAGGHPERFRIVT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +Y+EGFGPK+EGFDQ  + DL +LK  I+ +TAA++IEPIQ
Sbjct: 125 FEGAFHGRTLATIAAGGQQKYIEGFGPKVEGFDQVPYGDLTALKAAITPETAALMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R V  E+L+ LR +CD+   LLI DEVQTG GRTGKLFA+EW+ V PDIM+ AKG
Sbjct: 185 GEGGLRVVAPEWLRTLRALCDEHGLLLIMDEVQTGVGRTGKLFAHEWSGVTPDIMSAAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+G CLAT E A  M  GSHG+T+GGN LAM +G  VL+++ + GFLE+V     
Sbjct: 245 IGGGFPLGVCLATREAACGMTVGSHGTTFGGNPLAMAVGNAVLDVVLAPGFLEHVRRTGL 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L A+ +R P++  EVRG+GL++GL+ V      AA  R E LL  P+ DNVVR+L
Sbjct: 305 LLKQRLAALTDRHPDVIAEVRGEGLMVGLRCVVPNTDFAAAARAEHLLVIPAGDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL I   E+ E L R+E  +  L
Sbjct: 365 PPLIIGEAEVDEALNRLEAASSSL 388


>gi|307941512|ref|ZP_07656867.1| acetylornithine aminotransferase [Roseibium sp. TrichSKD4]
 gi|307775120|gb|EFO34326.1| acetylornithine aminotransferase [Roseibium sp. TrichSKD4]
          Length = 401

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 219/387 (56%), Positives = 274/387 (70%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M     LF  Y +S++ F+ G+G WL + +G  FLD  SGIAVN+LGHSHP LV+ LK Q
Sbjct: 1   MTSASSLFGNYARSNLEFDHGEGVWLVTNDGRRFLDCGSGIAVNALGHSHPHLVSALKEQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           +EKLWHVSNL++   QE     L  S+FAD+V   NSGAE++E  IK ARRYHY  G   
Sbjct: 61  AEKLWHVSNLHKVPGQEKLGERLAASSFADKVLMVNSGAEAMEACIKAARRYHYDRGNPE 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +F IVTFEGAFHGRT+ATI+AGG+ +YLEGFGPK  GFDQ    DL++L   I   TAAI
Sbjct: 121 RFHIVTFEGAFHGRTIATIAAGGQEKYLEGFGPKAPGFDQVPAGDLEALAAIIGPQTAAI 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
            IEPIQGEGG+R+   +FL+ LRK+CDD   LLIFDE+QTG GRTGKLFA+EWA V PD+
Sbjct: 181 AIEPIQGEGGIREQGTDFLRHLRKLCDDNGILLIFDEIQTGVGRTGKLFAHEWAGVAPDL 240

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M IAKG+GGGFP+GACLAT EVAAC+  G+HG+T+GGN LAM +G  VL+++  DGFLE 
Sbjct: 241 MAIAKGIGGGFPMGACLATEEVAACLTPGTHGTTFGGNPLAMAVGNAVLDVVLEDGFLEQ 300

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V     +L + L  + +  P +  EVRG+GLL+GLK V       A  R+  LL  P+ D
Sbjct: 301 VERKGLLLKQKLAGLVDTHPQVLAEVRGKGLLLGLKCVVPAGEFVAAAREHGLLAVPAGD 360

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NVVRI+PPLTIT EE+ E + R++  A
Sbjct: 361 NVVRIIPPLTITEEELSEVVTRLDAAA 387


>gi|328544890|ref|YP_004304999.1| Bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [polymorphum gilvum SL003B-26A1]
 gi|326414632|gb|ADZ71695.1| Bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 400

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/386 (58%), Positives = 282/386 (73%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF TY +SD+ F++G+G WL + +G  FLD  SGIAVNSLGH+HP LVA LK+Q+EKLWH
Sbjct: 6   LFGTYARSDLDFDRGEGVWLETTDGRRFLDCGSGIAVNSLGHTHPHLVAALKAQAEKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY  + QE     L  +TFADRVFFTNSGAE++E AIKTARRYHY  G  +++ I+T
Sbjct: 66  VSNLYHMSGQERLGRRLTEATFADRVFFTNSGAEAMEAAIKTARRYHYANGNPDRYGIIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRT+ATI+AGG+ +YLEGFGPK  GFDQ    DL +L+  I  +TAAI IEPIQ
Sbjct: 126 FEGAFHGRTIATIAAGGQAKYLEGFGPKAPGFDQVPAMDLDALRAAIDPNTAAIAIEPIQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R++P +FL+QLR ICD    LLIFDE+QTG GRTGKLFA+EWA V PD+M IAKG
Sbjct: 186 GEGGIREIPADFLRQLRSICDAEGLLLIFDEIQTGVGRTGKLFAHEWAGVTPDLMAIAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT   AA M  G+HG+T+GGN LAM +G  VL+++   GFLE V     
Sbjct: 246 IGGGFPMGACLATEAAAAGMVPGTHGTTFGGNPLAMAVGNAVLDVVLEPGFLEAVQRKGL 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L A+ +  P +F EVRG+GL++GLK       + AK R   LL  P+ DNV+R++
Sbjct: 306 LLKQKLAAVVDAHPAVFQEVRGRGLMLGLKCTPPAGEVLAKARANGLLMVPAGDNVLRVM 365

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL I+ EEI E + RI+  A  L  
Sbjct: 366 PPLIISDEEIAEAVARIDAAASALEQ 391


>gi|260177208|gb|ACX33931.1| hypothetical bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [uncultured prokaryote AT5]
          Length = 406

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 288/389 (74%)

Query: 3   KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSE 62
           +   L  TY + D+ FE+G+GAWL + +G  +LDF SG+AVN+LGH+HP LV  +  Q+ 
Sbjct: 5   RTSHLLPTYARVDLAFERGEGAWLIATDGERYLDFTSGVAVNALGHAHPHLVKAVTEQAN 64

Query: 63  KLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKF 122
           K+WHVSNLY+  + E  A+ L  ++FAD VFF NSGAE++ECAIK AR+Y   +G+  ++
Sbjct: 65  KVWHVSNLYRIPEAERIADRLCAASFADMVFFGNSGAEAMECAIKMARKYQSASGRPERY 124

Query: 123 RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI 182
           R++TFEGAFHGRTLAT++AGG+ +YLEGFGP +EGFDQ  F DL++ K  +  +TAAI+I
Sbjct: 125 RMITFEGAFHGRTLATLAAGGQKKYLEGFGPPVEGFDQVAFADLEATKRALGRETAAIVI 184

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           EPI GEGGVR VP EFL+ LR++CD+   LL+FDEVQTG GRTG+LFAY+   V PDIM 
Sbjct: 185 EPIMGEGGVRVVPNEFLRALRRLCDEHGLLLVFDEVQTGVGRTGELFAYQRCGVTPDIMA 244

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
           +AK + GGFP+GACLAT E A  M  G+HGST+GGN LAM     +L+++ +DGF+E V 
Sbjct: 245 LAKALAGGFPLGACLATAEAAKGMTTGTHGSTFGGNPLAMAAAGALLDVVLADGFVERVR 304

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNV 362
            ++ +L + L AIK+R+PN+  E+RG+GLL+GL+ V   A L  + R E ++T  + DNV
Sbjct: 305 KVSLVLKQKLAAIKDRYPNVIAELRGEGLLVGLRAVGPSADLVDELRAEKMITVAAGDNV 364

Query: 363 VRILPPLTITAEEIHEGLERIERTAIKLS 391
           VR+LPPL I+ EE+ EG++R+ER   +++
Sbjct: 365 VRLLPPLIISEEEVAEGVQRLERACARIA 393


>gi|240849779|ref|YP_002971167.1| acetylornithine aminotransferase [Bartonella grahamii as4aup]
 gi|240266902|gb|ACS50490.1| acetylornithine aminotransferase [Bartonella grahamii as4aup]
          Length = 404

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/385 (55%), Positives = 280/385 (72%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+  + + D+ FE+G G WL S+ G  +LDF SGIAVN+LG+SHP+LV  LK Q+EKLWH
Sbjct: 9   LYECFARRDLHFEQGHGVWLISDKGEHYLDFTSGIAVNALGYSHPKLVDTLKMQAEKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN++QS +Q   A  L  ++FAD+VFF NSG E++ECA KTAR Y+Y AG + +  I+T
Sbjct: 69  VSNIFQSPEQAALATRLCANSFADKVFFCNSGTEALECAFKTARHYYYAAGHSERIEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLA ++A G  +YLEGFGPK  GF Q  FCD  +L+N I+ +TAAILIEPIQ
Sbjct: 129 FEGAFHGRTLAALAATGHEKYLEGFGPKAGGFIQVPFCDEIALRNAINKNTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R V  E+L+ LRKICDD   LLI DEVQTG GRTGKLFAYEW++V PDI+T+AKG
Sbjct: 189 GEGGIRTVSHEYLRFLRKICDDNGLLLILDEVQTGIGRTGKLFAYEWSDVSPDILTLAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT++VA  M  G+HGST+GGN+L M +G  VL+I+    FL +V  +  
Sbjct: 249 LGGGFPLGACLATDKVAKSMTLGTHGSTFGGNLLGMAVGNSVLDILLEPNFLNHVQRMGN 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L  GL  I N +P++   V+G GL++G++ V S  L+     +E LL+  +++NVVR+L
Sbjct: 309 KLRSGLLHILNIYPDIICAVQGMGLMVGIQCVVSSNLVVNALENEYLLSVAANNNVVRLL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL I  EEI E L RIE+    LS
Sbjct: 369 PPLIIREEEIDESLHRIEKAIAYLS 393


>gi|121601786|ref|YP_989539.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Bartonella bacilliformis KC583]
 gi|120613963|gb|ABM44564.1| acetylornithine/succinylornithine aminotransferase [Bartonella
           bacilliformis KC583]
          Length = 401

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 211/386 (54%), Positives = 289/386 (74%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+N++++ ++ F +G G WL S+ G  +LDF SGIAVN LG+ H +L+  LK+QSEKLWH
Sbjct: 9   LYNSFNRRNLHFTQGDGVWLISDKGERYLDFTSGIAVNVLGYGHQKLINALKTQSEKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL+QS +QE  A  L  ++FAD+VFF NSGAE++ECA KTARRY+Y  G+  +  I+T
Sbjct: 69  VSNLFQSPEQEALAMRLCANSFADKVFFCNSGAEALECAFKTARRYYYTLGQPTRVEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLAT++AGG+ +YLEGFGPK  GF Q  F D ++L+N I+N+TAAILIEPIQ
Sbjct: 129 FEGAFHGRTLATLAAGGQEKYLEGFGPKAGGFVQVPFNDEKALRNAINNNTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP E L+ LR +CD+ D LLI DE+QTG GRTGKLFAYEW+++ PDI+T+AKG
Sbjct: 189 GEGGLRIVPHETLKFLRNLCDENDLLLILDEIQTGIGRTGKLFAYEWSDITPDILTLAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT++ A CM  G+HGST+GGN+L M +   VL+I+   GFL++V ++A 
Sbjct: 249 LGGGFPLGACLATDKAAKCMIPGTHGSTFGGNLLGMAVSNSVLDIVLEPGFLDHVQHVAN 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L +GL+ + + +P++   ++G GL+IG++ V     L     +E +L+  +S NVVR L
Sbjct: 309 KLKQGLSTLLDTYPDVISAIQGTGLMIGVQCVVPQQELITALENEHILSVGTSKNVVRFL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL IT +E+ EGL RI++    LS 
Sbjct: 369 PPLIITEDEVCEGLHRIKKAIDHLSQ 394


>gi|319898299|ref|YP_004158392.1| acetylornithine aminotransferase [Bartonella clarridgeiae 73]
 gi|319402263|emb|CBI75802.1| acetylornithine aminotransferase [Bartonella clarridgeiae 73]
          Length = 401

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 209/386 (54%), Positives = 288/386 (74%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+N + + ++ F +GKG WL S+ G  +LDF SGIAVN LG++HP+LV  +K+Q+EKLWH
Sbjct: 9   LYNNFSRRNLHFTQGKGVWLISDKGESYLDFTSGIAVNVLGYTHPKLVDAIKTQAEKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++S +QE  A  L  ++FAD+VFF NSGAE++ECA KTARRYHY +G+  +F I+T
Sbjct: 69  VSNLFESPEQESLATRLCANSFADKVFFCNSGAEALECAFKTARRYHYTSGQPTRFEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+A G+ +YLEGFGPK+ GF Q  F D ++L+N I+ +TAAILIEPIQ
Sbjct: 129 FEGAFHGRTLATIAASGQKKYLEGFGPKVCGFIQVPFDDEKALRNAINKNTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP E L+ LRK+CD+   LLI DEVQTG GRTGKLFAYEW ++ PDI+T+AKG
Sbjct: 189 GEGGLRTVPYETLKLLRKLCDENQLLLILDEVQTGIGRTGKLFAYEWHDITPDILTLAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G+HG+T+GGN+L + +   VL+I+   GFL++V +++ 
Sbjct: 249 LGGGFPLGACLATEKAAKSMTPGTHGTTFGGNLLGIAVSNNVLDILLEPGFLDHVQHMSS 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L +GL  I N +P++   ++G GL++G++ V     +     +E +L+  +  N+VR+L
Sbjct: 309 KLKQGLLNIFNTYPDIICAIQGIGLMMGMQCVIPKNEVITALDNERILSVGAGHNIVRLL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL IT EE++EGL RIE+    LS 
Sbjct: 369 PPLIITEEEMYEGLRRIEKAIAHLSQ 394


>gi|170744572|ref|YP_001773227.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium sp. 4-46]
 gi|168198846|gb|ACA20793.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium sp. 4-46]
          Length = 397

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 214/384 (55%), Positives = 277/384 (72%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ + FE+G+GAWL + +G  +LDF +GIAVN+LGH+HP LV  L  Q+ K+WH
Sbjct: 5   LLPTYARAKVSFERGEGAWLVARDGSRYLDFGAGIAVNALGHAHPHLVEALTEQARKVWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++  + E  A  LI +TFAD VFF+NSGAE+ E AIK AR+YH   G   +FRIVT
Sbjct: 65  VSNLFEIPEGERLAQRLIDATFADVVFFSNSGAEANEAAIKMARKYHAAGGHPERFRIVT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +Y+EGFGPK+EGFDQ  + DL +L + I+ +TAA++IEPIQ
Sbjct: 125 FEGAFHGRTLATIAAGGQQKYIEGFGPKVEGFDQVPYGDLDALAHAITPETAALMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R V  EFL+ LR +CD    LLI DEVQTG GRTGKLFA+EW+ V PDI++ AKG
Sbjct: 185 GEGGLRVVSPEFLRTLRGLCDRHGLLLIMDEVQTGMGRTGKLFAHEWSGVTPDILSAAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  GSHG+T+GGN LAM +G  VL+++ + GFLE V     
Sbjct: 245 IGGGFPMGACLATREAARGMVVGSHGTTFGGNPLAMAVGNAVLDVVLAPGFLEQVRRTGL 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L A+K+R P +  EVRG+GL+ GL+ V      AA  R E LL  P+ DNVVR+L
Sbjct: 305 LLKQRLAALKDRHPGVIAEVRGEGLMTGLRCVVPNTEFAAAARAEHLLVIPAGDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL I   E+ E + R+E  +  L
Sbjct: 365 PPLIIGEAEVAEAVNRLEAASSSL 388


>gi|49473779|ref|YP_031821.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Bartonella quintana str. Toulouse]
 gi|49239282|emb|CAF25607.1| Acetylornithine aminotransferase [Bartonella quintana str.
           Toulouse]
          Length = 397

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 209/386 (54%), Positives = 283/386 (73%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+  + + ++RFE+G G WL S+ G  +LDF SGI+VN+LG++HP+LV  LK Q+ KLWH
Sbjct: 9   LYECFARRNLRFEQGNGVWLVSDKGERYLDFTSGISVNALGYAHPKLVDTLKIQAGKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL+QS +QE  A  L  ++FAD+VFF NSGAE++ECA KTAR YHY +G   +  I+T
Sbjct: 69  VSNLFQSPEQEALAARLCANSFADKVFFCNSGAEALECAFKTARHYHYTSGHPTRIEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLAT++A G  +YLEGFGPK++GF Q  FCD  +L+N I+ +TAAILIEPIQ
Sbjct: 129 FEGAFHGRTLATLAATGHEKYLEGFGPKVDGFIQIPFCDESALRNAINKNTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP E+L  LRKIC+D D LLI DEVQTG GRTGKLFAYEW+ + PDI+T+AKG
Sbjct: 189 GEGGIRTVPREYLSFLRKICNDNDLLLILDEVQTGIGRTGKLFAYEWSAITPDILTLAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G GFP+GACLAT + A  M  G+HGST+GGN+L M +   VL+II   GFL +V ++  
Sbjct: 249 LGSGFPLGACLATEKAAKSMIPGTHGSTFGGNLLGMAVSNSVLDIILESGFLHHVQHMGN 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L  GL++I + +P++   ++G GL++G++ V    ++ +   +E LL+  +++NVVR L
Sbjct: 309 KLKNGLSSILSAYPDIICAIQGVGLMLGIQCVVPSNIVVSALENEYLLSVGANNNVVRFL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL I  EE+ E L RI++    LS 
Sbjct: 369 PPLIIKEEEVDESLHRIQKAIAYLSQ 394


>gi|114704459|ref|ZP_01437367.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Fulvimarina pelagi HTCC2506]
 gi|114539244|gb|EAU42364.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Fulvimarina pelagi HTCC2506]
          Length = 404

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 283/387 (73%), Gaps = 2/387 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           ++ TY+++ I FE G+G WL + +G  +LD A GIAVN+LGH+HP LV  LKSQ+EKLWH
Sbjct: 12  IYPTYNRAPISFESGEGVWLKANDGKRYLDCAGGIAVNALGHAHPHLVDALKSQAEKLWH 71

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++   Q+  A+ L  +TFADRVFFTNSGAE++ECAIKTARR+H++ G   +  I+T
Sbjct: 72  VSNLFEIPGQKRLADRLCQATFADRVFFTNSGAEALECAIKTARRFHHVNGAPERVNILT 131

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-DTAAILIEPI 185
           FEGAFHGRTLATI+AGG+ +YLEGFGPK  GF    F D  +L+   +  D AAIL+EP+
Sbjct: 132 FEGAFHGRTLATIAAGGQAKYLEGFGPKAPGFMSLPFGDHDALRMAAAEPDVAAILVEPV 191

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA-NVKPDIMTIA 244
           QGEGGVRK+P   L  LR++CD+   LLI+DEVQTG GRTG+ FA++ A   +PDI+  A
Sbjct: 192 QGEGGVRKLPLPCLTGLRELCDERGILLIYDEVQTGIGRTGRFFAHQNAGGAEPDILATA 251

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           KG+GGGFP+GACLAT    + M  G+HG+TYGGN LAM +G  VL+I+  +GFLE V + 
Sbjct: 252 KGIGGGFPLGACLATEAAGSAMTPGTHGTTYGGNPLAMAVGNAVLDIVLDEGFLEGVRDK 311

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
           A +  + L ++K+RFP++  EVRG GLLIGLKTV       A  R E LLT P+ DNVVR
Sbjct: 312 AILFKQSLESLKDRFPDVLEEVRGTGLLIGLKTVCPNTEAVAALRTEGLLTVPAGDNVVR 371

Query: 365 ILPPLTITAEEIHEGLERIERTAIKLS 391
           +LPPLTIT+EEI E ++R+E     LS
Sbjct: 372 LLPPLTITSEEIREAVQRLENAFAALS 398


>gi|319407974|emb|CBI81628.1| acetylornithine aminotransferase [Bartonella schoenbuchensis R1]
          Length = 395

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/386 (53%), Positives = 285/386 (73%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+N Y + ++ F++G GAWL S+ G  +LDF SG+AVN LG++HP+L+  LK ++EKLWH
Sbjct: 9   LYNNYARRNLCFKQGNGAWLISDKGERYLDFTSGVAVNVLGYAHPKLIDALKIEAEKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL+QS +QE  A  L  ++FAD+VFF NSGAE++ECA KTAR YHY  G+  +F I+T
Sbjct: 69  ISNLFQSPEQETLATRLCANSFADKVFFCNSGAEALECAFKTARHYHYANGQPERFEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FE AFHGRTLAT++A G+ +YLEGFGPK+ GF Q  F D ++L++ I+ +TAAILIEPIQ
Sbjct: 129 FEDAFHGRTLATLAASGQKKYLEGFGPKVSGFIQVPFGDEKALRSAINKNTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP E L+ LRK+CD+   LLI DEVQTG GRTGKLFAYEW+++ PDI+T+AKG
Sbjct: 189 GEGGLRAVPLETLKLLRKLCDENGLLLILDEVQTGIGRTGKLFAYEWSDIIPDILTLAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT++ A  M  G+HGST+GGN+L M +   VL+++   GFL +V ++A 
Sbjct: 249 LGGGFPLGACLATDKAAKSMTPGTHGSTFGGNLLGMAVCNSVLDVVSEPGFLNHVQHVAH 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L +GL  I   +P++   V+G+GL+IG++ +     +     +E +L+  + +N VR L
Sbjct: 309 QLKQGLLTILETYPDVICSVQGKGLMIGVQCIVPQNDVITALENEYILSVGAGNNFVRFL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL IT EEI EGL RIE+    LS+
Sbjct: 369 PPLIITEEEIREGLHRIEKAIAHLSN 394


>gi|49474927|ref|YP_032968.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Bartonella henselae str. Houston-1]
 gi|49237732|emb|CAF26924.1| Acetylornithine aminotransferase [Bartonella henselae str.
           Houston-1]
          Length = 401

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/386 (53%), Positives = 279/386 (72%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+  + + ++ FE+G   WL S+ G  +LDF SGIAVN LG++HP+L+  LK Q+EKLWH
Sbjct: 9   LYECFARRNLHFEQGNAVWLISDKGERYLDFTSGIAVNVLGYAHPKLIDTLKRQAEKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL+QS +QE  A  L  ++FAD+VFF NSGAE+VECA KTAR YHY +G   +F I+T
Sbjct: 69  VSNLFQSPEQEALAAQLCVNSFADKVFFCNSGAEAVECAFKTARHYHYASGHPTRFEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FE AFHGRTLAT++A G+ +YL+GFGPK +GF Q   CD  +L+N I+ +TAAILIEPIQ
Sbjct: 129 FEDAFHGRTLATLAATGQEKYLQGFGPKADGFIQIPLCDEIALRNAINKNTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R V  E+L+ LRKICD+   LLI DE+QTG GRTGKLFAYEW+ + PDI+T+AKG
Sbjct: 189 GEGGIRTVSHEYLRLLRKICDENGLLLILDEIQTGIGRTGKLFAYEWSGITPDILTLAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G+HGST+GGN+L M +G+ VL+II   G L++V  +  
Sbjct: 249 LGGGFPLGACLATEKAAKSMTPGTHGSTFGGNLLGMAVGKTVLDIILEPGLLDHVQQMGY 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L  GL+ I N +P++   + G GL++G++ V    ++ +    E LL+  +++NVVR L
Sbjct: 309 KLKSGLSNILNDYPDIICAINGVGLMLGIQCVVPSQVVVSALESEYLLSVSANNNVVRFL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL I  EE++E L RIE+    LS 
Sbjct: 369 PPLIIKEEEVNESLHRIEKAIASLSQ 394


>gi|298294428|ref|YP_003696367.1| acetylornithine and succinylornithine aminotransferase [Starkeya
           novella DSM 506]
 gi|296930939|gb|ADH91748.1| acetylornithine and succinylornithine aminotransferase [Starkeya
           novella DSM 506]
          Length = 402

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/386 (53%), Positives = 277/386 (71%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY++ D+ FE+G+GAWLF+++G  +LDF +GIAVN LGH+HP LVA L  Q+ KLWH
Sbjct: 5   ILPTYNRIDLVFERGEGAWLFTKDGQRYLDFTAGIAVNVLGHAHPHLVAALTEQAGKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL++    E  A  L  +TFAD +FFTNSGAE++ECAIK ARRY Y++G   + RI+T
Sbjct: 65  LSNLFRIEGGERLAKRLTEATFADTMFFTNSGAEALECAIKMARRYQYVSGHPERNRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG  +YLEGFGP + GFDQ  F DL+++K  I  +T AIL+EP+Q
Sbjct: 125 FEGAFHGRTLATIAAGGNAKYLEGFGPAMPGFDQVPFGDLEAVKAAIGPETGAILVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR     FL+ LR++CD+   LL+ DEVQ+G GRTGK FA+EWA + PDIM IAKG
Sbjct: 185 GEGGVRSPSWSFLRALRQLCDEHGLLLVLDEVQSGVGRTGKFFAHEWAGITPDIMAIAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G+HGSTYGGN LAM +   VL+++ ++GF+E V   + 
Sbjct: 245 IGGGFPVGACLATEEAAKGMTAGTHGSTYGGNPLAMSVANAVLDVVLAEGFMEKVQATSA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L + L  +K+R P +  EVRG+GLLIGL+T+     L    RDE +L   +++NVVR+L
Sbjct: 305 RLRQRLAELKDRHPAVIAEVRGEGLLIGLRTLVPNGDLINAMRDEHMLAPSAAENVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPLTI   EI    ++++    K+  
Sbjct: 365 PPLTIGEAEIDAAFDKLDAACTKIEQ 390


>gi|319405018|emb|CBI78628.1| acetylornithine aminotransferase [Bartonella sp. AR 15-3]
          Length = 401

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 206/386 (53%), Positives = 284/386 (73%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+NT+ + ++ F +G G WL S+ G  +LDF SGIAVN LG++HP+L+  +K+Q+EKLWH
Sbjct: 9   LYNTFARRNLHFTQGNGVWLISDKGQKYLDFTSGIAVNVLGYTHPKLIDAIKTQAEKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL++S +QE  A  L  ++FAD+VFF NSGAE++ECA KTARRYHY  G+  +F I+T
Sbjct: 69  ISNLFESPEQESLAARLCANSFADKVFFCNSGAEALECAFKTARRYHYTLGQPKRFEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+A G+ +YLEGFGPK+ GF Q  F D ++L++ I+ +TAAILIEPIQ
Sbjct: 129 FEGAFHGRTLATIAASGQKKYLEGFGPKVCGFIQVPFDDEKALRHAINKNTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP E  ++LRK+CD+   LLI DEVQTG GRTGKLFAYEW ++ PDI+T+AKG
Sbjct: 189 GEGGLRTVPYETFKKLRKLCDENQLLLILDEVQTGIGRTGKLFAYEWNDIIPDILTLAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G+HG+T+GGN+L + +   VL+II   GFL +V ++  
Sbjct: 249 LGGGFPLGACLATEQAAKAMTPGTHGTTFGGNLLGIAVSNSVLDIILEPGFLNHVQHMGN 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L +GL +I N +P++   ++G GL++G++       +     +E +L+  +  N+VR L
Sbjct: 309 KLQQGLLSILNTYPDIICAIQGIGLMMGIQCTIPQNEVITALDNEYILSVGAGHNIVRFL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL IT EEI+EGL RIE+    LS 
Sbjct: 369 PPLIITEEEIYEGLHRIEKAIAYLSQ 394


>gi|163867405|ref|YP_001608600.1| acetylornithine transaminase protein [Bartonella tribocorum CIP
           105476]
 gi|161017047|emb|CAK00605.1| acetylornithine aminotransferase [Bartonella tribocorum CIP 105476]
          Length = 399

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/386 (54%), Positives = 279/386 (72%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+  + + ++ F++G G WL S+ G  +LDF SGIAVN+LG++HP+LV  LK Q+EKLWH
Sbjct: 9   LYECFARRNLHFKQGHGVWLTSDKGEHYLDFTSGIAVNALGYAHPKLVDTLKRQAEKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL+QS +Q  FA  L   +F+D+VFF NSG E++ECA KTAR Y+Y AG   +  I+T
Sbjct: 69  ISNLFQSPEQVAFATRLCAHSFSDKVFFCNSGTEALECAFKTARHYYYAAGYPERVEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLA ++A G  +YLEGFGPK  GF Q  FCD  +L+N I+ +TAAILIEPIQ
Sbjct: 129 FEGAFHGRTLAALAATGHEKYLEGFGPKAGGFIQVPFCDEIALRNAINENTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+RKV  E+L+ LRKICDD   LLIFDEVQTG GRTGKLFAYEW++V PDI+ +AKG
Sbjct: 189 GEGGIRKVSHEYLRFLRKICDDNGLLLIFDEVQTGMGRTGKLFAYEWSDVTPDILALAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT++VA  M  G+HGST+GGN+L M +G  VL+I+    FL +V  +  
Sbjct: 249 LGGGFPLGACLATDKVAKSMTPGTHGSTFGGNLLGMAIGNSVLDILLEPSFLNHVQRMGD 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L  GL  I N +P++   ++G GL++G++ V    L+     +E LL+  +++NVVR+L
Sbjct: 309 KLKSGLLHILNIYPDIICAIQGMGLMVGIQCVVPSNLVVNALENEYLLSVAANNNVVRLL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL I  EEI + L RIE+    LS 
Sbjct: 369 PPLIIREEEIDDSLHRIEKAISYLSQ 394


>gi|319406505|emb|CBI80147.1| acetylornithine aminotransferase [Bartonella sp. 1-1C]
          Length = 401

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/385 (53%), Positives = 282/385 (73%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+NT+ +  + F +GKG WL S+ G  +LDF SGIAVN LGH+HP+L+  LK+Q+EKLWH
Sbjct: 9   LYNTFVRRHLHFTQGKGLWLISDKGEKYLDFTSGIAVNVLGHTHPKLIDTLKTQAEKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++S +QE  A  L  ++FAD+VFF NSGAE++ECA KTARRYHY  G+  +F I+T
Sbjct: 69  VSNLFESPEQEALAARLCANSFADKVFFCNSGAEALECAFKTARRYHYTLGQPQRFEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+A G+ +YLEGFGPK+ GF Q  F D ++L++ I+ +TAAILIEPIQ
Sbjct: 129 FEGAFHGRTLATIAASGQKKYLEGFGPKVCGFIQVPFDDEKALRHAINKNTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP   L+ LRK+CD+   LLI DEVQTG GRTGKLFAYEW ++ PDI+T+AKG
Sbjct: 189 GEGGLRTVPYGTLKMLRKLCDENQLLLILDEVQTGIGRTGKLFAYEWYDIVPDILTLAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G+HG+T+GGN+L + +   VL+ +   GFL +V ++  
Sbjct: 249 LGGGFPLGACLATEKAAKAMTPGTHGTTFGGNLLGIAISNSVLDTLLEPGFLNHVQHMGN 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L +GL  I N +P++  +++G GL++G++ +     +     +E +L+  +  N+VR L
Sbjct: 309 KLKQGLLNILNIYPDIICKIQGTGLMMGMQCIIPHNEVITALDNEHILSVGAGHNIVRFL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL I  EEI+EGL RIE+    LS
Sbjct: 369 PPLIINEEEIYEGLHRIEKAIAYLS 393


>gi|254503916|ref|ZP_05116067.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Labrenzia alexandrii DFL-11]
 gi|222439987|gb|EEE46666.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Labrenzia alexandrii DFL-11]
          Length = 399

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/384 (53%), Positives = 273/384 (71%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF  Y +S++ F+ G+G WL + +G  FLD  SGIAVNSLGH+HP LV  L+ Q+ KLWH
Sbjct: 6   LFGNYARSNLSFDHGEGVWLVTSDGRRFLDCGSGIAVNSLGHAHPHLVQALQDQAAKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL+Q       A  L  +TFAD+V F NSGAE++E AIK ARRYHY     ++++IVT
Sbjct: 66  ISNLHQMPDGARLAQRLTDATFADKVLFVNSGAEAMEAAIKCARRYHYDRNDPDRYQIVT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTL TI+AGG+ +YLEGFGPK  GFDQ    DL +LK  +   TAAI IEPIQ
Sbjct: 126 FEGAFHGRTLGTIAAGGQAKYLEGFGPKAPGFDQVPSGDLDALKAMVGPQTAAIAIEPIQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R+V  EFL+ LRK+CD+  ALLIFDE+QTG GRTGK+FA++W  V PD+M +AKG
Sbjct: 186 GEGGIREVDYEFLRALRKLCDETGALLIFDEIQTGVGRTGKMFAHQWTGVDPDLMAVAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G GFP+GACLAT EVA+ +  G+HG+T+GGN LAM +G  VL++I +DGFLE V     
Sbjct: 246 IGSGFPMGACLATEEVASALAPGTHGTTFGGNPLAMAVGNAVLDVILADGFLEEVQKKGL 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
              + L+ + +  P +F  VRG GL++G+K         A  R+  +L  P+ DNVVRIL
Sbjct: 306 SFKQKLSGLVDSHPKVFEAVRGNGLMLGIKCTAPVGDYVAAAREAGILAVPAGDNVVRIL 365

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPLTI+ +EI + L+R+E+ A+ +
Sbjct: 366 PPLTISEDEIADALDRLEQAAVAV 389


>gi|323135687|ref|ZP_08070770.1| acetylornithine and succinylornithine aminotransferase
           [Methylocystis sp. ATCC 49242]
 gi|322398778|gb|EFY01297.1| acetylornithine and succinylornithine aminotransferase
           [Methylocystis sp. ATCC 49242]
          Length = 398

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/380 (55%), Positives = 271/380 (71%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           N  L+ TY ++DI F +G+GAWL +ENG  +LDFASG+AV SLGH HP LVA LK+ +E+
Sbjct: 2   NSALYPTYARADISFARGEGAWLVAENGDRYLDFASGVAVLSLGHEHPHLVATLKAAAEQ 61

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
            WHVSNL++  Q E  A  L  +TFAD VFFTNSGAE+VE AIKTAR+YH   G+  ++R
Sbjct: 62  PWHVSNLFRIPQAERLARRLAEATFADIVFFTNSGAEAVEAAIKTARKYHAANGQPERYR 121

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           ++TFEGAFHGRTLATI+AGG  +YLEGFGP +EGFDQ  F DL +++  I+++TA +L+E
Sbjct: 122 LITFEGAFHGRTLATIAAGGNPKYLEGFGPPVEGFDQVPFADLDAVEKAITDETAGVLLE 181

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGG+R  P  FL  +RK+CD    LL+ DEVQ G GRTGK  A E A V PD++ +
Sbjct: 182 PIQGEGGLRVFPPAFLSDIRKLCDARGLLLVLDEVQCGVGRTGKFLACEHAGVTPDVVAL 241

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFPIGACLAT E A  M  G+HGST+GGN LA  +G  VL+++  DGF+  V  
Sbjct: 242 AKGLGGGFPIGACLATREAAKGMTAGTHGSTFGGNPLATAVGSAVLDVVLEDGFMLRVAR 301

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVV 363
           +  +L + L  +++R+P +  EVRG+GL+ GLKT       AA  R E LLT  + DNVV
Sbjct: 302 LGALLRQRLAELEDRYPAIIGEVRGEGLMFGLKTRVPNGDFAAAARAEGLLTVLAGDNVV 361

Query: 364 RILPPLTITAEEIHEGLERI 383
           R+LPPL I   +I E + R+
Sbjct: 362 RLLPPLIIDESDIAEAVRRL 381


>gi|319403591|emb|CBI77176.1| acetylornithine aminotransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 401

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 205/386 (53%), Positives = 281/386 (72%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L+NT+ +  + F +GKG WL S+ G  +LDF SGIAVN LGH+HP+L+  LK+Q+EKLWH
Sbjct: 9   LYNTFARRHLHFTQGKGVWLISDKGEKYLDFTSGIAVNVLGHTHPKLIDALKTQAEKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++S +QE  A  L  ++FAD+VFF NSGAE++ECA KTARRYHY   +  +F I+T
Sbjct: 69  VSNLFESPEQESLAARLCANSFADKVFFCNSGAEALECAFKTARRYHYTLDQPQRFEIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+A G+ +YLEGFGPK+ GF Q  F D ++L++ I+ +TAAILIEPIQ
Sbjct: 129 FEGAFHGRTLATIAASGQKKYLEGFGPKVCGFIQVPFDDEKALRHAINKNTAAILIEPIQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  P + L+ LRK+C+D   LLI DEVQTG GRTGKLFAYEW ++ PDI+T+AKG
Sbjct: 189 GEGGLRTTPYKTLKMLRKLCNDNQLLLILDEVQTGIGRTGKLFAYEWYDIVPDILTLAKG 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G+HG+T+GGN+L + + + VL+ +   GFL +V ++  
Sbjct: 249 LGGGFPLGACLATEKAAKAMTPGTHGTTFGGNLLGIAVSKSVLDTLLEPGFLNHVQHMGN 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L +GL  I N +P++   ++G GL++G++ +     +     +E +L+  +  N+VR L
Sbjct: 309 KLKQGLLNILNTYPDIICTIQGTGLMMGMQCIIPQNEVITALDNEHILSVGAGHNIVRFL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL I  EEI+EGL RIE+    LS 
Sbjct: 369 PPLIINEEEIYEGLHRIEKAIAYLSQ 394


>gi|296444941|ref|ZP_06886903.1| acetylornithine and succinylornithine aminotransferase
           [Methylosinus trichosporium OB3b]
 gi|296257609|gb|EFH04674.1| acetylornithine and succinylornithine aminotransferase
           [Methylosinus trichosporium OB3b]
          Length = 398

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 210/386 (54%), Positives = 271/386 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF TY ++D+ FE G+GAWL + +G  +LDF SG+AVNSLGH+HP LV  L + +   WH
Sbjct: 5   LFPTYPRADLSFETGEGAWLVASDGERYLDFGSGVAVNSLGHAHPHLVGTLSAAAASPWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++    E  A  L  ++FAD VFFTNSGAE+VECAIKTAR+YH   G+  ++R++T
Sbjct: 65  VSNLFRIPAAERLAERLAQASFADLVFFTNSGAEAVECAIKTARKYHAANGRPERYRLIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG  +YL+GFGP ++GFDQA F DL +++  IS  TA +L+EPIQ
Sbjct: 125 FEGAFHGRTLATIAAGGNPKYLDGFGPPVDGFDQAPFGDLDAVRALISPQTAGVLLEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR  P  FL  LR +CD+   LL+ DEVQTG GRTG+  A E + V PDI  +AKG
Sbjct: 185 GEGGVRVAPPGFLPGLRALCDEHGLLLVVDEVQTGVGRTGRFLAIEHSGVAPDIAALAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G+HGSTYGGN LA  +G  VL+I+   GFLE V  +  
Sbjct: 245 VGGGFPLGACLATAEAAKGMTLGAHGSTYGGNPLATAVGNAVLDIVLEPGFLERVAQLGG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L A+++R+P +  EVRG+GL+ G+KT       AA  R   LLT P+SDNVVR+L
Sbjct: 305 LFRQKLAALEDRYPQVIEEVRGEGLMFGVKTRVPNMAFAAAARAAGLLTIPASDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPL +T  EI EG+ R+E     L+ 
Sbjct: 365 PPLIVTESEIAEGVARLETACASLAQ 390


>gi|154245166|ref|YP_001416124.1| acetylornithine and succinylornithine aminotransferase
           [Xanthobacter autotrophicus Py2]
 gi|154159251|gb|ABS66467.1| acetylornithine and succinylornithine aminotransferase
           [Xanthobacter autotrophicus Py2]
          Length = 402

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 205/378 (54%), Positives = 271/378 (71%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY + D+ FE+G+G WL + +G  FLDF  GIAVN LGH+HP L   L  Q++KLWH
Sbjct: 5   VLPTYARIDLEFERGEGCWLVTTDGRRFLDFTGGIAVNVLGHAHPYLAEALSEQAKKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL++    E  A+ +   TFAD +FFTNSGAE++ECAIK AR+Y + +G   K RI+T
Sbjct: 65  TSNLFRIPGGERLADRIKAVTFADTMFFTNSGAEALECAIKMARKYQFASGHPEKNRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG  +YLEGFGP + GFDQ  F DL + +  ++ +TAAIL+EP+Q
Sbjct: 125 FEGAFHGRTLATIAAGGNAKYLEGFGPAMPGFDQVPFGDLDAARAAVTPETAAILVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR  P  FL+ LR +CD+   LL+ DEVQ G GRTGKLFA+EW  V PDIM +AKG
Sbjct: 185 GEGGVRVPPSGFLKGLRALCDEKGLLLVLDEVQCGVGRTGKLFAHEWVGVTPDIMAVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G+HGSTYGGN LAM +G  VL+++ +DGFL++V  ++ 
Sbjct: 245 IGGGFPMGACLATEEAAKGMTLGTHGSTYGGNPLAMAVGNAVLDLVLADGFLDHVNAMST 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L + L  +++R P++  EVRGQGLL+GL+     A L    R+E +L   +SDNVVR+L
Sbjct: 305 RLVQRLAEVRDRHPSVIAEVRGQGLLLGLRCAVPAADLVTALREEGMLAPGASDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIE 384
           PPL ++ EE+   +E+IE
Sbjct: 365 PPLIVSEEEVGIAVEKIE 382


>gi|188583744|ref|YP_001927189.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium populi BJ001]
 gi|179347242|gb|ACB82654.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium populi BJ001]
          Length = 396

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 272/384 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ I FE+G+GAWL +E+G  +LDF +GIAVN+LGH+HP LV  L +Q++KLWH
Sbjct: 5   LLPTYARAPIAFERGEGAWLVAEDGDRYLDFGAGIAVNALGHAHPHLVEALTAQAQKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL+Q  + E     L+ +TFAD  FF NSGAE+ E AIK AR+YH + G   ++RI+T
Sbjct: 65  TSNLFQIPEGERLGRRLVAATFADVAFFANSGAEANEAAIKMARKYHAVGGCPERYRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +Y+EGFGPK+EGFDQ    D  +L+  I  +TAA++IEPIQ
Sbjct: 125 FEGAFHGRTLATIAAGGQQKYIEGFGPKVEGFDQVPVGDFAALEAMIGPETAALMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P E L++LR +CD    LLI DEVQTG GRTG+ FA+EW+ V PDIM+ AKG
Sbjct: 185 GEGGLRVIPGETLRRLRALCDAQGLLLIMDEVQTGVGRTGRFFAHEWSGVTPDIMSAAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+G CLAT E A  M  G+HG+T+GGN LAM +G  VL+++  DGFL +V  +  
Sbjct: 245 IGGGFPLGVCLATAEAARGMTAGTHGTTFGGNPLAMAVGNAVLDVVLGDGFLAHVERMGL 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  + +R P++F E+RGQGL+ GLK         A  R   LL  P+ DNV+R+L
Sbjct: 305 LLTQKLAGLIDRHPHVFAELRGQGLMRGLKLNVPNTEFTAAARARHLLVIPAGDNVIRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL + A E+ E + R+E  A  L
Sbjct: 365 PPLIVGAAEVEEAVVRLEAAATDL 388


>gi|118589319|ref|ZP_01546725.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Stappia aggregata IAM 12614]
 gi|118438019|gb|EAV44654.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Stappia aggregata IAM 12614]
          Length = 398

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/384 (55%), Positives = 276/384 (71%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF  Y +S++ F+ G+G WL + +G  FLD  SGIAVN+LGH+HP LV  L+ Q+ KLWH
Sbjct: 6   LFGNYARSNLSFDHGEGVWLVTTDGRRFLDCGSGIAVNALGHAHPHLVKALQDQAAKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL+Q    E  A  L  +TFAD+V F NSGAE++E AIK ARRYHY  G   +F IVT
Sbjct: 66  TSNLHQMPDGERLAQRLCAATFADKVLFVNSGAEAMEAAIKCARRYHYDNGNPERFHIVT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRT+ATI+AGG+ +YLEGFGPK  GFDQ    DL +LK+ I   TAAI IEP+Q
Sbjct: 126 FEGAFHGRTIATIAAGGQAKYLEGFGPKAPGFDQVPAGDLDALKDAIGPQTAAIAIEPVQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R++P +FL+ LRKICDD   LLIFDE+QTG GRTGKLFAY+WA V+PD+M IAKG
Sbjct: 186 GEGGIREIPADFLRALRKICDDNGILLIFDEIQTGVGRTGKLFAYQWAGVEPDLMAIAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E AA ++ G+HG+T+GGN LAM +G  VL+++  DGFLE V     
Sbjct: 246 IGGGFPMGACLATAETAAALSPGTHGTTFGGNPLAMAVGNAVLDVVLEDGFLEGVCQKGL 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
              + L  + +  P++  EVRG GL++GLK V   A      R+  LL  P+ DNVVRI+
Sbjct: 306 SFKQKLAGLVDSHPDVLAEVRGSGLMLGLKCVVPVADYVLAAREAGLLAVPAGDNVVRIM 365

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPLT++ EEI   +ER+E+ A+ +
Sbjct: 366 PPLTMSEEEISIAVERLEQAAVAV 389


>gi|163853473|ref|YP_001641516.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium extorquens PA1]
 gi|163665078|gb|ABY32445.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium extorquens PA1]
          Length = 396

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 270/384 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ I FE+G+GAWL +E+G  +LDF +GIAVN+LGH+HP LV  L +Q++KLWH
Sbjct: 5   LLPTYARAPIAFERGEGAWLVAEDGDRYLDFGAGIAVNALGHAHPHLVEALTTQAQKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL+Q  + E     L+ +TFAD  FF NSGAE+ E AIK AR+YH   G   ++RI+T
Sbjct: 65  TSNLFQIPEGERLGQRLVDATFADVAFFANSGAEANEAAIKMARKYHAAGGHPERYRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +Y+EGFGPK+EGFDQ    D  +L+  I  +TAA++IEPIQ
Sbjct: 125 FEGAFHGRTLATIAAGGQQKYIEGFGPKVEGFDQVPVGDFAALEAVIGPETAALMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P E L++LR +C+    LLI DEVQTG GRTGK FA+EW+ V PDIM+ AKG
Sbjct: 185 GEGGLRVIPGETLRRLRALCEAHGLLLIMDEVQTGVGRTGKFFAHEWSGVTPDIMSAAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+G CLAT E A  M  G+HG+T+GGN LAM +G  VL+++  DGFL +V  +  
Sbjct: 245 IGGGFPLGVCLATAEAARGMTAGTHGTTFGGNPLAMAVGNAVLDVVLGDGFLAHVERMDL 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  + +R P++F E+RGQGL+ GLK         A  R   LL  P+ DNVVR+L
Sbjct: 305 LLTQKLAGLIDRHPHVFAELRGQGLMRGLKLNLPNTTFTAAARARHLLVIPAGDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL +   E+ E + R+E  A  L
Sbjct: 365 PPLIVGETEVDEAVARLEAAATDL 388


>gi|209883805|ref|YP_002287662.1| acetylornithine aminotransferase [Oligotropha carboxidovorans OM5]
 gi|209872001|gb|ACI91797.1| acetylornithine aminotransferase [Oligotropha carboxidovorans OM5]
          Length = 407

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/391 (52%), Positives = 279/391 (71%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N    L   + + D+ FE+G+GAWL + +G  +LDF SG+AVN+LGH+HP LVA +++Q+
Sbjct: 4   NTTSHLMPVFARVDLAFERGEGAWLIATDGERYLDFTSGVAVNALGHAHPHLVAAVQAQA 63

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            KLWH+SNL++S   E  A  L  ++FAD VFF NSGAE++ECAIK  RRYH   G   +
Sbjct: 64  AKLWHMSNLFRSPDGEKVAARLCENSFADEVFFANSGAEALECAIKVTRRYHARKGHPER 123

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
           +RI+TFEGAFHGRTLAT++AGG+ +YL+GFGPK+EGFDQ    D++++K  I  +TA IL
Sbjct: 124 YRIITFEGAFHGRTLATLAAGGQEKYLDGFGPKVEGFDQVPLGDIEAVKKAIGPETAGIL 183

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           IEP+QGEGGVR+    F + LR++CDD   LL+FDEVQTG GRTG+LFAY+   V+PD+M
Sbjct: 184 IEPVQGEGGVREPSHSFFRALRELCDDKGLLLVFDEVQTGMGRTGELFAYKRLGVEPDVM 243

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
            +AK +GGGFPIGACL T E A+ M  GSHGST+GGN LA+     VL+++ + GF ++V
Sbjct: 244 ALAKALGGGFPIGACLTTREAASGMTAGSHGSTFGGNPLAIAAASAVLDVMLAPGFFDHV 303

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDN 361
              + +L + L +I +R+P +  EVRG+GLLIGL+       L A  RDE LLT  + +N
Sbjct: 304 KRASLVLKQKLASIIDRYPGVLREVRGEGLLIGLQAALPAPDLIAALRDEKLLTVGAGEN 363

Query: 362 VVRILPPLTITAEEIHEGLERIERTAIKLSH 392
           VVR+LPPL +T  EI + + RIE+   +L+ 
Sbjct: 364 VVRLLPPLIVTESEIEDAVGRIEKACARLAQ 394


>gi|299134024|ref|ZP_07027217.1| acetylornithine and succinylornithine aminotransferase [Afipia sp.
           1NLS2]
 gi|298590771|gb|EFI50973.1| acetylornithine and succinylornithine aminotransferase [Afipia sp.
           1NLS2]
          Length = 406

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 284/389 (73%), Gaps = 2/389 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +  L   + + ++ FE+G+GAWL + NG  +LDF SG+AVN+LGH+HP LVA +++Q+ K
Sbjct: 6   SSHLMPVFARVNLAFERGEGAWLVATNGERYLDFTSGVAVNALGHAHPHLVAAVQAQAAK 65

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SNL++S   E  A  L  ++FAD VFF NSGAE++ECAIK  R+YH   G   +FR
Sbjct: 66  LWHMSNLFKSPDGEKVAARLCENSFADEVFFANSGAEAMECAIKVTRKYHAAKGHPERFR 125

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+TFEGAFHGRTLAT++AGG+ +YL+GFGPK+EGFDQ    D++++K  I   TA ILIE
Sbjct: 126 IITFEGAFHGRTLATLAAGGQEKYLDGFGPKVEGFDQVPLGDIEAVKKAIGPQTAGILIE 185

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGGVR+    F + LR++CDD   LLIFDEVQTG GRTG+LFAY+   V+PD+M +
Sbjct: 186 PLQGEGGVREPAHSFFRALRELCDDKGLLLIFDEVQTGMGRTGELFAYKRLGVEPDVMAL 245

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGACLAT E A+ M  GSHGST+GGN LA+     VL+++ + GF ++V  
Sbjct: 246 AKALGGGFPIGACLATREAASGMTAGSHGSTFGGNPLAIAAATAVLDVMLAPGFFDHVKR 305

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLK-TVFSPALLAAKFRDECLLTAPSSDNV 362
            + IL + L ++ +R+PN+  EVRG+GLLIGL+  V SP L+ A  R+E LLT  + +NV
Sbjct: 306 ASLILKQKLASVIDRYPNVLREVRGEGLLIGLQAAVPSPDLIVA-LREEKLLTVGAGENV 364

Query: 363 VRILPPLTITAEEIHEGLERIERTAIKLS 391
           VR+LPPL +T  EI E + R+E+   +L+
Sbjct: 365 VRLLPPLIVTEAEIEEAVGRVEKACARLA 393


>gi|146343543|ref|YP_001208591.1| acetylornithine transaminase protein [Bradyrhizobium sp. ORS278]
 gi|146196349|emb|CAL80376.1| acetylornithine transaminase (NAcOATase and DapATase),
           PLP-dependent [Bradyrhizobium sp. ORS278]
          Length = 403

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/385 (51%), Positives = 269/385 (69%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + + D+ FE+G+GAWL + NG  +LDF SG+AVNSLGH+HP LV  L+ Q+ KLWH
Sbjct: 9   LLPVFARVDLSFERGEGAWLIAANGDRYLDFTSGVAVNSLGHAHPHLVKALQEQATKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL++S   E  A  L   +FAD VFF NSGAE++E AIK  R+YH   G   ++RI+T
Sbjct: 69  MSNLFKSPDGERLAARLCEQSFADYVFFANSGAEAMEGAIKITRKYHASKGHPERYRIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLAT++A G  +YL+GFGP ++GFDQ  F D++++K  I   TA IL+EP+Q
Sbjct: 129 FEGAFHGRTLATLAATGSAKYLDGFGPPMDGFDQVPFGDIEAVKKAIGPHTAGILVEPVQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR  P  F + LR++CDD   LL+ DEVQTG GRTG LFA+ W  V PD+M++AK 
Sbjct: 189 GEGGVRTAPLTFYKALRQLCDDNGLLLVIDEVQTGMGRTGDLFAHRWLGVTPDVMSLAKA 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGA LAT E A+ M  GSHGST+GGN LA+     VL+++ + GF ++V  ++ 
Sbjct: 249 LGGGFPIGAVLATAEAASGMTPGSHGSTFGGNPLAVSAANAVLDVMLAPGFFDHVRKMSL 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L A+K+R P++  E+RG+GLLIG+K V     L A  RD+ LLT  + DNVVR L
Sbjct: 309 LLKQKLAAVKDRHPDIIAEIRGEGLLIGVKAVVPSGDLVAALRDQKLLTVGAGDNVVRFL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL +   EI + +E ++R    LS
Sbjct: 369 PPLIVNESEIEQSVEMLDRACTALS 393


>gi|170748736|ref|YP_001754996.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170655258|gb|ACB24313.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 396

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/381 (53%), Positives = 272/381 (71%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ + FE+G+GAWL +E G  +LDF +GIAVN LGH+HP LV  L  Q+ K+WH
Sbjct: 5   LLPTYVRAPLAFERGEGAWLVTEGGERYLDFGAGIAVNGLGHAHPHLVGALTEQASKIWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL+Q    E     L+ +TFAD VFF NSGAE+ E AIK AR+YH   G+  ++RIVT
Sbjct: 65  TSNLFQIPGGERLGQRLVDATFADVVFFCNSGAEANEAAIKIARKYHAAGGQPERYRIVT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGRTLAT++AGG+ +Y+EGFGPK+EGFDQ    D  +L+  I  +TAA++IEPIQ
Sbjct: 125 FAGAFHGRTLATLAAGGQQKYIEGFGPKVEGFDQVPAGDWAALEAAIGPETAALMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR++P   L++LR+ICD    LLI DEVQTG GRTG+LFA+EW+ + PDIM++AKG
Sbjct: 185 GEGGVREIPHADLRRLREICDANGLLLIMDEVQTGVGRTGRLFAHEWSGITPDIMSVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G+HG+T+GGN LAM +G  VL+++  +GFL  V     
Sbjct: 245 IGGGFPLGACLATREAARGMTAGTHGTTFGGNPLAMAVGNAVLDVVLEEGFLARVARSGL 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L A+++R P++  E+RG+GL++GLK        AA  RD  LL  P+ DN+VR+L
Sbjct: 305 LLKQKLAALRDRHPHVIQEIRGEGLMLGLKLGVPNTDFAAAARDAHLLVIPAGDNIVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPLTI   EI E + R++  A
Sbjct: 365 PPLTIGEAEIDEAVRRLDAAA 385


>gi|218532330|ref|YP_002423146.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium chloromethanicum CM4]
 gi|254563402|ref|YP_003070497.1| succinylornithine transaminase, also has acetylornitine
           transaminase activity, PLP-dependent [Methylobacterium
           extorquens DM4]
 gi|218524633|gb|ACK85218.1| acetylornithine and succinylornithine aminotransferase
           [Methylobacterium chloromethanicum CM4]
 gi|254270680|emb|CAX26684.1| succinylornithine transaminase, also has acetylornitine
           transaminase activity, PLP-dependent [Methylobacterium
           extorquens DM4]
          Length = 396

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 270/384 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ I FE+G+GAWL +E+G  +LDF +GIAVN+LGH+HP LV  L +Q++KLWH
Sbjct: 5   LLPTYARAPIAFERGEGAWLVAEDGDRYLDFGAGIAVNALGHAHPHLVEALTTQAQKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL+Q  + E     L+ +TFAD  FF NSGAE+ E AIK AR+YH   G   ++RI+T
Sbjct: 65  TSNLFQIPEGERLGQRLVDATFADVAFFANSGAEANEAAIKMARKYHAAGGHPERYRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +Y+EGFGPK+EGFDQ    D  +L+  I  +TAA++IEPIQ
Sbjct: 125 FEGAFHGRTLATIAAGGQQKYIEGFGPKVEGFDQVPVGDFAALEAVIGPETAALMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P E L++LR +C+    LLI DEVQTG GRTGK FA+EW+ V PDIM+ AKG
Sbjct: 185 GEGGLRVIPGETLRRLRALCEAHGLLLIMDEVQTGVGRTGKFFAHEWSGVTPDIMSAAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+G CLAT E A  M  G+HG+T+GGN LAM +G  VL+++  DGFL +V  +  
Sbjct: 245 IGGGFPLGVCLATAEAARGMTAGTHGTTFGGNPLAMAVGNAVLDVVLGDGFLAHVERMDL 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  + +R P++F E+RGQGL+ GLK         A  R   LL  P+ DNVVR+L
Sbjct: 305 LLTQKLAGLIDRHPHVFAELRGQGLMRGLKLNLPNTAFTAAARARHLLVIPAGDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL +   E+ E + R+E  A  L
Sbjct: 365 PPLIVGETEVDEAVARLEAAATDL 388


>gi|240140892|ref|YP_002965372.1| succinylornithine transaminase, also has acetylornitine
           transaminase activity, PLP-dependent [Methylobacterium
           extorquens AM1]
 gi|240010869|gb|ACS42095.1| succinylornithine transaminase, also has acetylornitine
           transaminase activity, PLP-dependent [Methylobacterium
           extorquens AM1]
          Length = 396

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 203/384 (52%), Positives = 269/384 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ I FE+G+GAWL +E+G  +LDF +GIAVN+LGH+HP LV  L +Q++KLWH
Sbjct: 5   LLPTYARAPIAFERGEGAWLVAEDGDRYLDFGAGIAVNALGHAHPHLVEALTTQAQKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL+Q  + E     L+ +TFAD  FF NSGAE+ E AIK AR+YH   G   ++RI+T
Sbjct: 65  TSNLFQIPEGERLGQRLVDATFADVAFFANSGAEANEAAIKMARKYHAAGGHPERYRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG+ +Y+EGFGPK+EGFDQ    D  +L+  I  +TAA++IEPIQ
Sbjct: 125 FEGAFHGRTLATIAAGGQQKYIEGFGPKVEGFDQVPVGDFAALEAVIGPETAALMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +  E L++LR +C+    LLI DEVQTG GRTGK FA+EW+ V PDIM+ AKG
Sbjct: 185 GEGGLRVISGEILRRLRALCEAHGLLLIMDEVQTGVGRTGKFFAHEWSGVTPDIMSAAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+G CLAT E A  M  G+HG+T+GGN LAM +G  VL+++  DGFL +V  +  
Sbjct: 245 IGGGFPLGVCLATAEAARGMTAGTHGTTFGGNPLAMAVGNAVLDVVLGDGFLAHVERMDL 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  + +R P++F E+RGQGL+ GLK         A  R   LL  P+ DNVVR+L
Sbjct: 305 LLTQKLAGLIDRHPHVFAELRGQGLMRGLKLNLPNTAFTAAARARHLLVIPAGDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL +   E+ E + R+E  A  L
Sbjct: 365 PPLIVGETEVDEAVARLEAAATDL 388


>gi|74419581|gb|ABA03780.1| acetylornithine aminotransferase apoenzyme [Nitrobacter
           winogradskyi Nb-255]
          Length = 423

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 203/384 (52%), Positives = 271/384 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ FE G+GAWL   +G  +LDF SG+AVN+LGH HP LVA L++Q+ KLWH
Sbjct: 29  LLPVFARADLSFESGEGAWLLGSDGGRYLDFTSGVAVNALGHCHPHLVAALQAQTAKLWH 88

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++S   E  A  L   +FAD VFF NSGAE+VECAIK  RRYH   G   ++RIVT
Sbjct: 89  VSNLFKSPDGERLAVRLCEQSFADFVFFANSGAEAVECAIKIVRRYHAGRGNPERYRIVT 148

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLA ++A G  +YLEG+GP  +GFDQ    D++++K  +  +TA ILIEP+Q
Sbjct: 149 FEGAFHGRTLAMLAATGSKKYLEGYGPPADGFDQVPLDDIEAVKKAVGPETAGILIEPLQ 208

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR+ P  F + LR++CD+   LL+FDEVQTG GRTG LFAY    V PD+M++AK 
Sbjct: 209 GEGGVREPPPAFFRALRQLCDERGLLLVFDEVQTGMGRTGDLFAYRRIGVAPDVMSLAKA 268

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A+ M  GSHGST+GGN LA+     VL+++ + GF E    ++ 
Sbjct: 269 LGGGFPIGACLATAEAASGMTPGSHGSTFGGNPLAVAAAHAVLDVMLAPGFFERTRKMSL 328

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L ++ +R+P++  EVRG+GLLIGLK V     L +  R+E LLT  + +NVVR+L
Sbjct: 329 LLKQKLASLVDRYPDVLSEVRGEGLLIGLKAVVPSGDLVSALREEKLLTVGAGENVVRLL 388

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL I   EI+E  +R+ER  ++L
Sbjct: 389 PPLIIGEAEINEAAQRLERACVRL 412


>gi|158425652|ref|YP_001526944.1| acetylornithine and succinylornithine aminotransferase
           [Azorhizobium caulinodans ORS 571]
 gi|158332541|dbj|BAF90026.1| acetylornithine and succinylornithine aminotransferase
           [Azorhizobium caulinodans ORS 571]
          Length = 402

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 203/378 (53%), Positives = 263/378 (69%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY + ++ FE+G+G WL + +G  +LDF +GIAVN LGH++P L   L  Q+ KLWH
Sbjct: 5   VLPTYARINLEFERGEGCWLVTTDGRRYLDFTAGIAVNVLGHANPYLAQALTEQAGKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL++    E  A  L  +TFAD VFFTNSGAE++ECAIK AR+Y Y++G   + R++ 
Sbjct: 65  TSNLFRIAGGERLAERLTQATFADTVFFTNSGAEALECAIKMARKYQYVSGHPERNRLIA 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLATI+AGG  +YLEGFGP++ GFD   F DL+++K  I   TA IL+EPIQ
Sbjct: 125 FEGAFHGRTLATIAAGGNAKYLEGFGPELPGFDHVPFGDLEAVKAAIGPATAGILLEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR  P  FL  LR +CD+   LL+ DEVQ+G GRTGKLFA+EWA V PDIM++AKG
Sbjct: 185 GEGGVRVPPSGFLAALRALCDEHGLLLVLDEVQSGVGRTGKLFAHEWAGVTPDIMSVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G+HGSTYGGN LAM +G  VL+ +    FLE+V  I+ 
Sbjct: 245 IGGGFPMGACLATEEAAKGMTLGTHGSTYGGNPLAMAVGNAVLDKVLEPSFLEHVNQISL 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
              + L  +K+R P +  EVRGQGLL+GL+       L    R+E LL   + DNVVR+L
Sbjct: 305 RFTQLLAGVKDRHPGVIAEVRGQGLLLGLRANVPAGDLVVALREEGLLAPGAGDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIE 384
           PPL ++ EE+    E+IE
Sbjct: 365 PPLVVSEEEVKLAAEKIE 382


>gi|162139850|ref|YP_317132.2| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Nitrobacter winogradskyi Nb-255]
          Length = 403

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/384 (52%), Positives = 271/384 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ FE G+GAWL   +G  +LDF SG+AVN+LGH HP LVA L++Q+ KLWH
Sbjct: 9   LLPVFARADLSFESGEGAWLLGSDGGRYLDFTSGVAVNALGHCHPHLVAALQAQTAKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++S   E  A  L   +FAD VFF NSGAE+VECAIK  RRYH   G   ++RIVT
Sbjct: 69  VSNLFKSPDGERLAVRLCEQSFADFVFFANSGAEAVECAIKIVRRYHAGRGNPERYRIVT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLA ++A G  +YLEG+GP  +GFDQ    D++++K  +  +TA ILIEP+Q
Sbjct: 129 FEGAFHGRTLAMLAATGSKKYLEGYGPPADGFDQVPLDDIEAVKKAVGPETAGILIEPLQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR+ P  F + LR++CD+   LL+FDEVQTG GRTG LFAY    V PD+M++AK 
Sbjct: 189 GEGGVREPPPAFFRALRQLCDERGLLLVFDEVQTGMGRTGDLFAYRRIGVAPDVMSLAKA 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A+ M  GSHGST+GGN LA+     VL+++ + GF E    ++ 
Sbjct: 249 LGGGFPIGACLATAEAASGMTPGSHGSTFGGNPLAVAAAHAVLDVMLAPGFFERTRKMSL 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L ++ +R+P++  EVRG+GLLIGLK V     L +  R+E LLT  + +NVVR+L
Sbjct: 309 LLKQKLASLVDRYPDVLSEVRGEGLLIGLKAVVPSGDLVSALREEKLLTVGAGENVVRLL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL I   EI+E  +R+ER  ++L
Sbjct: 369 PPLIIGEAEINEAAQRLERACVRL 392


>gi|85713648|ref|ZP_01044638.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Nitrobacter sp. Nb-311A]
 gi|85699552|gb|EAQ37419.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Nitrobacter sp. Nb-311A]
          Length = 403

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/385 (52%), Positives = 271/385 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ FE G+GAWL   +G  +LDF SG+AVN+LGH HP L+A L++Q+ KLWH
Sbjct: 9   LLPVFARADLSFESGEGAWLLGSDGGRYLDFTSGVAVNALGHCHPHLIAALQAQAAKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++S   E  A  L   +FAD VFF NSGAE+VECAIK  RRYH   G   ++RI+T
Sbjct: 69  VSNLFKSPDGERLAARLCDQSFADFVFFANSGAEAVECAIKVVRRYHAHRGHPERYRIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLA ++A G  +YLEG+GP  +GFDQ    D++++K  I  +TA ILIEP+Q
Sbjct: 129 FEGAFHGRTLAMLAATGSKKYLEGYGPPADGFDQVPLDDMEAVKKAIGPETAGILIEPLQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR+ P  F + LR++CD+   LL+FDEVQTG GRTG LFAY+   V PD+M++AK 
Sbjct: 189 GEGGVREPPHAFFRALRQLCDERGLLLVFDEVQTGMGRTGDLFAYKRIGVAPDVMSLAKA 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A+ M  GSHGST+GGN LA+ +   VL+++   GF E    ++ 
Sbjct: 249 LGGGFPIGACLATAEAASGMTPGSHGSTFGGNPLAVAVAHAVLDVMLEPGFFERTRKMSL 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L ++ +R+P++  EVRG+GLLIGLK V     L    R+E LLT  + +NVVR+L
Sbjct: 309 LLKQKLASVVDRYPDVLSEVRGEGLLIGLKAVVPSGDLVGALREEKLLTVGAGENVVRLL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL I   EI E + R+ER  ++LS
Sbjct: 369 PPLIIGDAEIDESVRRLERACVRLS 393


>gi|312115102|ref|YP_004012698.1| acetylornithine and succinylornithine aminotransferase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311220231|gb|ADP71599.1| acetylornithine and succinylornithine aminotransferase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 393

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/384 (52%), Positives = 273/384 (71%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY + ++ FE+G+GAWL +  G  +LDF SG+AVN+LGH+HP L+A L  Q+ K+WH
Sbjct: 4   VLGTYARINVEFERGEGAWLETAAGERYLDFGSGVAVNALGHAHPHLIAALTEQAHKVWH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+   QE  A  L   TFAD+VFFTNSGAE++EC+IK AR+YH   G+  ++R++T
Sbjct: 64  TSNLYRVPGQERLAERLCALTFADKVFFTNSGAEAMECSIKMARKYHSYNGQPERWRVIT 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRTLATI+AG + ++L+GFGPK++GFDQ    DL +L+  I+++TAA+LIEPIQ
Sbjct: 124 FVDAFHGRTLATIAAGNQEKHLKGFGPKVDGFDQVPVGDLDALRAAITHETAALLIEPIQ 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE GVR V   FL+ LR+I D+   LLI DEVQTG GRTGKLFA+EWA ++PDIM IAKG
Sbjct: 184 GESGVRPVGWPFLRALREIADEHGLLLILDEVQTGVGRTGKLFAHEWAGIEPDIMGIAKG 243

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A+ M  GSHGST+GGN LAM +   VL+I     FL NV  ++ 
Sbjct: 244 IGGGFPVGACLATEKAASGMTAGSHGSTFGGNPLAMAVANAVLDIATKPEFLGNVQEMSL 303

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L  I +R P +  ++RG+GLL+GLK     A +++    E LLT  + DNVVR+L
Sbjct: 304 LFKQRLAEIIDRHPRIIADIRGEGLLLGLKCKVPSADVSSTLFAEKLLTVSAGDNVVRLL 363

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL +T  EI +  E+IE    +L
Sbjct: 364 PPLIVTEAEIKDACEKIESACARL 387


>gi|254471830|ref|ZP_05085231.1| acetylornithine aminotransferase [Pseudovibrio sp. JE062]
 gi|211959032|gb|EEA94231.1| acetylornithine aminotransferase [Pseudovibrio sp. JE062]
          Length = 394

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/385 (52%), Positives = 271/385 (70%)

Query: 8   FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV 67
             TY +SD+ FE+G+G WL++ +G  ++D ASGIAV+ LGH+HP+LV  LK Q+EKLWHV
Sbjct: 1   MQTYARSDLAFERGEGVWLYAADGRRYMDCASGIAVSGLGHAHPKLVEALKGQAEKLWHV 60

Query: 68  SNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTF 127
           +NLY   + E  A  L  +TFAD VFFTNSG E+ E A+K ARRYH+  G   K RI+TF
Sbjct: 61  TNLYTIPEGEKLAKLLTDNTFADVVFFTNSGTEATEGAMKAARRYHFAKGNPEKNRIITF 120

Query: 128 EGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQG 187
           E AFHGRT+A ++AGG+ +YLEGFGP  EGFDQ    DL+++K  +  +TAAI++EP+QG
Sbjct: 121 ENAFHGRTMAALAAGGQQKYLEGFGPAPEGFDQVPAGDLEAVKKIVGPETAAIMLEPVQG 180

Query: 188 EGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGM 247
           EGG+R +   FL+ LR+ICD+ D LLI+DE+QTG GRTGKLFA+EWA V PD+M IAKG+
Sbjct: 181 EGGIRSMDPAFLKGLREICDENDLLLIYDEIQTGVGRTGKLFAHEWAGVAPDLMAIAKGI 240

Query: 248 GGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKI 307
           GGGFP+GA LATNE A+ M  G HG+T+GGN LAM +G  V+  +   GFLE V     +
Sbjct: 241 GGGFPMGAFLATNEAASGMVPGVHGTTFGGNPLAMAVGTAVMETVLEPGFLEAVQEKGLM 300

Query: 308 LFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILP 367
           L + L  I ++  ++F  VRG+GL++GLK       L    R+  LL   + DNV+RI+P
Sbjct: 301 LKQKLACIVDQHGDVFELVRGEGLMLGLKCKVPNTQLLVHMRNNGLLPVGAGDNVLRIMP 360

Query: 368 PLTITAEEIHEGLERIERTAIKLSH 392
           P+TITAEEI    ++IE  A  + +
Sbjct: 361 PMTITAEEIDVLAQKIEAAAADMEN 385


>gi|300021557|ref|YP_003754168.1| acetylornithine and succinylornithine aminotransferase
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523378|gb|ADJ21847.1| acetylornithine and succinylornithine aminotransferase
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 390

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/386 (53%), Positives = 265/386 (68%), Gaps = 2/386 (0%)

Query: 8   FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV 67
             TY + +I F +G+G WLF+ENG  +LDF SG+AVN+LGH+HP LVA LK+Q++KLWH 
Sbjct: 1   MGTYGRQNIVFARGEGCWLFAENGDRYLDFGSGVAVNALGHAHPALVAALKAQADKLWHT 60

Query: 68  SNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTF 127
           SNLY+   QE  A  L   TFA+RVFF NSGAE+ E AIK ARRYHY++G   + RI+TF
Sbjct: 61  SNLYRVEGQETVAEKLTRLTFAERVFFCNSGAEACEGAIKVARRYHYVSGHLERQRIITF 120

Query: 128 EGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQG 187
            GAFHGRTLAT++A G  +YLEGF P+  GFD     DL +L+  IS +TAAI++EPIQG
Sbjct: 121 RGAFHGRTLATLAAAGNEKYLEGFAPEAGGFDHVDAGDLAALEAAISPETAAIMLEPIQG 180

Query: 188 EGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGM 247
           EGGVR    E L+ +R +CD    LL+ DEVQTG GRTGKLFAYEWA + PD+M +AKG+
Sbjct: 181 EGGVRAFSPEDLRAIRDLCDKHGLLLVLDEVQTGVGRTGKLFAYEWAGITPDVMAVAKGL 240

Query: 248 GGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKI 307
           G GFP+GA LAT E A  M  G+HGST+GGN LAM +   VL+I+    FLE V   A  
Sbjct: 241 GSGFPVGAILATAEAAKGMTPGTHGSTFGGNPLAMAVASTVLDIVSEPEFLEGVRTKALH 300

Query: 308 LFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
           L +GL+ +K++  ++  EVRG GLL G  LK   SP  L A   DE LL   + DN VR+
Sbjct: 301 LKQGLSGLKDQHADVVEEVRGAGLLTGLKLKAHVSPQQLVAAAMDEKLLLVGAGDNCVRV 360

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPL  + ++I E ++ + R   +++
Sbjct: 361 LPPLIASDKDIAEAMQILSRALSRVA 386


>gi|148252344|ref|YP_001236929.1| acetylornithine transaminase protein [Bradyrhizobium sp. BTAi1]
 gi|146404517|gb|ABQ33023.1| acetylornithine aminotransferase apoenzyme [Bradyrhizobium sp.
           BTAi1]
          Length = 403

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 268/385 (69%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + + D+ FE+G+GAWL + NG  +LDF SG+AVNSLGH+HP LV  L+ Q+ KLWH
Sbjct: 9   LLPVFARVDLAFERGEGAWLIATNGDRYLDFTSGVAVNSLGHAHPHLVKALQEQATKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL++S   E  A  L   +FAD VFF NSGAE++E AIK  R+YH   G   ++RI+T
Sbjct: 69  MSNLFKSPDGERLAARLCEQSFADYVFFANSGAEAMEGAIKITRKYHAAKGHPERYRIIT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLAT++A G  +YLEGFGP ++GFDQ    DL+++K  I   TA ILIEP+Q
Sbjct: 129 FEGAFHGRTLATLAATGSAKYLEGFGPPMDGFDQVPLGDLEAVKKAIGPHTAGILIEPVQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR  P  F + LR++CDD   LL+ DEVQTG GRTG LFA+ W  V PD+M++AK 
Sbjct: 189 GEGGVRTAPLSFYKALRQLCDDHGLLLVVDEVQTGMGRTGDLFAHRWLGVTPDVMSLAKA 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGA LAT E A+ M  GSHGST+GGN LA+     VL+++ + GF E+V  ++ 
Sbjct: 249 LGGGFPIGAVLATAEAASGMTPGSHGSTFGGNPLAVAAANAVLDVMLAPGFFEHVRRMSL 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L A+ +R P++  E+RG+GLLIG+K V     L A  R++ LLT  + DNVVR L
Sbjct: 309 LLKQKLAAVVDRHPDIISEIRGEGLLIGVKAVVPSGDLVAALREQKLLTVGAGDNVVRFL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL ++  EI + +E ++R    LS
Sbjct: 369 PPLIVSEAEIEQSVEMLDRACAALS 393


>gi|39651691|emb|CAE30213.1| putative acetylornithine aminotransferase [Rhodopseudomonas
           palustris CGA009]
          Length = 420

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/386 (51%), Positives = 270/386 (69%), Gaps = 2/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ FE+G+G WL   +G  +LDF SG+AVN+LGH HP LV  L+ Q+ KLWH
Sbjct: 27  LLPVFARADVAFERGEGVWLHGTDGERYLDFTSGVAVNALGHCHPHLVEALQQQASKLWH 86

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++S + E  A  L   +FAD+VFF NSGAE+VECA+K AR YH+  G+  + R++T
Sbjct: 87  VSNLFKSPEGERLAARLCEQSFADKVFFCNSGAEAVECALKMARHYHFSKGEPERTRVIT 146

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTL T++A G  +YLEG+G  +EGFDQ    DL ++K  I  +TAAILIEP+Q
Sbjct: 147 FEGAFHGRTLGTLAATGSAKYLEGYGQPLEGFDQLPLGDLDAVKAAIGPNTAAILIEPLQ 206

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR     F + LR++CD    LL+FDEVQTG GRTG+LFAY+   V PDIM +AK 
Sbjct: 207 GEGGVRSPELAFFRGLRELCDAHGLLLVFDEVQTGMGRTGELFAYKRIGVAPDIMALAKA 266

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACL+T E A  M  G+HGST+GGN LA+ +   VL+++   GF ++V  ++ 
Sbjct: 267 LGGGFPIGACLSTAEAAKGMAPGAHGSTFGGNPLAVAVANAVLDVMLQPGFFDHVKKMSL 326

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF-SPALLAAKFRDECLLTAPSSDNVVRI 365
           +L + L  + +R P +  E+RG+GLL+GLK V  SP L+AA  R E LL+  + DNVVR+
Sbjct: 327 LLKQKLAGVVDRHPRVVSEIRGEGLLLGLKAVVPSPELIAA-LRAEKLLSVGAGDNVVRL 385

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPL +   E+ E + R+ER  + L+
Sbjct: 386 LPPLIVNEAELDEAVGRLERACVTLA 411


>gi|316936254|ref|YP_004111236.1| acetylornithine and succinylornithine aminotransferase
           [Rhodopseudomonas palustris DX-1]
 gi|315603968|gb|ADU46503.1| acetylornithine and succinylornithine aminotransferase
           [Rhodopseudomonas palustris DX-1]
          Length = 403

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/386 (52%), Positives = 266/386 (68%), Gaps = 2/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ FE+G+G WL   +G  +LDF SG+AVN+LGH HP LV  L+ Q+ +LWH
Sbjct: 10  LLPVFARADVAFERGEGVWLHGTDGERYLDFTSGVAVNALGHCHPHLVEALQQQATRLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL++S   E  A  L   +FAD VFF NSGAE+VECA+K AR YH+  G   + R++T
Sbjct: 70  MSNLFKSPDGERLAARLCEHSFADMVFFCNSGAEAVECALKMARHYHFSKGAPERTRVIT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTL T++A G  +YLEG+GP +EGFDQ    DL ++K  I   TAAILIEP+Q
Sbjct: 130 FEGAFHGRTLGTLAATGAAKYLEGYGPPLEGFDQLPLGDLDAVKAAIGPHTAAILIEPLQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR     F + LR++CD    LLIFDEVQTG GRTG+LFA+    V PDIM +AK 
Sbjct: 190 GEGGVRSPEPSFFRALRELCDAHGLLLIFDEVQTGMGRTGELFAHNRFGVAPDIMALAKA 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACL+T E A  M  G+HGST+GGN LA+ +   VL+++   GF +NV   + 
Sbjct: 250 LGGGFPIGACLSTAEAAKGMAPGAHGSTFGGNPLAVAVANAVLDVMLQPGFFDNVKRSSL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF-SPALLAAKFRDECLLTAPSSDNVVRI 365
           +L + L  + +R P +  EVRG+GLL+GLK V  SP L+AA  R E LLT  + DNVVR+
Sbjct: 310 LLKQKLAGVVDRHPQVLSEVRGEGLLLGLKAVVPSPELIAA-LRAEKLLTVGAGDNVVRL 368

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPL ++  EI E + R+ER  + L+
Sbjct: 369 LPPLIVSEAEIDEAIGRLERACVVLA 394


>gi|161610767|ref|NP_950107.2| acetylornithine transaminase protein [Rhodopseudomonas palustris
           CGA009]
 gi|192293616|ref|YP_001994221.1| acetylornithine transaminase protein [Rhodopseudomonas palustris
           TIE-1]
 gi|192287365|gb|ACF03746.1| acetylornithine and succinylornithine aminotransferase
           [Rhodopseudomonas palustris TIE-1]
          Length = 403

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/386 (51%), Positives = 270/386 (69%), Gaps = 2/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ FE+G+G WL   +G  +LDF SG+AVN+LGH HP LV  L+ Q+ KLWH
Sbjct: 10  LLPVFARADVAFERGEGVWLHGTDGERYLDFTSGVAVNALGHCHPHLVEALQQQASKLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++S + E  A  L   +FAD+VFF NSGAE+VECA+K AR YH+  G+  + R++T
Sbjct: 70  VSNLFKSPEGERLAARLCEQSFADKVFFCNSGAEAVECALKMARHYHFSKGEPERTRVIT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTL T++A G  +YLEG+G  +EGFDQ    DL ++K  I  +TAAILIEP+Q
Sbjct: 130 FEGAFHGRTLGTLAATGSAKYLEGYGQPLEGFDQLPLGDLDAVKAAIGPNTAAILIEPLQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR     F + LR++CD    LL+FDEVQTG GRTG+LFAY+   V PDIM +AK 
Sbjct: 190 GEGGVRSPELAFFRGLRELCDAHGLLLVFDEVQTGMGRTGELFAYKRIGVAPDIMALAKA 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACL+T E A  M  G+HGST+GGN LA+ +   VL+++   GF ++V  ++ 
Sbjct: 250 LGGGFPIGACLSTAEAAKGMAPGAHGSTFGGNPLAVAVANAVLDVMLQPGFFDHVKKMSL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF-SPALLAAKFRDECLLTAPSSDNVVRI 365
           +L + L  + +R P +  E+RG+GLL+GLK V  SP L+AA  R E LL+  + DNVVR+
Sbjct: 310 LLKQKLAGVVDRHPRVVSEIRGEGLLLGLKAVVPSPELIAA-LRAEKLLSVGAGDNVVRL 368

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPL +   E+ E + R+ER  + L+
Sbjct: 369 LPPLIVNEAELDEAVGRLERACVTLA 394


>gi|254292719|ref|YP_003058742.1| acetylornithine and succinylornithine aminotransferase [Hirschia
           baltica ATCC 49814]
 gi|254041250|gb|ACT58045.1| acetylornithine and succinylornithine aminotransferase [Hirschia
           baltica ATCC 49814]
          Length = 399

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/379 (50%), Positives = 268/379 (70%), Gaps = 1/379 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y   ++ FE+G+G  L+S  G  +LDF +GI+VN LGH+HP+LV  L+ QSEKLWH
Sbjct: 5   MMPVYAPPEVVFERGEGLRLYSSEGREYLDFIAGISVNCLGHAHPKLVKTLQEQSEKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+++  + E  A      TFADRVFFTNSG E++ECAIKTAR+Y Y++GK +K+RI++
Sbjct: 65  ISNMFRVPEGERLAERYTADTFADRVFFTNSGTEAIECAIKTARKYQYVSGKEDKYRIIS 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEG+FHGRTL  ++AG    Y EGFGP +EGF    F D+ +    + +D AA+LIEP+Q
Sbjct: 125 FEGSFHGRTLGAVNAGANPNYREGFGPAMEGFTHLPFDDVDAFNEAMGDDVAAVLIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW-ANVKPDIMTIAK 245
           GEGG R+VPE FL+ LR+ CD+  ALLI+DEVQ G GRTGKLFAYEW  +V+PDI+T+AK
Sbjct: 185 GEGGCREVPEAFLKLLREKCDEFGALLIYDEVQCGAGRTGKLFAYEWFTDVEPDIVTVAK 244

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GACL T E A  M  GSHGSTYGGN +AM +G  V + + SDGFLENV  ++
Sbjct: 245 GVGGGFPLGACLTTEEAAKGMQPGSHGSTYGGNPMAMAVGNAVWDELTSDGFLENVQRVS 304

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
            +L + L+++ +R+P++   +RG+GLL G+     P  +  K  ++ L+   +  NVVR+
Sbjct: 305 GVLTQSLSSLIDRYPDLVDGLRGKGLLRGIALKIDPMAIRKKALEKGLIIGTAGGNVVRL 364

Query: 366 LPPLTITAEEIHEGLERIE 384
            PPL  T E++ + +  I+
Sbjct: 365 APPLIATDEDVLKAVSLID 383


>gi|114569038|ref|YP_755718.1| acetylornithine aminotransferase [Maricaulis maris MCS10]
 gi|114339500|gb|ABI64780.1| acetylornithine aminotransferase apoenzyme [Maricaulis maris MCS10]
          Length = 395

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/383 (52%), Positives = 268/383 (69%), Gaps = 3/383 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           + +TY   D+ F+ GKG  LF+ +G  +LDF SGIAVN LGH+HP+ VA L  Q+ KLWH
Sbjct: 5   MMDTYAPPDLVFDHGKGPRLFTASGDGYLDFISGIAVNCLGHAHPKAVAALNEQAGKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+++       A  L  +TFADRVFFTNSGAE++ECA+KTARRYHY+ G   ++RI+T
Sbjct: 65  LSNMFKVPAGVELAEKLTKATFADRVFFTNSGAEAMECALKTARRYHYVNGNPQRYRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGRT   I+AGG  +YLEGFGP +EGFDQ +F DL+++K  IS++TAAI +EP+Q
Sbjct: 125 FTGAFHGRTYGAINAGGNPKYLEGFGPAMEGFDQVEFGDLEAVKAVISDETAAICVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN-VKPDIMTIAK 245
           GEGGVR   + FL+ LR++CD+   +LI+DEVQ+G GRTGKLFA++W +  +PDIM  AK
Sbjct: 185 GEGGVRAPEDSFLRGLRQLCDEHGLMLIYDEVQSGAGRTGKLFAHQWVDGAEPDIMAAAK 244

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GACLAT   A  M  G+HGSTYGG  LAM +G  V + + SDGFL+ V+ ++
Sbjct: 245 GIGGGFPMGACLATEAAAKGMVVGTHGSTYGGGPLAMAVGNVVFDELTSDGFLDQVVEVS 304

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDNVV 363
             L + L  + +R  +   EVRG+GLLIG  LK  F P  LA   RD  LL   + DNV 
Sbjct: 305 NYLTQQLHGLMDRHADKVEEVRGKGLLIGMKLKPGFDPKKLAGLARDRHLLIGAAGDNVS 364

Query: 364 RILPPLTITAEEIHEGLERIERT 386
           R+ PPL IT ++  E +  ++  
Sbjct: 365 RLAPPLVITKDDASEAVAVLDEA 387


>gi|90426387|ref|YP_534757.1| acetylornithine transaminase protein [Rhodopseudomonas palustris
           BisB18]
 gi|90108401|gb|ABD90438.1| acetylornithine aminotransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 405

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 269/385 (69%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ F +G+G WL S  G  +LDF SGIAVN+LGH HP LVA L+ Q+ +LWH
Sbjct: 10  LLPVFARADLAFARGEGVWLISTTGERYLDFTSGIAVNALGHCHPHLVAALQEQATQLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL++S   E  A  L   +FAD VFF NSGAE++ECAIK  R++H   G   ++RI+T
Sbjct: 70  MSNLFKSPDGERLAARLCEQSFADLVFFANSGAEAMECAIKITRKHHAAKGHPERYRIIT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLAT++A G  +YL+GFGP ++GFDQ    D+ ++K  I   TA ILIEP+Q
Sbjct: 130 FEGAFHGRTLATLAATGSAKYLDGFGPPMDGFDQVPLGDIAAVKAAIGPGTAGILIEPLQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR  P  F + LR++CD+   LLIFDEVQTG GRTG LFA++   V PD+M++AK 
Sbjct: 190 GEGGVRSPPPAFFRALRELCDERGLLLIFDEVQTGMGRTGILFAHQRFGVTPDVMSLAKA 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT + AA M  GSHGST+GGN LA+  G  VL+I+   GF E V  IA 
Sbjct: 250 LGGGFPIGACLATADAAAGMTPGSHGSTFGGNPLAVAAGNAVLDIMLKPGFFERVQQIAL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L ++ +R+P +  EVRG+GLLIGLK V     L A  R++ LLT  + DNVVR+L
Sbjct: 310 LARQKLASVVDRYPEVLSEVRGEGLLIGLKAVVPSTDLVAALREQKLLTVGAGDNVVRLL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL ++  EI + +ERIER  + LS
Sbjct: 370 PPLIVSEAEIDDAVERIERACVALS 394


>gi|182677151|ref|YP_001831297.1| acetylornithine and succinylornithine aminotransferase
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633034|gb|ACB93808.1| acetylornithine and succinylornithine aminotransferase
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 405

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/384 (54%), Positives = 262/384 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ I FE+G+GAWL S  G  FLDF  GIAV SLG+SHP L+  L  Q +KLWH
Sbjct: 5   LLPTYARAPIAFERGEGAWLTSTTGERFLDFGGGIAVASLGYSHPHLIKALHEQGDKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL+Q  Q E  A  L   +FAD VFFTNSGAE++E  IKTAR+YH   G   K RI+T
Sbjct: 65  TSNLFQIPQAERLAERLTAVSFADFVFFTNSGAEAMEGVIKTARKYHAACGHPEKNRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+GAFHGRTLATI+A G  +YL+GF P++ GFD   F DL+++K  I  +T AILIEPIQ
Sbjct: 125 FQGAFHGRTLATIAAAGNEKYLDGFEPRLPGFDNVPFGDLEAVKAAIKPETGAILIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R V  +FLQ LRK+CD+   LL+ DEVQ+G GR+GKLFAYEWA V+PD+M IAKG
Sbjct: 185 GEGGIRVVSPDFLQALRKLCDEQGLLLLLDEVQSGVGRSGKLFAYEWAGVEPDVMAIAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA +AT E A  M  G+HGSTYGGN LA  +G  VL+I+    FL +V     
Sbjct: 245 IGGGFPLGAFMATREAAKGMVVGTHGSTYGGNPLATSIGNAVLDIVLEPSFLAHVEATGV 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L A++ R P +  E+RG GL+ G+K     A  AA  R E LL  P+ DNVVR+L
Sbjct: 305 LLQQRLVALRERHPEVIAELRGAGLMRGIKVTLPVADFAAAARAEKLLVIPAGDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL I  EE+   +ER++     L
Sbjct: 365 PPLIIGEEEVDGAIERLDAACAAL 388


>gi|154250858|ref|YP_001411682.1| acetylornithine and succinylornithine aminotransferase
           [Parvibaculum lavamentivorans DS-1]
 gi|154154808|gb|ABS62025.1| acetylornithine and succinylornithine aminotransferase
           [Parvibaculum lavamentivorans DS-1]
          Length = 446

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 261/376 (69%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++D+ FEKG+G +L +  G  +LDF +GIAVN+ GH++P L+A L  Q+ K+WH
Sbjct: 48  VLPTYARADLEFEKGEGPYLITAGGERYLDFGAGIAVNAFGHANPHLIAALTEQAGKVWH 107

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SN+Y+   QE  A  L+ +TFAD VFFTNSGAE++ECAIK AR+YH   G   ++ ++T
Sbjct: 108 TSNIYRIPGQEKLAKRLVEATFADTVFFTNSGAEALECAIKMARKYHAAGGAPERYELIT 167

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            EGAFHGRTLATI+AGG+ +YLEGFGP + GF Q  F DL++LK  I   TA ILIEPIQ
Sbjct: 168 MEGAFHGRTLATIAAGGQQKYLEGFGPPMPGFPQVPFGDLKALKAAIGPATAGILIEPIQ 227

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P E L+++R+ICD+   LL+ DEVQTG GRTGKLFA+E A + PDIM IAK 
Sbjct: 228 GEGGIRVIPSEDLRRIREICDEAGILLVLDEVQTGIGRTGKLFAHELAGITPDIMAIAKA 287

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G+HGST+GGN LAM +   V+++   + FL +V  +  
Sbjct: 288 LGGGFPVGACLATEEAARGMTAGTHGSTFGGNPLAMAVANAVMDLALDEQFLPHVRMLGL 347

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L + L  + +++P +   VRG+GL++GLK       L A  R   +LT  + DNVVR+L
Sbjct: 348 KLRQKLAMLADQYPRIVEGVRGEGLMLGLKCKVPNTDLVAALRSRKMLTVGAGDNVVRLL 407

Query: 367 PPLTITAEEIHEGLER 382
           PPL I    + E +E+
Sbjct: 408 PPLNIEESHLDEAMEK 423


>gi|304392360|ref|ZP_07374301.1| acetylornithine aminotransferase [Ahrensia sp. R2A130]
 gi|303295464|gb|EFL89823.1| acetylornithine aminotransferase [Ahrensia sp. R2A130]
          Length = 403

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/389 (49%), Positives = 271/389 (69%), Gaps = 1/389 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           N  L+ ++ +  + FE+G+G  +++  G  +LDFA+GIAVN+LGH HP+L+  L  Q++ 
Sbjct: 7   NSPLYPSFARVPLHFERGEGVRVWTNEGDEYLDFAAGIAVNALGHCHPKLIEALTEQAQT 66

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWHVSNL++S QQE  A  L  +TFADRVFFTNSG ES+ECA KTARRYHY  G   +  
Sbjct: 67  LWHVSNLFESPQQEKLARRLCENTFADRVFFTNSGTESMECAFKTARRYHYENGAPERVN 126

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+TF GAFHGR+LA I+AGG  +Y+ GFGP   GF    F D ++LK  +   TAAILIE
Sbjct: 127 IITFSGAFHGRSLAAITAGGNEKYMTGFGPATGGFVHLPFGDHEALKAAVDETTAAILIE 186

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW-ANVKPDIMT 242
           PIQGEGG+R VP + L+ LR++CD+   LLI+DEVQ G  RTGK FA++W    +PDIM 
Sbjct: 187 PIQGEGGIRTVPHQCLRGLREMCDEHGILLIYDEVQCGAARTGKFFAHQWIEGAEPDIMA 246

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
           +AKG+GGGFP+GACLA+ +V   M  G+HG+TYGGN LAM +G  VL+++  DGF+++V 
Sbjct: 247 VAKGIGGGFPMGACLASEKVGTAMGPGTHGTTYGGNPLAMAVGNAVLDVVLEDGFMQSVQ 306

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNV 362
           +   I  + L A+ + +P++   VRG GL+ G K   +   + A FR++ LL+ P+ DNV
Sbjct: 307 DKGIIFKQKLAALADSYPDLIEGVRGDGLIQGFKCRATNLDVVAAFREQNLLSVPAGDNV 366

Query: 363 VRILPPLTITAEEIHEGLERIERTAIKLS 391
           VR++PPL ++ +E+ E +++++     +S
Sbjct: 367 VRLMPPLIVSEDELSEAVDKMDAALSAMS 395


>gi|84685279|ref|ZP_01013177.1| acetylornithine aminotransferase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84666436|gb|EAQ12908.1| acetylornithine aminotransferase [Rhodobacterales bacterium
           HTCC2654]
          Length = 392

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/378 (50%), Positives = 268/378 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+G+WL  E G  +LD  +GIAVN+LGH++P+L+  L +Q+ KLWH
Sbjct: 5   VLPTYARAKLNFVKGEGSWLIEEGGDRYLDLGAGIAVNALGHANPDLIGALTAQAHKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+   Q++ A+ L+ ++FAD VFFTNSG E+ E AIK +R+YHY  G T++  I+T
Sbjct: 65  VSNLYEIPGQKVLADKLVEASFADTVFFTNSGTEAAELAIKMSRKYHYDRGDTDRVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G FHGR+   I+A G  + ++GFGP + GF    F D  +L+  ++  TAAILIEP+Q
Sbjct: 125 FSGCFHGRSTGAIAASGAEKMVKGFGPLMPGFVHLDFGDHDALRAAVTEKTAAILIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP++ L+ LR +CD+   LLIFDEVQ G GRTGK FA+EWA V PDI   AKG
Sbjct: 185 GEGGIRPVPDQCLKGLRDLCDETGTLLIFDEVQCGVGRTGKFFAHEWAGVTPDICMSAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT + A+ M  G+HGSTYGGN LAM +G K+++++  +GFL++V   A 
Sbjct: 245 IGGGFPLGAVLATEDAASGMVVGTHGSTYGGNPLAMAVGIKMVDVVTGNGFLDDVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  + +  P++F  VRG GL++GLK   +PA L A   D  ++T P++DNVVR+L
Sbjct: 305 LLRQKLEGLTDAHPDIFDSVRGVGLMLGLKCKVAPADLVAAGYDAHVITVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIE 384
           PPL IT E+I EG+ R++
Sbjct: 365 PPLNITDEDIAEGVARLD 382


>gi|217977017|ref|YP_002361164.1| acetylornithine and succinylornithine aminotransferase
           [Methylocella silvestris BL2]
 gi|217502393|gb|ACK49802.1| acetylornithine and succinylornithine aminotransferase
           [Methylocella silvestris BL2]
          Length = 400

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 200/384 (52%), Positives = 261/384 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ + F+ G+GAWL + +G  +LDF  GIAV SLG+SHP LV  L +Q  KLWH
Sbjct: 5   LLPTYARAHLAFDHGEGAWLTATDGERYLDFGGGIAVASLGYSHPHLVEALIAQGRKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL++  Q E  A  L  ++FAD VFFTNSGAE+VE AIKTAR+Y  ++G   KFRIVT
Sbjct: 65  TSNLFEIPQAERLAARLCEASFADFVFFTNSGAEAVEGAIKTARKYQSVSGHPEKFRIVT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+GAFHGRTLATI+AGG  +YL+GFGPK+EGFD  +F DL ++K  I   T A+L+EPIQ
Sbjct: 125 FKGAFHGRTLATIAAGGNPKYLDGFGPKLEGFDSVEFGDLDAVKAAIGPQTGAVLVEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE G+R    EF++ LR +CD    LL++DEVQ G GRTGKLFAYE   V PDIM IAKG
Sbjct: 185 GEAGIRVASTEFMRGLRALCDAHGLLLVYDEVQCGVGRTGKLFAYELYGVTPDIMAIAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E    M  G+HG+TYGGN LA  +G  VL+++ + GFL++V  +  
Sbjct: 245 IGGGFPLGAFLATREAGKGMTVGTHGTTYGGNPLATSIGNAVLDVVLAPGFLDHVATVGA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L +GL  +   +P     VRG+GL++GL+     A   A  R E +L  P+ DNV R+L
Sbjct: 305 RLKQGLLTLIEAYPRSVANVRGEGLMLGLELRAPVADFVAAARAEKILVIPAGDNVARLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL I+  E  EG++R+     +L
Sbjct: 365 PPLIISEAEAAEGVKRLGAACARL 388


>gi|83309911|ref|YP_420175.1| ornithine/acetylornithine aminotransferase [Magnetospirillum
           magneticum AMB-1]
 gi|82944752|dbj|BAE49616.1| Ornithine/acetylornithine aminotransferase [Magnetospirillum
           magneticum AMB-1]
          Length = 388

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 263/380 (69%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           D L   +D++D+ FE+G+GAWL + +G  FLDF +G+AVN+LGH+HP LVA L++Q+ KL
Sbjct: 4   DNLLPVFDRTDVIFEQGEGAWLTASDGRRFLDFGAGVAVNALGHAHPRLVAALEAQAGKL 63

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WH SNLY+   QE  A  LI ++FAD  FF N+GAE++E  IK ARRYH+ AG+  + RI
Sbjct: 64  WHCSNLYRVPGQERVAERLIKASFADTAFFCNTGAEAMELVIKIARRYHHCAGRPERNRI 123

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           V   G+FHGRT+AT++A G  +YLEGFGP  +GFD   + DL++ +  I ++TAA+L+EP
Sbjct: 124 VACTGSFHGRTIATLAAAGTPKYLEGFGPVAQGFDHVPYGDLEAARGAIGSNTAALLVEP 183

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           +QGEGG+R     +L+ LR + D    LL+ DEVQTG GRTGKLFA+EW+ + PD+M +A
Sbjct: 184 VQGEGGIRPADPAYLRGLRALADQFGLLLLMDEVQTGIGRTGKLFAHEWSGIAPDVMGLA 243

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           KG+GGGFP+GA LAT + A+CM  G+HG T+GGN LAM + E VL+ + + GFLE V  +
Sbjct: 244 KGLGGGFPVGAVLATEKAASCMTPGTHGCTFGGNPLAMAVAEAVLDEVMAPGFLERVQAV 303

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
           A +L   L  +  R+P    +VRGQGL++GLKTV       AK     LL   + DNVVR
Sbjct: 304 AALLRGRLDDLARRYPGAIAQVRGQGLMLGLKTVPVNTEFNAKLFAAGLLAVGAGDNVVR 363

Query: 365 ILPPLTITAEEIHEGLERIE 384
           ++PPL I   E+   +E I+
Sbjct: 364 LVPPLIIGEAEVERAVEIID 383


>gi|46200924|ref|ZP_00207904.1| COG4992: Ornithine/acetylornithine aminotransferase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 386

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/381 (50%), Positives = 267/381 (70%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
            +  TY +SD+ FE+G+GA+LF+ +G  FLDFASG+AVN+LGH HP LV  L  Q+ K+W
Sbjct: 1   MVMPTYARSDLAFERGEGAYLFTMDGRRFLDFASGVAVNALGHCHPRLVKALAGQAAKVW 60

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY+   QE  A  L+  +FAD VFF NSGAE++EC IK ARRYH+ AG   + RI+
Sbjct: 61  HTSNLYRVPGQESVAAKLVGQSFADTVFFCNSGAEALECCIKMARRYHFAAGNPQRTRII 120

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
             EGAFHGRTLAT++AGG+ ++LEGF P ++GFD   F +L +L+  I+ ++AAIL+EP+
Sbjct: 121 CAEGAFHGRTLATVAAGGQKKHLEGFAPAVDGFDHVPFGNLNALRAAITEESAAILVEPV 180

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+     ++L++LR   D+   LLIFDEVQTG GRTG LFA+E A + PDIM +AK
Sbjct: 181 QGEGGIVPGDPDYLRRLRATADEFGLLLIFDEVQTGMGRTGTLFAHEQAGIAPDIMGLAK 240

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GACLAT + A+ M  G+HGST+GGN LAM + ++V+ I+   GFL++V  +A
Sbjct: 241 GLGGGFPVGACLATAKAASGMVPGTHGSTFGGNPLAMAVADEVMTIMAEPGFLDHVRAVA 300

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
           + L  G+    +RFP++  EVRG GL++G K       + A+     LL+  + DN+VR+
Sbjct: 301 QKLRTGVEEAASRFPDVIEEVRGLGLMLGFKPRMPNTDMVARLAANGLLSVGAGDNMVRL 360

Query: 366 LPPLTITAEEIHEGLERIERT 386
           LPPL I   ++ E +  + RT
Sbjct: 361 LPPLIINDAQVDEAVGILART 381


>gi|83309415|ref|YP_419679.1| ornithine/acetylornithine aminotransferase [Magnetospirillum
           magneticum AMB-1]
 gi|82944256|dbj|BAE49120.1| Ornithine/acetylornithine aminotransferase [Magnetospirillum
           magneticum AMB-1]
          Length = 389

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/380 (49%), Positives = 268/380 (70%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++D+ FE+G+GA+LF+ +G  +LDFA+G+AVN+LGH HP LV  L +Q+ K+WH
Sbjct: 5   VMPTYARADLAFERGEGAYLFTADGRRYLDFAAGVAVNALGHCHPRLVKALTAQAAKVWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+   QE  A  L+  +FAD VFF NSGAE++EC+IK ARR+H+ AG   ++RI+ 
Sbjct: 65  TSNLYRVAGQESVAAKLVERSFADTVFFCNSGAEALECSIKMARRHHFAAGNPQRYRIIC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            EGAFHGRTLAT++AGG+ ++LEGF P ++GFD   + +L +L+  I+ +TAAIL+EP+Q
Sbjct: 125 AEGAFHGRTLATVAAGGQKKHLEGFAPAVDGFDHVPYGNLNALRASITEETAAILVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+     ++L++LR   D+   LLIFDEVQTG GRTG LFA+E A + PDIM +AKG
Sbjct: 185 GEGGIVPGDPDYLRRLRATADEFGLLLIFDEVQTGMGRTGTLFAHEQAGIAPDIMGVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A+ M  G+HGST+GGN LAM +  +VL+I+   GFLE+V  +A 
Sbjct: 245 LGGGFPVGACLATTKAASGMVPGTHGSTFGGNPLAMAVAGEVLDIMAEPGFLEHVQAMAA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L   +     RFP +  EVRG GL++G+K       + A+  +  LLT  + DN+VR+L
Sbjct: 305 LLRSKVEDTAARFPGVVEEVRGLGLMLGIKPRMPNTEMVARLAEGGLLTVGAGDNIVRLL 364

Query: 367 PPLTITAEEIHEGLERIERT 386
           PPL I   ++ E +  + R 
Sbjct: 365 PPLIINDAQVDEAVGILARA 384


>gi|23015325|ref|ZP_00055104.1| COG4992: Ornithine/acetylornithine aminotransferase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 390

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/387 (50%), Positives = 262/387 (67%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           D L   +D++D+ FE G+GAWL + +G  FLDF +G+AVN+LGH+HP LVA L  Q+ KL
Sbjct: 4   DNLLAVFDRTDVIFEHGEGAWLTAADGRRFLDFGAGVAVNALGHAHPRLVAALGEQAGKL 63

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WH SNLY+   QE  A  L+ ++FAD  FF N+GAE++E  IK ARRYH+ AG   + RI
Sbjct: 64  WHCSNLYRVPGQERVAQRLVDASFADTAFFCNTGAEAMELVIKIARRYHHCAGHPERNRI 123

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           +   G+FHGRT+AT++A G  +YLEGFGP  +GFD   + DL++++  I ++TAAIL+EP
Sbjct: 124 IACTGSFHGRTIATLAAAGTAKYLEGFGPVAQGFDHVPYGDLEAVQGAIGSNTAAILVEP 183

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           +QGEGG+R     +L+ LR + D+   LL+ DEVQTG GRTGKLFA+EW+ + PD+M +A
Sbjct: 184 VQGEGGIRPGDPAYLRGLRALADEFGLLLLMDEVQTGIGRTGKLFAHEWSGIAPDVMGLA 243

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           KG+GGGFP+GA LAT + AACM  G+HG T+GGN LAM + E VL+ I + GFL+ V  +
Sbjct: 244 KGLGGGFPVGAVLATEKAAACMTPGTHGCTFGGNPLAMAVAEAVLDEIMAPGFLDRVQAV 303

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
           A +L   L  +  R+P    EVRGQGL++GLKTV       AK     LL   + DNVVR
Sbjct: 304 AAMLRGKLDDLARRYPQAIAEVRGQGLMLGLKTVPLNTEFNAKLFAAGLLAVGAGDNVVR 363

Query: 365 ILPPLTITAEEIHEGLERIERTAIKLS 391
           ++PPL I   E+   +E IE      S
Sbjct: 364 LVPPLIIGEAEVVRAVEIIEGVCASFS 390


>gi|329888390|ref|ZP_08266988.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Brevundimonas diminuta ATCC 11568]
 gi|328846946|gb|EGF96508.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Brevundimonas diminuta ATCC 11568]
          Length = 399

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 265/372 (71%), Gaps = 3/372 (0%)

Query: 15  DIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQST 74
           D+ FE GKGAWL+ ++G  +LDFASGIAVN+LGH HP LV  LK Q+ K+WH SN  +  
Sbjct: 13  DLAFEYGKGAWLYDQDGKAYLDFASGIAVNALGHCHPHLVRALKKQAGKIWHTSNTVRIP 72

Query: 75  QQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGR 134
           + E  A  L+ STFA+ V+F NSG E+ E A+K ARR H +AG+  ++RIVTFEGAFHGR
Sbjct: 73  EGERLAQRLVDSTFAEVVYFANSGGEANEAAVKMARRRHAVAGRPERYRIVTFEGAFHGR 132

Query: 135 TLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKV 194
           TLA I+A G   Y+EGFGPK+EGFDQ +  D  +L+  +++ TAA++IEPIQGEGG+R V
Sbjct: 133 TLAMIAATGHPPYIEGFGPKVEGFDQVRLDDWDALEAVVTDQTAALMIEPIQGEGGLRVV 192

Query: 195 PEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIG 254
             E L++LR++CD+   LLI DEVQ+G GRTG+ FA+EW+ + PDI+T+AKG+GGGFP+G
Sbjct: 193 KTETLERLRRMCDERGMLLILDEVQSGVGRTGRFFAHEWSGIVPDIVTVAKGIGGGFPMG 252

Query: 255 ACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTA 314
           ACLAT   A  M  G+HG+T+GGN LAM +G  +L+I+Q D FL  V+N A +L   L  
Sbjct: 253 ACLATRHAAEGMTLGTHGTTFGGNPLAMAVGNAMLDIVQDDAFLARVLNKAVLLRRQLKR 312

Query: 315 IKNRFPNMFLEVRGQGLLIGL--KTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTIT 372
           ++  +  +  E+RG+GLL G   + V +   +AA  R++ L+   + DNVVR  PPLT+T
Sbjct: 313 VQRAYGRLVGELRGEGLLQGFCARGVEARDFVAA-LREQGLIALAARDNVVRFAPPLTVT 371

Query: 373 AEEIHEGLERIE 384
           A+EI +   R+E
Sbjct: 372 AKEIADAGARLE 383


>gi|149913425|ref|ZP_01901958.1| aspartate carbamoyltransferase catalytic subunit [Roseobacter sp.
           AzwK-3b]
 gi|149812545|gb|EDM72374.1| aspartate carbamoyltransferase catalytic subunit [Roseobacter sp.
           AzwK-3b]
          Length = 394

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 264/384 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+G+WL   +G  FLD  +GIAVN+LGH+HP L+A L  Q+ KLWH
Sbjct: 5   VLPTYNRAPLTFVKGEGSWLVEADGRRFLDMGAGIAVNALGHAHPALIAALTEQAGKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY   QQ+  A+ L+ +TFAD VFFTNSG ES E A+K AR+Y Y  G+ ++  IV 
Sbjct: 65  TSNLYNIPQQQALADKLVDATFADTVFFTNSGTESCELAVKMARKYFYEKGQPDRIGIVA 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGR+ A I+A G  + ++GFGP + GF Q  + D   L   I++ TAAILIEP+Q
Sbjct: 125 FEGAFHGRSHAAIAAAGSEKMVKGFGPLLPGFTQVAWGDHGGLHAAITDTTAAILIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP++ L+ LR +CD+   LLIFDEVQ G GRTGKLFA+EWA V+PDIM +AKG
Sbjct: 185 GEGGIRPVPDQCLKGLRDLCDEKGILLIFDEVQCGMGRTGKLFAHEWAGVEPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT + A+ M  G+HGSTYGGN LA  +G KV++I+    FL  V   A 
Sbjct: 245 IGGGFPLGAVLATQDAASGMTAGTHGSTYGGNPLACAVGAKVMDIVAEPDFLSAVNAKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L  GL  +    P++F  VRG GL+IGLK   +   +     D  ++T P++DNVVR+L
Sbjct: 305 KLRHGLDGLVASHPDVFEGVRGLGLMIGLKCKVANMDVVTAGYDAGVITVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL ++ EEI E L R++ +A+ +
Sbjct: 365 PPLNLSDEEIAEALSRLQASAVAI 388


>gi|114764000|ref|ZP_01443241.1| acetylornithine aminotransferase [Pelagibaca bermudensis HTCC2601]
 gi|114543592|gb|EAU46606.1| acetylornithine aminotransferase [Roseovarius sp. HTCC2601]
          Length = 398

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/385 (49%), Positives = 264/385 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+G WL  E+G  FLD  SGIAVN+LGH+HP LVA L +Q++ LWH
Sbjct: 7   VLPTYSRAPLHFVKGEGTWLVEEDGRRFLDLGSGIAVNALGHAHPALVAALTAQAQNLWH 66

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  QQ+  A+ L+  +FAD VFFTNSG ES E A+K AR+Y Y  G+  K  I+ 
Sbjct: 67  VSNLYEIPQQQALADKLVAESFADTVFFTNSGTESCELAVKMARKYWYDKGQPEKTDIIA 126

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  +  +GFGP + GF    + D ++L   I ++TAAILIEP+Q
Sbjct: 127 FAGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFKHLPWGDHEALDAAIDDNTAAILIEPVQ 186

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P++ +Q LRK+CD+   LL+ DEVQ G GRTG+LFA+EWA + PDIM +AKG
Sbjct: 187 GEGGIRPLPDQCMQGLRKLCDEKGVLLVLDEVQCGIGRTGRLFAHEWAGIAPDIMMVAKG 246

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E A+ M  G+HGSTYGGN L   +G  V++ +    FL+ V   A 
Sbjct: 247 IGGGFPLGAVLATEEAASGMTAGTHGSTYGGNPLGCAVGCAVMDHVTDPAFLDGVNRKAG 306

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +    P++F EVRG GL++GLK   +PA L     +  ++T P++DNVVR+L
Sbjct: 307 LLRQKLEGLVAAHPDIFEEVRGMGLMLGLKCKIAPADLVKAGYEALVITVPAADNVVRLL 366

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPLTIT +EI E + R++  A  L+
Sbjct: 367 PPLTITEDEIGEAIARLDTAASALA 391


>gi|126739949|ref|ZP_01755639.1| acetylornithine aminotransferase [Roseobacter sp. SK209-2-6]
 gi|126718768|gb|EBA15480.1| acetylornithine aminotransferase [Roseobacter sp. SK209-2-6]
          Length = 396

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/381 (50%), Positives = 266/381 (69%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+G+WL   +G  FLD  SGIAVN+LGH+HP+LV +L +Q++ LWH
Sbjct: 8   VLPTYNRAPLEFVKGEGSWLIEADGRRFLDLGSGIAVNALGHAHPKLVEVLSTQAQNLWH 67

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  QQE  A+ L+  TFAD VFFTNSG E+ E A+K AR++ Y   +  +  I+T
Sbjct: 68  VSNLYKIPQQEKLADLLVEHTFADTVFFTNSGTEACELAVKMARKFFYEKDQPERVEIIT 127

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+G+FHGR+ A I+A G  +  +GFGP + GF    F DL  + N I++ TAAILIEP+Q
Sbjct: 128 FDGSFHGRSSAGIAAAGSEKMTQGFGPLLPGFVHLTFGDLDGVTNAITDQTAAILIEPVQ 187

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+ LR+ICD+   LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 188 GEGGIRPVPDAELKALRQICDEAGILLILDEVQCGVGRTGKLFAHEWAGIAPDIMMVAKG 247

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E A+ M  G+HGSTYGGN L   +G  V+  + +DGFLE V   A 
Sbjct: 248 IGGGFPLGAVLATEEAASGMTAGTHGSTYGGNPLGCAVGCAVVEEVTADGFLEEVNRKAG 307

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  I   +P++F EVRG GL++GLK   S   +  +  ++ L+T P++DNV+R+L
Sbjct: 308 LLRQKLEGIVADYPDVFEEVRGSGLMLGLKCKVSNIDVVNEGYEKELITVPAADNVIRLL 367

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPL ++ E++ E   RIE TA
Sbjct: 368 PPLNLSDEDVAEAALRIEATA 388


>gi|288957259|ref|YP_003447600.1| acetylornithine aminotransferase [Azospirillum sp. B510]
 gi|288909567|dbj|BAI71056.1| acetylornithine aminotransferase [Azospirillum sp. B510]
          Length = 390

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/381 (51%), Positives = 258/381 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++D+ FE+G+G +L++ +G  FLDFA+G+AVN+LGH+HP LV  L  Q+ KLWH
Sbjct: 5   VMPTYARADVVFERGEGPYLYATDGRRFLDFAAGVAVNALGHAHPYLVEKLTEQAGKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL++   QE     L   TFAD VFFTNSGAE+ EC  KT R+YHY +G   K RI+T
Sbjct: 65  TSNLFRVAGQESLGKRLTEVTFADTVFFTNSGAEAWECGAKTVRKYHYDSGNPQKNRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FE AFHGRTL  ISA  + + + GF P ++GFDQ  F DL +++  I+  T  I +EPIQ
Sbjct: 125 FEQAFHGRTLGAISAAKQEKLVHGFDPLLDGFDQVPFGDLDAVRAAITPATGGICVEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R    EFL+ LR +CD+   LL  DE+Q G GRTGKLFA+EWA + PD+M +AKG
Sbjct: 185 GEGGIRAGSVEFLRGLRALCDEHGLLLFLDEIQCGMGRTGKLFAHEWAGITPDVMCVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT   AA M  G+HGSTYGGN LA  +G  VL+++ + GFL+ V   A 
Sbjct: 245 IGGGFPLGACLATERAAAGMTAGTHGSTYGGNPLATAVGNAVLDVMLAPGFLDEVRKTAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
                L  +  + P MFL++RGQGL++GLK       + AK R   LL  P+ DNVVR+L
Sbjct: 305 YARARLEELIAKHPAMFLDLRGQGLMLGLKLGQPVGEVVAKLRANGLLAVPAGDNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPLTI   E++E +  ++RTA
Sbjct: 365 PPLTIGEAEVNEAVGILDRTA 385


>gi|295690264|ref|YP_003593957.1| acetylornithine and succinylornithine aminotransferase [Caulobacter
           segnis ATCC 21756]
 gi|295432167|gb|ADG11339.1| acetylornithine and succinylornithine aminotransferase [Caulobacter
           segnis ATCC 21756]
          Length = 405

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/382 (50%), Positives = 267/382 (69%), Gaps = 2/382 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y+++ + FE+G+GA LFS +G  +LD  +GIA N LGH+HP LV +LK Q+EKLWH
Sbjct: 14  IMGVYNRAPLAFERGRGARLFSTDGGEYLDCVAGIATNGLGHAHPVLVDVLKEQAEKLWH 73

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN+Y+  +QE  A+ +  STFAD VFFTNSG E+VECA+KTAR+YH   G+  +  I  
Sbjct: 74  VSNIYRIPEQEALADAICASTFADVVFFTNSGTEAVECALKTARKYHSANGQPERIDIYG 133

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SNDTAAILIEPI 185
           F+G+FHGRT A ++A G   Y++GFGP++ G+ Q  F D +++K  I S  TAAI++EP+
Sbjct: 134 FDGSFHGRTYAAVNASGNPSYVDGFGPRLPGYSQLTFGDHEAIKAAIASPTTAAIIVEPV 193

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA-NVKPDIMTIA 244
           QGEGG R +P + L+ LR++CD+   LLI+DEVQ G GRTGKLFAYEWA   +P IM +A
Sbjct: 194 QGEGGARSIPTQCLKGLRQLCDEHGVLLIYDEVQCGMGRTGKLFAYEWAEGGEPHIMAVA 253

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K +GGGFP+GACLAT E A  M   +HGST+GGN LAM +G+   ++I S   L+NV  +
Sbjct: 254 KALGGGFPVGACLATTEAAKGMTVAAHGSTFGGNPLAMAVGKAAFDLINSPETLDNVNAV 313

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
           A  L + L  +K+RFP++ +++RG+GLLIG+K + +        RDE LL A   DN VR
Sbjct: 314 AGFLTQQLNGLKDRFPDVIVDIRGKGLLIGIKLIPNNREFMVLARDEHLLVAGGGDNCVR 373

Query: 365 ILPPLTITAEEIHEGLERIERT 386
           +LPPL +T EE  E + ++E+ 
Sbjct: 374 LLPPLNLTIEEAREAIAKLEKA 395


>gi|86747909|ref|YP_484405.1| acetylornithine transaminase protein [Rhodopseudomonas palustris
           HaA2]
 gi|86570937|gb|ABD05494.1| acetylornithine aminotransferase [Rhodopseudomonas palustris HaA2]
          Length = 407

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 261/385 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ FE+G+GAWL S  G  +LDF SG+AVNSLGH HP LV  L+ Q+ KLWH
Sbjct: 14  LLPVFARADVAFERGEGAWLISTTGERYLDFTSGVAVNSLGHCHPHLVEALQQQATKLWH 73

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL++S   E  A  L   +FAD VFF NSGAE++ECA+K  R +H+  G   + RI+T
Sbjct: 74  MSNLFKSPDGERLAARLCEQSFADFVFFANSGAEAMECALKMTRHHHFSKGNPERTRIIT 133

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGRTL T++A G  +YLEG+G  ++GFDQ    DL ++K  I   TA ILIEP+Q
Sbjct: 134 FAGAFHGRTLGTLAATGSAKYLEGYGEPLDGFDQVPLGDLDAVKKAIGPTTAGILIEPLQ 193

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR     F + LR +CD    LLIFDEVQTG GRTG+LFAY+   V PDIM++AK 
Sbjct: 194 GEGGVRSPEPAFFRALRDLCDSNGLLLIFDEVQTGMGRTGELFAYQRIGVAPDIMSLAKA 253

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT + A  M  GSHGST+GGN LA+     VL+++   GFL++V  ++ 
Sbjct: 254 LGGGFPIGACLATADAAEGMAPGSHGSTFGGNPLAVAAANAVLDVMLEPGFLDHVRRMSL 313

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  I +R+P +  E+RG+GLLIGLK V     L A  RD+ LLT  + DNVVR+L
Sbjct: 314 LLKQKLAGIVDRYPQVLSEIRGEGLLIGLKAVVPSTDLVAALRDQNLLTVGAGDNVVRLL 373

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL +   EI E + R+ER    LS
Sbjct: 374 PPLIVDEVEIDEAVTRLERACGVLS 398


>gi|91975375|ref|YP_568034.1| acetylornithine transaminase protein [Rhodopseudomonas palustris
           BisB5]
 gi|91681831|gb|ABE38133.1| acetylornithine aminotransferase [Rhodopseudomonas palustris BisB5]
          Length = 403

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/385 (51%), Positives = 259/385 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ FE+G+G WL +  G  +LDF SG+AVNSLGH HP LV  L+ QS KLWH
Sbjct: 10  LLPVFARADVAFERGEGVWLIATAGERYLDFTSGVAVNSLGHCHPHLVEALQQQSAKLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL++S   E  A  L   +FAD VFF NSGAE++ECA+K  R Y +  G   + RI+T
Sbjct: 70  TSNLFKSPDGERLAARLCEQSFADYVFFANSGAEAIECALKMTRHYQFSKGSPERTRIIT 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLA ++A G  +YLEG+G  ++GFDQ    D++++K  I  +TA ILIEP+Q
Sbjct: 130 FEGAFHGRTLAALAATGSAKYLEGYGDPLDGFDQLPLGDIEAVKKAIGPNTAGILIEPLQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR     F + LR++CD    LL+FDEVQTG GRTG+LFAY+   V PDIM +AK 
Sbjct: 190 GEGGVRAPEPAFFRALRELCDANGLLLVFDEVQTGMGRTGELFAYQRLGVAPDIMALAKA 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A  M  GSHGST+GGN LA+     VL+++   GF ++   ++ 
Sbjct: 250 LGGGFPIGACLATAEAAKGMAPGSHGSTFGGNPLAVAAANAVLDVMLKPGFFDHAKRMSL 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           IL + L  I +R+P +  EVRG+GLLIGLK V     L A  RD+ LLT  + DNVVR+L
Sbjct: 310 ILKQKLAGIVDRYPQVLSEVRGEGLLIGLKAVVPSGDLVAALRDQKLLTVGAGDNVVRLL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL +   EI E + R+ER    LS
Sbjct: 370 PPLIVDEAEIEEAVTRLERACGVLS 394


>gi|91976774|ref|YP_569433.1| acetylornithine and succinylornithine aminotransferases
           [Rhodopseudomonas palustris BisB5]
 gi|91683230|gb|ABE39532.1| acetylornithine aminotransferase [Rhodopseudomonas palustris BisB5]
          Length = 394

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/381 (51%), Positives = 262/381 (68%), Gaps = 1/381 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y  + + F+ G+GAWL + NG  +LDF +GIAVN+LG+SHP L+  L+ Q  KLWH
Sbjct: 5   LLPVYQPASMLFDHGEGAWLTTVNGDRYLDFGAGIAVNALGYSHPHLIEALERQGRKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN+Y+  + E  A  L  S FAD  FF NSGAE+ ECAIK ARR+H   G  +++RI+T
Sbjct: 65  LSNVYRIAETERLAERLTASCFADIAFFANSGAEANECAIKIARRHHDAHGLPDRWRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLAT++AGG  +YL+GFGP ++ FDQ    D+++++ +I   TAAI+IEPIQ
Sbjct: 125 FEGAFHGRTLATMAAGGNRKYLDGFGPTVDAFDQCPLEDIEAVRARIGPHTAAIMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R V   FL+QLR +CD    LLIFDE+Q G GRTG LFA++ + V PDIM++AKG
Sbjct: 185 GEGGLRPVSHSFLRQLRALCDAHGLLLIFDEIQCGMGRTGYLFAHQESGVVPDIMSLAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT   A  M  GSHGST+GGN LA  +   VL+++  D  L  +     
Sbjct: 245 LGGGFPIGACLATRNAAFGMTPGSHGSTFGGNPLAGAVANAVLDVVMDDALLGEIRRKGA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF-SPALLAAKFRDECLLTAPSSDNVVRI 365
           +LF  L A+  R+P+  +E+RG+GL++G+KT   SP ++ A      +LT  + DNV R+
Sbjct: 305 LLFGLLQALAGRYPDSIVELRGRGLMLGIKTTLPSPQVVEALRAQAKVLTIAAGDNVTRV 364

Query: 366 LPPLTITAEEIHEGLERIERT 386
           LPPL +T EEIH   ER + T
Sbjct: 365 LPPLIVTDEEIHLFAERCDET 385


>gi|254465201|ref|ZP_05078612.1| acetylornithine aminotransferase [Rhodobacterales bacterium Y4I]
 gi|206686109|gb|EDZ46591.1| acetylornithine aminotransferase [Rhodobacterales bacterium Y4I]
          Length = 394

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/386 (50%), Positives = 271/386 (70%), Gaps = 2/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+GAWL + +G  FLD  SGIAVN+LGH+HP LV  L +Q++ LWH
Sbjct: 8   VLPTYNRAPLEFVKGEGAWLTTADGRRFLDLGSGIAVNALGHAHPALVEALTAQAQNLWH 67

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLYQ  QQ+  A+ L+  TFAD VFFTNSG E+ E A+K AR+Y +  G+  +  I+T
Sbjct: 68  VSNLYQIPQQQALADKLVEHTFADTVFFTNSGTEACELAVKMARKYFHDKGQPERVEIIT 127

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+G+FHGR+ A I+A G  + ++GFGP + GF    F DL  + + IS  TAAI+IEP+Q
Sbjct: 128 FDGSFHGRSSAGIAAAGSEKMVKGFGPLLPGFVHLTFGDLDGVTDAISERTAAIMIEPVQ 187

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+ LR+ICD+   LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 188 GEGGIRPVPDAELKALRRICDEHGLLLILDEVQCGVGRTGKLFAHEWAGITPDIMMVAKG 247

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT + A+ M  G+HGSTYGGN L   +G  V++ I  D FL  V   A 
Sbjct: 248 IGGGFPLGAVLATEDAASGMTAGTHGSTYGGNPLGCAVGCAVMDHIADDAFLAEVNRKAG 307

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA-LLAAKFRDECLLTAPSSDNVVRI 365
           +L + L  +    P +F EVRG GL++GLK   + A ++ A + +E L+T P++DNV+R+
Sbjct: 308 LLRQKLEGLVADHPEVFEEVRGAGLMLGLKCKAANADVVQAGYGNE-LITVPAADNVIRL 366

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPLT+T E+I E + R+++TA +++
Sbjct: 367 LPPLTLTDEDIAEAVRRLDKTAAQVA 392


>gi|239787684|emb|CAX84192.1| Acetylornithine aminotransferase [uncultured bacterium]
          Length = 393

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/378 (50%), Positives = 255/378 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++D+ FE+G G WL + +G  FLDF SG+AV +LGH+HP L+A L +Q+ KLWH
Sbjct: 5   VMPTYARADLAFERGDGCWLLATDGRRFLDFGSGVAVTALGHAHPRLIAALTAQAGKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+   QE  A  LI ++FAD  FF NSGAE++ECA+K  R+YH   G   ++R + 
Sbjct: 65  CSNLYRVPGQERVAERLIANSFADTAFFCNSGAEAMECALKMVRKYHDAVGTPERYRCIV 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            EGAFHGRTLATI+AGG+ ++L+GF P ++GFD   F ++ +L+N I   TAAI++EP+Q
Sbjct: 125 AEGAFHGRTLATIAAGGQEKHLKGFDPVVDGFDHVPFGNMNALRNAIGPQTAAIVVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR    ++L++LR   D+   LL+FDEVQTG GRTG LFAYE A V PDIM +AKG
Sbjct: 185 GEGGVRPAEADYLRKLRLAADEFGLLLVFDEVQTGMGRTGSLFAYEQAGVAPDIMALAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT + A  M  G+HGST+GGN LAM + E VL ++   GFL  V +  +
Sbjct: 245 LGGGFPIGACLATEKAAQGMTAGTHGSTFGGNPLAMAVAETVLGVMLEPGFLAGVADKGR 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L  GL  +  + P      RG+GLL GL  +   + +      + LLT  + DNVVR+L
Sbjct: 305 FLAAGLAELVKKHPASLASARGRGLLQGLVCIRPNSDVVEACYGQGLLTVMAGDNVVRVL 364

Query: 367 PPLTITAEEIHEGLERIE 384
           PPL +T  EI EG  R++
Sbjct: 365 PPLIVTESEIEEGCARLD 382


>gi|83859666|ref|ZP_00953186.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852025|gb|EAP89879.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Oceanicaulis alexandrii HTCC2633]
          Length = 394

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/383 (49%), Positives = 268/383 (69%), Gaps = 3/383 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L +TY   ++ FE+G+G +L  ++G  +LDF SGIAVN+LGH+HP+ VA LK Q++KLWH
Sbjct: 5   LMDTYSPPNLDFERGEGVYLIEKSGEKYLDFISGIAVNALGHAHPKAVAALKEQADKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SN+++   Q   A      +FADRVFFTNSG E+VECA+K+AR YH+  G+ +K+RI+T
Sbjct: 65  TSNMFRVPGQIELAEKYCRDSFADRVFFTNSGTEAVECALKSARHYHFANGRPDKYRIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGR+   I+AGG  +YLEGFGP +EGFDQ +F D  +LK  I+ +TAAIL+EP+Q
Sbjct: 125 FTGAFHGRSYGGINAGGNPKYLEGFGPAMEGFDQVEFGDHDALKAAITEETAAILVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA-NVKPDIMTIAK 245
           GEGGVR +P+  L+ LR++CD+   LLI+DEVQ G GRTGK++A+EWA + +PDIM +AK
Sbjct: 185 GEGGVRAIPDVCLRGLRELCDEHGLLLIYDEVQCGAGRTGKVWAHEWAGSAQPDIMAVAK 244

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GACL T+   A M  G+HGST+GGN LAM +G  V + +   GF++ V++I+
Sbjct: 245 GVGGGFPMGACLTTDAAGAHMVVGTHGSTFGGNPLAMAVGNVVYDELTRPGFMDEVVDIS 304

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV--FSPALLAAKFRDECLLTAPSSDNVV 363
             L + L+ + +   +   E+RG+GLLIGLK    +    L  K RD  LL   + DNV 
Sbjct: 305 NKLRQALSGLADEHSDKVEELRGRGLLIGLKLKDGYGNRTLVGKARDHHLLMGAAGDNVA 364

Query: 364 RILPPLTITAEEIHEGLERIERT 386
           R+ PPL I  + + E +  +++ 
Sbjct: 365 RMAPPLIINEDHVREAVSALDKA 387


>gi|260431031|ref|ZP_05785002.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414859|gb|EEX08118.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 395

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/381 (51%), Positives = 261/381 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+GAWL   +G  FLD  +GIAVN+LGH+HP LV  L  Q+  LWH
Sbjct: 5   VLPTYNRAPLTFVKGEGAWLTEADGRRFLDLGAGIAVNALGHAHPALVNALTEQAHALWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLYQ  QQ+  A+ L+  TFAD VFFTNSG ES E A+K AR++ Y  G+ +K  I+T
Sbjct: 65  VSNLYQIPQQQALADKLVDMTFADTVFFTNSGTESCELAVKMARKHFYDRGQPDKVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEG+FHGR+ A I+A G  +  +GFGP + GF    F DL  + N IS+ TAAI+IEPIQ
Sbjct: 125 FEGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFVHVAFGDLDGVTNAISDKTAAIMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+ LR+ICDD   LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 185 GEGGIRPVPDVELKALRQICDDNGLLLILDEVQCGVGRTGKLFAHEWAGITPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A+ M  G+HGSTYGGN L   +G  VL+ + +  FL+ V   A 
Sbjct: 245 IGGGFPLGAVLATEAAASGMTAGTHGSTYGGNPLGCAVGCAVLDHVATPAFLDGVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +    P++F EVRG GL++GLK       + A   D  ++T P++DNV+R+L
Sbjct: 305 LLRQKLEGLVADHPDVFEEVRGSGLMLGLKCKAPNTDVVAAGYDNEVITVPAADNVIRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPLT+T ++I + L R+E+ A
Sbjct: 365 PPLTLTEDDIAQALIRLEKAA 385


>gi|86136552|ref|ZP_01055131.1| acetylornithine aminotransferase [Roseobacter sp. MED193]
 gi|85827426|gb|EAQ47622.1| acetylornithine aminotransferase [Roseobacter sp. MED193]
          Length = 393

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 267/386 (69%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+G+WLF  +G  FLD  SGIAVN+LGH+HP+LV +L +Q++ LWH
Sbjct: 5   VLPTYNRAPLEFVKGEGSWLFEADGRRFLDLGSGIAVNALGHAHPKLVEVLSTQAQNLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  QQE  A+ L+  TFAD VFFTNSG E+ E A+K AR+Y Y   +  +  I+T
Sbjct: 65  VSNLYKIPQQEKLADLLVEHTFADTVFFTNSGTEACELAVKMARKYFYEKDQPERVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+G+FHGR+ A I+A G  + ++GFGP + GF    F D+  L N I+ +TAA+LIEP+Q
Sbjct: 125 FDGSFHGRSSAGIAAAGTEKMVKGFGPLLPGFVHLTFGDMDGLTNAITANTAAVLIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+ LR+ICD+   LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 185 GEGGIRPVPDAELKALRQICDEAGILLILDEVQCGVGRTGKLFAHEWAGITPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E A+ M  G+HGSTYGGN L   +G  V+  + + GFL  V   A 
Sbjct: 245 IGGGFPLGAVLATEEAASGMTAGTHGSTYGGNPLGCAVGCAVIEEVMAPGFLAGVNRRAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +  + P++F E+RG GL++GLK       +     D  ++T P++DNV+R+L
Sbjct: 305 LLRQRLDGLVAQHPDVFEELRGSGLMLGLKCKALNMDVVQSGYDNEVITVPAADNVIRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKLSH 392
           PPLT++ E+I E + R+++ A ++  
Sbjct: 365 PPLTLSEEDIAEAIARLDKAATQIEQ 390


>gi|197106400|ref|YP_002131777.1| putative acetylornithine aminotransferase protein [Phenylobacterium
           zucineum HLK1]
 gi|196479820|gb|ACG79348.1| putative acetylornithine aminotransferase protein [Phenylobacterium
           zucineum HLK1]
          Length = 414

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/385 (49%), Positives = 263/385 (68%), Gaps = 2/385 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y ++ + FE+G+GA L++  G  +LD  +GIAVN+LGHSHP L+  LK Q++K
Sbjct: 15  SDHIMGVYARAPLAFERGEGARLYTAEGEAYLDCMAGIAVNALGHSHPRLIQALKDQADK 74

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN+++   QE  A+ L  +TFAD  FFTNSGAE++ECAIKTAR+YH+  G+  +  
Sbjct: 75  LWHTSNIFRIPNQEKLADLLTRNTFADVAFFTNSGAEAIECAIKTARKYHWAKGQPERID 134

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+G+FHGRT+A I A     Y+EGFGP   GF  AKF DL+ LK  +   TAAIL+E
Sbjct: 135 IIGFDGSFHGRTIAAIFAANNPSYVEGFGPPPPGFVGAKFGDLEGLKALVGPTTAAILLE 194

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN--VKPDIM 241
           P+QGEGG R   E  L+++R++CD+   LLI+DE+Q G GR+GKLFA+EWA+    PDIM
Sbjct: 195 PVQGEGGARHWTEAQLKEIRRLCDETGTLLIYDEIQCGLGRSGKLFAHEWADGQADPDIM 254

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
            +AK +GGGFP+GACLAT E A+ M  GSHGSTYGGN LAM +G   +  +     L +V
Sbjct: 255 AVAKALGGGFPVGACLATAEAASGMTPGSHGSTYGGNPLAMAVGIASVEELVKPELLAHV 314

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDN 361
             +A    + L+ +K+R+P++  ++RG+GLLIG+K V          RDE LL A   DN
Sbjct: 315 RELAGYFGQQLSGLKDRYPDVVADIRGKGLLIGVKLVTPNREFMQHARDEKLLIAGGGDN 374

Query: 362 VVRILPPLTITAEEIHEGLERIERT 386
            VR+LPPLT+T EE  E +E++ER 
Sbjct: 375 CVRLLPPLTLTFEEAREAIEKLERA 399


>gi|83954534|ref|ZP_00963245.1| acetylornithine aminotransferase [Sulfitobacter sp. NAS-14.1]
 gi|83840818|gb|EAP79989.1| acetylornithine aminotransferase [Sulfitobacter sp. NAS-14.1]
          Length = 394

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 272/386 (70%), Gaps = 2/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+G+WL  ++G  FLD  +GIAVN+LGH+HP LVA L  Q+ +LWH
Sbjct: 8   VLPTYSRAPLSFVKGEGSWLIEQDGRRFLDLGAGIAVNALGHAHPALVAALTEQAGQLWH 67

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+  QQ+  A+ L+  +FAD VFFTNSG E+ E A+K AR+Y Y  G+ ++  I+T
Sbjct: 68  TSNLYEIPQQQELADRLVALSFADTVFFTNSGTEACELAVKMARKYFYDKGQPDRTEIIT 127

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  +  +GFGP + GF   +F D+++L   I++ TAAI+IEP+Q
Sbjct: 128 FSGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFKHIEFGDMEALGAAITDTTAAIMIEPVQ 187

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+Q+R +C+    LLIFDEVQ G GRTGK+FA+EWA V PDIM +AKG
Sbjct: 188 GEGGIRPVPDADLKQMRALCETHGLLLIFDEVQCGVGRTGKMFAHEWAGVTPDIMMVAKG 247

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A+ M  G+HGSTYGGN L   +G  V+NII +D FLE+V   A 
Sbjct: 248 IGGGFPLGAVLATENAASGMTAGTHGSTYGGNPLGCAVGNAVVNIIGTDAFLEDVNRKAG 307

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA-LLAAKFRDECLLTAPSSDNVVRI 365
           ++ + L  +    P++F  VRG GL++GLK   + + +++A +R E ++T P++DNV+R+
Sbjct: 308 LMRQKLEGLVASHPDVFESVRGSGLMLGLKCKATNSDVVSAGYRYE-VITVPAADNVIRL 366

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPL IT E+I E + R+++ A  L+
Sbjct: 367 LPPLNITDEDIAEAVSRLDQAASSLA 392


>gi|83943961|ref|ZP_00956418.1| acetylornithine aminotransferase [Sulfitobacter sp. EE-36]
 gi|83845208|gb|EAP83088.1| acetylornithine aminotransferase [Sulfitobacter sp. EE-36]
          Length = 391

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 271/386 (70%), Gaps = 2/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+G+WL  ++G  FLD  +GIAVN+LGH+HP LVA L  Q+ +LWH
Sbjct: 5   VLPTYSRAPLSFVKGEGSWLIEQDGRRFLDLGAGIAVNALGHAHPALVAALTEQAGQLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+  QQ+  A+ L+  +FAD VFFTNSG E+ E A+K AR+Y Y  G+ ++  I+T
Sbjct: 65  TSNLYEIPQQQELADRLVALSFADTVFFTNSGTEACELAVKMARKYFYDKGQPDRTEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  +  +GFGP + GF   +F D+++L   I++ TAAI+IEP+Q
Sbjct: 125 FSGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFKHIEFGDMEALGAAITDTTAAIMIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+Q+R +C+    LLIFDEVQ G GRTGK+FA+EWA V PDIM +AKG
Sbjct: 185 GEGGIRPVPDADLKQMRALCETHGLLLIFDEVQCGVGRTGKMFAHEWAGVTPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A+ M  G+HGSTYGGN L   +G  V+NII +D FL++V   A 
Sbjct: 245 IGGGFPLGAVLATENAASGMTAGTHGSTYGGNPLGCAVGNAVVNIIGTDAFLDDVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT-VFSPALLAAKFRDECLLTAPSSDNVVRI 365
           ++ + L  +    P++F  VRG GL++GLK    +  +++A +R E ++T P++DNV+R+
Sbjct: 305 LMRQKLEGLVASHPDVFESVRGSGLMLGLKCKATNSDVVSAGYRHE-VITVPAADNVIRL 363

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPL IT E+I E + R+++ A  L+
Sbjct: 364 LPPLNITDEDIAEAVSRLDQAASSLA 389


>gi|254477640|ref|ZP_05091026.1| acetylornithine aminotransferase [Ruegeria sp. R11]
 gi|214031883|gb|EEB72718.1| acetylornithine aminotransferase [Ruegeria sp. R11]
          Length = 392

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 255/379 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+GAWL   +G  FLD A+GIAVN+LGH+HP LV  L  Q+E LWH
Sbjct: 5   VLPTYNRAPLSFVKGEGAWLIEADGRRFLDLAAGIAVNALGHAHPALVKALSEQAENLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY   QQ+  A+ L+  +FAD VFFTNSG ES E A+K AR+Y Y  G+  +  I+T
Sbjct: 65  VSNLYHIPQQQALADRLVEHSFADTVFFTNSGTESCELAVKMARKYFYEKGQPERVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A ISA G  +  +GFGP + GF    F DL  + N IS+ TAAILIEP+Q
Sbjct: 125 FSGSFHGRSSAGISAAGSEKMTKGFGPMLPGFVHLTFGDLDGVTNAISDKTAAILIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+ LR+ICD    LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 185 GEGGIRPVPDAELKALRQICDAHGLLLILDEVQCGVGRTGKLFAHEWAGITPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E A+ M  G+HGSTYGGN L   +G  V++ +    FL  V   A 
Sbjct: 245 IGGGFPLGAVLATEEAASGMTAGTHGSTYGGNPLGCAVGCAVMDHVSDPAFLAEVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +    P +F EVRG GL++GLK V     +     D  ++T P++DNV+R+L
Sbjct: 305 LLRQKLEGLVASHPEVFEEVRGTGLMLGLKCVAPNIDVVNAGYDNEVVTVPAADNVIRLL 364

Query: 367 PPLTITAEEIHEGLERIER 385
           PPLT+T ++I E   R++R
Sbjct: 365 PPLTLTDDDIDEAYARLDR 383


>gi|56695864|ref|YP_166215.1| acetylornithine transaminase protein [Ruegeria pomeroyi DSS-3]
 gi|56677601|gb|AAV94267.1| acetylornithine aminotransferase [Ruegeria pomeroyi DSS-3]
          Length = 391

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 259/385 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+GAWL   +G  FLD  +GIAVN+LGH+HP LV  L  Q++ LWH
Sbjct: 5   VLPTYTRAPLHFVKGEGAWLTEADGRRFLDLGAGIAVNALGHAHPALVKALTDQAQNLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY   QQ+  A+ L+  TFAD VFFTNSG E+ E A+K AR+Y Y  G+  +  I+T
Sbjct: 65  VSNLYHIPQQQALADKLVEHTFADTVFFTNSGTEACELAVKMARKYFYDKGQPERVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+G+FHGR+ A I+A G  + ++GFGP + GF    F DL  + N I++ TAAILIEP+Q
Sbjct: 125 FDGSFHGRSSAGIAAAGSEKMVKGFGPLLPGFVHLTFGDLDGVTNAITDKTAAILIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+ LR+ICDD   LLI DEVQ G GRTG+LFA+EWA + PDIM +AKG
Sbjct: 185 GEGGIRPVPDADLKALRQICDDHGLLLILDEVQCGVGRTGRLFAHEWAGITPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E A+ M  G+HGSTYGGN L   +G  V++ +    FL  V   A 
Sbjct: 245 IGGGFPLGAVLATEEAASGMTVGTHGSTYGGNPLGCAVGCAVMDHVADPDFLAEVNRKAA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +    PN+F EVRG GL++GLK   S   +     D  ++T P++DNVVR+L
Sbjct: 305 LLRQRLEGLIATHPNVFEEVRGSGLMLGLKCKASNLDVVKAGFDNLVITVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPLT+T E+I E   R++  A ++ 
Sbjct: 365 PPLTLTEEDIAEAFTRLDAAATQVD 389


>gi|27376209|ref|NP_767738.1| acetylornithine transaminase protein [Bradyrhizobium japonicum USDA
           110]
 gi|41016888|sp|Q89VE9|ARGD1_BRAJA RecName: Full=Acetylornithine aminotransferase 1; Short=ACOAT 1
 gi|27349349|dbj|BAC46363.1| acetylornithine aminotransferase [Bradyrhizobium japonicum USDA
           110]
          Length = 405

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 265/385 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + +SD+ FE+G+G WL + NG  +LDF SG+AVN+LGH+HP LV  L+ Q+ KLWH
Sbjct: 12  LLPVFARSDLGFERGEGCWLIATNGDRYLDFTSGVAVNALGHAHPALVKALQEQATKLWH 71

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL+QS   E  A  L + +FAD VFF NSGAE++E  IK  R +H+  G   ++RI+T
Sbjct: 72  MSNLFQSPDGEKLATRLCNESFADFVFFCNSGAEALEGVIKLVRHHHFSKGHPERYRIIT 131

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLAT++A G  +YLEGFGP ++GFDQ    D++++K  I   TA ILIEPIQ
Sbjct: 132 FEGAFHGRTLATLAATGSAKYLEGFGPPMDGFDQVPHGDIEAVKKAIGPQTAGILIEPIQ 191

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR     FL+ LR++CD+   LL FDEVQTG GRTG LFA+    V PD+M++AK 
Sbjct: 192 GEGGVRSATPAFLKALRQLCDEKGLLLAFDEVQTGMGRTGDLFAHRRTGVTPDVMSLAKA 251

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGA LAT + AA M  GSHGST+GGN LA+     VL+++   GF ++V  ++ 
Sbjct: 252 LGGGFPIGAILATADAAAGMGPGSHGSTFGGNPLAIAAANAVLDVMLKPGFFDHVQKMSL 311

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L ++ +R  ++  EVRG+GLLIG+K V     L A  R+E LLT  + DNVVR L
Sbjct: 312 LLKQKLASVIDRHGDVVSEVRGEGLLIGIKAVVPSGDLVAALRNEKLLTVGAGDNVVRFL 371

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL +T  EI + + R+ER    +S
Sbjct: 372 PPLIVTEAEIEDSVGRLERACAAIS 396


>gi|254511679|ref|ZP_05123746.1| acetylornithine aminotransferase [Rhodobacteraceae bacterium KLH11]
 gi|221535390|gb|EEE38378.1| acetylornithine aminotransferase [Rhodobacteraceae bacterium KLH11]
          Length = 395

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/387 (50%), Positives = 269/387 (69%), Gaps = 6/387 (1%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+GAWL   +G  FLD  +GIAVN+LGH+HP LVA L  Q+  LWH
Sbjct: 5   VLPTYNRAPLTFVKGEGAWLTEADGRRFLDLGAGIAVNALGHAHPALVAALTEQAHALWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY   QQ+  A+ L+  TFAD VFFTNSG ES E A+K AR++ +  G+  K  I+T
Sbjct: 65  VSNLYHIPQQQALADKLVEHTFADTVFFTNSGTESCELAVKMARKHFHDKGQPEKVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+G+FHGR+ A I+A G  +  +GFGP + GF    F DL  + N I++ TAAI+IEP+Q
Sbjct: 125 FDGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFVHLMFGDLDGVTNAITDKTAAIMIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+ LR+ICDD   LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 185 GEGGIRPVPDTELKALRQICDDHGLLLILDEVQCGVGRTGKLFAHEWAGITPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT + A+ M  G+HGSTYGGN L   +G  VL+ + +  FLE V   A 
Sbjct: 245 IGGGFPLGAVLATEDAASGMTAGTHGSTYGGNPLGCAVGCAVLDQVATPAFLEGVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA---LLAAKFRDECLLTAPSSDNVV 363
           +L + L  +    P++F EVRG GL++GLK    PA   ++ A + +E ++T P++DNV+
Sbjct: 305 LLRQKLEGLIAAHPDVFEEVRGTGLMLGLKC--KPANIDVVNAGYDNE-VITVPAADNVI 361

Query: 364 RILPPLTITAEEIHEGLERIERTAIKL 390
           R+LPPLT+T ++I + L R+++TA ++
Sbjct: 362 RLLPPLTLTEDDIAQALIRLDKTATQV 388


>gi|260426310|ref|ZP_05780289.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Citreicella sp. SE45]
 gi|260420802|gb|EEX14053.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Citreicella sp. SE45]
          Length = 391

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/384 (49%), Positives = 261/384 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+G+WL  E+G  FLD  SGIAVN+LGH+HP LV  L  Q++ LWH
Sbjct: 5   VLPTYSRAPLHFVKGEGSWLVEEDGRRFLDLGSGIAVNALGHAHPALVKALTDQAQNLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  QQ+  A+ L+ S+FAD VFFTNSG E+ E A+K AR+Y Y  G+ +K  I+ 
Sbjct: 65  VSNLYEIPQQQALADKLVASSFADTVFFTNSGTEACELAVKMARKYWYEKGQPDKTDIIA 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  + ++GFGP + GF   ++ D+  L+  I  +TAA+LIEP+Q
Sbjct: 125 FSGSFHGRSSAGIAAAGSEKMVKGFGPLLPGFKHLEWRDMAGLEAAIDENTAAVLIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P++ L+ LR +CDD   LLI DEVQ G GRTG+LFA+EWA V PDIM +AKG
Sbjct: 185 GEGGIRPMPDDELKALRALCDDKGCLLILDEVQCGMGRTGRLFAHEWAGVTPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E A+ M  G+HGSTYGGN L   +G  V++ +    FL  V   A 
Sbjct: 245 IGGGFPLGAVLATEEAASGMTVGTHGSTYGGNPLGCAVGCAVMDHVADPEFLAEVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +    P +F EVRG GL+IGLK   +PA L     +  ++T P++DNVVR+L
Sbjct: 305 LLRQKLEGLVAAHPEVFEEVRGSGLMIGLKCRIAPADLVKAGYNALVITVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           P LTI+ +EI E + R++  A  L
Sbjct: 365 PALTISDDEIAEAVTRLDLAAASL 388


>gi|241760958|ref|ZP_04759047.1| acetylornithine and succinylornithine aminotransferase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|241374577|gb|EER64038.1| acetylornithine and succinylornithine aminotransferase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
          Length = 396

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/379 (50%), Positives = 256/379 (67%), Gaps = 1/379 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+G +LF E G  +LDFASGIAVN LGH HP LV  ++ Q+  L H
Sbjct: 6   LMPVYPRCAVRPVRGEGCYLFGEQGERYLDFASGIAVNILGHGHPHLVKAIQEQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN+Y S Q E FA  L+   FAD VFFTNSGAE++ECAIKTARR+HY  G   +F+++T
Sbjct: 66  VSNMYGSPQGEAFAKRLLSHCFADTVFFTNSGAEAIECAIKTARRFHYANGNPERFKLIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRT+ TISA  + + ++GF P + GF   +F DL + +  + + TA  L+EPIQ
Sbjct: 126 FSNAFHGRTMGTISATNQPKMVDGFKPLLPGFQVVEFNDLAAAEAAVDDQTAGFLVEPIQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R   +EF++ LR+ICD+   +L+ DEVQ GYGR+G  FA+E   +KPDIM +AKG
Sbjct: 186 GEGGIRPATDEFMKGLRRICDEKGLMLVLDEVQCGYGRSGTFFAHEQYGIKPDIMAVAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT   A  M  G+HGSTYGGN LAM  G+ +L+II  DGF ++V  +  
Sbjct: 246 IGGGFPLGACLATEHAAKGMVFGTHGSTYGGNPLAMAAGQSILDIILEDGFFDHVQKMGN 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNVVRI 365
           IL E L  I  ++P + LE RG+GL+ GLK       + A  RD   LLT  ++DNV+RI
Sbjct: 306 ILAEKLETIVKKYPELCLEARGRGLIRGLKLSVPSRDVVAHLRDNHGLLTVAAADNVIRI 365

Query: 366 LPPLTITAEEIHEGLERIE 384
           LPPL I  + I E +E++E
Sbjct: 366 LPPLVIEEKHIDEFMEKLE 384


>gi|283856251|ref|YP_162143.2| acetylornithine transaminase protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|283775246|gb|AAV89032.2| acetylornithine and succinylornithine aminotransferase [Zymomonas
           mobilis subsp. mobilis ZM4]
          Length = 396

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/379 (50%), Positives = 256/379 (67%), Gaps = 1/379 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+G +LF E G  +LDFASGIAVN LGH HP LV  ++ Q+  L H
Sbjct: 6   LMPVYPRCAVRPVRGEGCYLFGEQGERYLDFASGIAVNILGHGHPHLVKAIQEQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN+Y S Q E FA  L+   FAD VFFTNSGAE++ECAIKTARR+HY  G   +F+++T
Sbjct: 66  VSNMYGSPQGEAFAKRLLSHCFADTVFFTNSGAEAIECAIKTARRFHYANGNPERFKLIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRT+ TISA  + + ++GF P + GF   +F DL + +  + + TA  L+EPIQ
Sbjct: 126 FSNAFHGRTMGTISATNQPKMVDGFKPLLPGFQVVEFNDLAAAEAAVDDQTAGFLVEPIQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R   +EF++ LR+ICD+   +L+ DEVQ GYGR+G  FA+E   +KPDIM +AKG
Sbjct: 186 GEGGIRPATDEFMKGLRRICDEKGLMLVLDEVQCGYGRSGTFFAHEQYGIKPDIMAVAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT   A  M  G+HGSTYGGN LAM  G+ +L+II  DGF ++V  +  
Sbjct: 246 IGGGFPLGACLATEHAAKGMVFGTHGSTYGGNPLAMAAGQSILDIILEDGFFDHVQKMGN 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNVVRI 365
           IL E L  I  ++P + LE RG+GL+ GLK       + A  RD   LLT  ++DNV+RI
Sbjct: 306 ILAEKLETIVKKYPELCLEARGRGLIRGLKLSVPSRDVVAHLRDNHGLLTVAAADNVIRI 365

Query: 366 LPPLTITAEEIHEGLERIE 384
           LPPL I  + I E +E++E
Sbjct: 366 LPPLVIEEKHIDEFMEKLE 384


>gi|294678651|ref|YP_003579266.1| acetylornithine aminotransferase [Rhodobacter capsulatus SB 1003]
 gi|294477471|gb|ADE86859.1| acetylornithine aminotransferase [Rhodobacter capsulatus SB 1003]
          Length = 393

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 264/384 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F +G+G+WL++ +G  +LD  +GIAVN+LGH+ P+LVA L  Q+ KLWH
Sbjct: 5   VLPTYTRAPLAFVRGEGSWLWTADGSRYLDLGAGIAVNALGHAAPDLVATLTEQAGKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  +QE  A+ L+  TFAD VFFTNSG E+ E A+K  R++ Y  G+  +  I+T
Sbjct: 65  VSNLYRIPEQERLADMLVAKTFADTVFFTNSGTEACELAVKMVRKHFYDKGQPERTEILT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGR+ A I+A G  + ++GFGP + GF    + DL ++K  ++  TAAILIEPIQ
Sbjct: 125 FSGAFHGRSSAAIAAAGTEKMVKGFGPLLPGFVHLPWGDLDAVKAAVTETTAAILIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R  PE FL+ LR+ICD+   LL+FDEVQ G  RTGKLFA+EWA V PD+M +AKG
Sbjct: 185 GEGGIRPAPEGFLRALREICDETGTLLVFDEVQCGVARTGKLFAHEWAGVTPDVMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT + A+ M  G+HGSTYGGN L   +G K++ I+ + GFL+ V   A 
Sbjct: 245 IGGGFPLGAVLATEDAASGMIAGTHGSTYGGNPLGCAIGAKMIEIVTAPGFLDEVSRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L + L  +    P++F EVRGQGL++GL+    P  +      + LLT P++DNV+R+L
Sbjct: 305 FLRQWLEGLVAAHPDIFEEVRGQGLMLGLRLKLPPGDVVKAAYAQNLLTVPAADNVLRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           P LTI+ +++ E + R++  A  L
Sbjct: 365 PALTISEDDMAEAVRRLDAAAASL 388


>gi|16126482|ref|NP_421046.1| acetylornithine aminotransferase [Caulobacter crescentus CB15]
 gi|221235262|ref|YP_002517699.1| acetylornithine transaminase protein [Caulobacter crescentus
           NA1000]
 gi|28376934|sp|Q9A652|ARGD_CAUCR RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|13423752|gb|AAK24214.1| acetylornithine aminotransferase [Caulobacter crescentus CB15]
 gi|220964435|gb|ACL95791.1| acetylornithine aminotransferase/succinyldiaminopimelate
           aminotransferase [Caulobacter crescentus NA1000]
          Length = 405

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/381 (50%), Positives = 264/381 (69%), Gaps = 2/381 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y+++ + FE+G+GA L S  G  +LD  +GIA N LGH+HP LV +LK+Q+EKLWH
Sbjct: 14  IMGVYNRAPLAFERGRGARLISTEGEEYLDCVAGIATNGLGHAHPALVEVLKAQAEKLWH 73

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN+Y+  +QE  A+ L  ++FAD VFFTNSG E+VECA+KTAR+YH   G+  +  I  
Sbjct: 74  VSNIYRIPEQEELADALCANSFADVVFFTNSGTEAVECALKTARKYHSANGQPERIDIYG 133

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SNDTAAILIEPI 185
           F+G+FHGRT A ++A G   Y++GFGP++ G+ Q  F D  ++K  I S  TAAI++EP+
Sbjct: 134 FDGSFHGRTYAAVNASGNPSYVDGFGPRLPGYSQLTFGDHDAIKAAIASPTTAAIIVEPV 193

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA-NVKPDIMTIA 244
           QGEGG R +P + L  LR++CD+   LLI+DEVQ G GRTGKLFAYEWA   +P IM +A
Sbjct: 194 QGEGGARSIPTQCLVGLRQLCDEHGVLLIYDEVQCGMGRTGKLFAYEWAEGGEPHIMAVA 253

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K +GGGFPIGACLAT E A  M   +HGST+GGN LAM +G+  L II+S   L+NV  +
Sbjct: 254 KALGGGFPIGACLATTEAAKGMTVAAHGSTFGGNPLAMAVGKAALEIIKSPETLDNVKTV 313

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
           +    + L  +K+RFP++ ++VRG+G+LIG+K + +        RDE LL A   DN VR
Sbjct: 314 SGFFTQQLNGLKDRFPDVIVDVRGKGMLIGVKLIPNNRDFMVLARDEKLLIAGGGDNCVR 373

Query: 365 ILPPLTITAEEIHEGLERIER 385
           +LPPL +T EE  E + ++E+
Sbjct: 374 LLPPLNLTIEEASEAIAKLEK 394


>gi|144900477|emb|CAM77341.1| Aminotransferase class-III [Magnetospirillum gryphiswaldense MSR-1]
          Length = 385

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/377 (51%), Positives = 262/377 (69%)

Query: 10  TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN 69
           TY ++D+ FE+G+GA L++++G  FLDF +G+AV +LGH HP LVA L++Q+ KLWH SN
Sbjct: 3   TYARADVVFERGEGATLWADDGRRFLDFGAGVAVTNLGHCHPRLVAALQAQAGKLWHTSN 62

Query: 70  LYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
           LY+   QE  A  L+ +TFAD VFF NSGAE+ ECAIK AR++HY +G   +  I+   G
Sbjct: 63  LYRVAGQESVAAKLVANTFADTVFFCNSGAEANECAIKMARKFHYDSGNAERTEIICATG 122

Query: 130 AFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEG 189
           AFHGRTLATI+AGG+ ++L+GF P++ GF    F +L +L+  I+  TAAIL+EP+QGEG
Sbjct: 123 AFHGRTLATIAAGGQEKHLKGFDPQMPGFVHVPFGNLNALRAAITGKTAAILVEPVQGEG 182

Query: 190 GVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGG 249
           G+     ++LQ+LR   D+   LLIFDEVQTG GRTG LFA++   V PDIM +AKG+GG
Sbjct: 183 GIVPGDPDYLQRLRAAADEFGLLLIFDEVQTGMGRTGALFAHQQMGVTPDIMPVAKGLGG 242

Query: 250 GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILF 309
           GFP+GACLAT + A  M  G+HGST+GGN LAM + E VL+++   GF++ +   A +L 
Sbjct: 243 GFPVGACLATEKAAKGMVPGAHGSTFGGNPLAMAVAETVLDVMLEPGFMDAIHAKAALLR 302

Query: 310 EGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPL 369
           +GL  +  RFP +  EVRG GL+IGLK       L ++     LLT  + DNVVR+LPPL
Sbjct: 303 QGLDGLAARFPAVIEEVRGLGLMIGLKCRIPNTELQSRLMANGLLTIGAGDNVVRLLPPL 362

Query: 370 TITAEEIHEGLERIERT 386
            I   EI+E L  I RT
Sbjct: 363 IIGEAEINEALAIIART 379


>gi|83592483|ref|YP_426235.1| acetylornithine aminotransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83575397|gb|ABC21948.1| acetylornithine aminotransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 394

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/390 (48%), Positives = 267/390 (68%), Gaps = 1/390 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D L   +  + + F+ G+GAWL + NG  +LDF +GIAVN+LG+SHP LV  L+ Q  K
Sbjct: 2   SDALLPVFSPASVLFDHGEGAWLVAANGERYLDFGAGIAVNALGYSHPHLVGALERQGRK 61

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+Y+ ++ E  A  L  + FAD  FF NSGAE+ ECAIK ARR+H   G+  ++R
Sbjct: 62  LWHLSNVYRISEAERLAERLTAACFADVAFFANSGAEANECAIKIARRHHDAHGRPERWR 121

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+TF+GAFHGRTLAT++AGG  +YL+GFGP ++GFDQ    D+++++ ++   TAA++IE
Sbjct: 122 IITFDGAFHGRTLATMAAGGNRKYLDGFGPAVDGFDQCPLEDIEAVRARVGPRTAALMIE 181

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGE G+R V   FL+QLR++CD+   LLIFDE+Q G  RTG LFA++ A V PDIM++
Sbjct: 182 PIQGESGIRPVSHGFLRQLRELCDERGLLLIFDEIQCGMARTGHLFAHQEAGVVPDIMSL 241

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFPIGACLAT   A  M  G+HGST+GGN LA  +   VL+I+  DG L  +  
Sbjct: 242 AKGLGGGFPIGACLATRGAAFGMRPGAHGSTFGGNPLAGAVANAVLDIVMDDGVLAEIRR 301

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF-SPALLAAKFRDECLLTAPSSDNV 362
            + +L   L  +  R+P++ +EVRG+GL++GLKT   SP ++ A      +LT  + D V
Sbjct: 302 KSALLRGLLEELAGRYPDLLVEVRGRGLMLGLKTTRPSPEIVEALRARAKVLTIAAGDTV 361

Query: 363 VRILPPLTITAEEIHEGLERIERTAIKLSH 392
            R+LPPL +T ++I    ER + T   LS 
Sbjct: 362 TRVLPPLIVTDKDIRLFAERCDETFAGLSR 391


>gi|163737717|ref|ZP_02145134.1| acetylornithine aminotransferase [Phaeobacter gallaeciensis BS107]
 gi|161389243|gb|EDQ13595.1| acetylornithine aminotransferase [Phaeobacter gallaeciensis BS107]
          Length = 394

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/381 (50%), Positives = 257/381 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+GAWL   +G  FLD A+GIAVN+LGH+HP LV  L  Q+E LWH
Sbjct: 5   VLPTYNRAPLSFVKGEGAWLIEADGRRFLDLAAGIAVNALGHAHPALVKALTDQAETLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY   QQ+  A+ L+  +FAD VFFTNSG ES E A+K AR+Y +  G+  +  I+T
Sbjct: 65  VSNLYHIPQQQALADRLVEHSFADTVFFTNSGTESCELAVKMARKYFHDKGQPERVEILT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A ISA G  +   GFGP + GF    F DL  + + I++ TAAILIEP+Q
Sbjct: 125 FSGSFHGRSSAGISAAGSEKMTAGFGPMLPGFKHLMFGDLDGVTDAITDQTAAILIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+ LR+ICD+   LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 185 GEGGIRPVPDAELKALRQICDEHGLLLILDEVQCGVGRTGKLFAHEWAGITPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E A+ M  G+HGSTYGGN L   +G  V++ +    FL  V   A 
Sbjct: 245 IGGGFPLGAVLATEEAASGMTAGTHGSTYGGNPLGCAVGCAVMDHVTDPEFLAEVSRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +    P +F  VRG GL++GLK V +   + A   +  ++T P++DNVVR+L
Sbjct: 305 LLRQKLEGLVASHPQVFEAVRGSGLMLGLKCVAANTDVVAAGYEAEVVTVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPLT+T E+I E   R+++ A
Sbjct: 365 PPLTLTDEDIAEAFARLDQAA 385


>gi|114773338|ref|ZP_01450542.1| Acetylornithine Aminotransferase class-III [alpha proteobacterium
           HTCC2255]
 gi|114546272|gb|EAU49183.1| Acetylornithine Aminotransferase class-III [alpha proteobacterium
           HTCC2255]
          Length = 392

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/381 (49%), Positives = 256/381 (67%)

Query: 10  TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN 69
           TY ++ + F KGKG+WL  EN   ++D  +GIAVN LGH+HP+LV +L+ Q+E LWH SN
Sbjct: 8   TYARAPLTFVKGKGSWLIDENSEKYIDMGAGIAVNVLGHAHPDLVQVLQKQAENLWHTSN 67

Query: 70  LYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
           LY  + Q+  A+ L+  TFA  VFFTNSG ES+ECAIK AR++HY  G   + +I+TFEG
Sbjct: 68  LYNVSNQKKLADVLVEETFAQTVFFTNSGTESMECAIKMARKFHYEKGMPERTKIITFEG 127

Query: 130 AFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEG 189
           +FHGR++  ISA G  +  +GFGP + GF Q  F D ++L  +I    AAI+IEPIQGEG
Sbjct: 128 SFHGRSIGMISAAGSEKLTKGFGPLLPGFVQIPFGDHEALIAEIDETIAAIVIEPIQGEG 187

Query: 190 GVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGG 249
           G+  VP++ L+ LR  CD+   LLIFDE+Q G GRTGKLFA+EWA V+PDIM IAKG+GG
Sbjct: 188 GILPVPDQCLKGLRDCCDENGILLIFDEIQCGMGRTGKLFAHEWAGVEPDIMAIAKGIGG 247

Query: 250 GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILF 309
           GFP+GACLAT+  A CM  G+HGSTYGGN LA  +G +V+  + +  FL NV  +A    
Sbjct: 248 GFPLGACLATSNAAECMTAGTHGSTYGGNPLATAVGLEVMRHVNTPAFLNNVNFLASNFR 307

Query: 310 EGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPL 369
           + L A+    P +F  VRG GL++G++ V     +     D  +LT P   NV+R+LP L
Sbjct: 308 QSLEALVANHPTIFKSVRGSGLMLGIECVVPNIDVVNAGYDNKILTVPGGANVIRLLPAL 367

Query: 370 TITAEEIHEGLERIERTAIKL 390
            ++  E+ E  +R+  TA KL
Sbjct: 368 NVSMNELKEATQRLSATASKL 388


>gi|119384773|ref|YP_915829.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Paracoccus denitrificans PD1222]
 gi|119374540|gb|ABL70133.1| acetylornithine aminotransferase apoenzyme [Paracoccus
           denitrificans PD1222]
          Length = 390

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/381 (48%), Positives = 263/381 (69%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ I FE+G+G W  + +G  +LD  +GIAVN+LGH++PELVA L  Q+ ++WH
Sbjct: 5   VLPTYNRAPIAFERGEGTWAIATDGTRYLDLGAGIAVNALGHANPELVATLTEQANRIWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLYQ  +QE  A+ L+  TFAD  F TNSG E+ E AIK  R+Y + AG  +++ I+T
Sbjct: 65  VSNLYQIPEQERLADLLVEHTFADTAFITNSGTEAAELAIKMVRKYWHDAGDPDRYEILT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGR+   I+A G  + ++GFGP + GF Q  + D+++LK  IS+ TAA+++EP+Q
Sbjct: 125 FEGAFHGRSTGAIAAAGSEKMVKGFGPLMPGFRQLPWGDMEALKAAISDRTAAVMLEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R + +  L  +R++CD    LL+ DEVQ+G GRTGKLFA+E+A + PDIM IAKG
Sbjct: 185 GEGGIRPLSDADLAAIRQLCDQTGTLLVLDEVQSGMGRTGKLFAHEYAGITPDIMMIAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   AA M  G+HGSTYGGN LA  +G KV+ I+ +  FL  V   A 
Sbjct: 245 IGGGFPLGAVLATERAAAGMAAGTHGSTYGGNPLACAVGAKVMQIVAAPEFLAEVNRKAA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L  +    P++F  VRGQGL++GLK   +P  L     DE +LT  ++D+ +R+L
Sbjct: 305 LFRQKLEGLVAAHPDVFDYVRGQGLMLGLKCKVAPGELVKAGYDEHILTVAAADDTLRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPLTI+ EEI E + R++R A
Sbjct: 365 PPLTISDEEIAEAVVRLDRAA 385


>gi|302384431|ref|YP_003820254.1| acetylornithine and succinylornithine aminotransferase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302195059|gb|ADL02631.1| acetylornithine and succinylornithine aminotransferase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 398

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 261/382 (68%), Gaps = 2/382 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y+++ +  ++G+GA L++ +G  +LD   GI+ N LGH+HP L+  +K Q+EKLWH
Sbjct: 5   LMGVYNRAPLEVDRGRGARLWATDGTEYLDCVQGISTNGLGHAHPVLIEAVKEQAEKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN+++   QE  A+ L  S+FAD VFFTNSG E+VECA+KTAR+YH   G+  +  I  
Sbjct: 65  VSNIFKIPGQEELADRLTESSFADVVFFTNSGTEAVECALKTARKYHAANGQPERIDIYG 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-DTAAILIEPI 185
           F+GAFHGRT   I+A     Y EGFGPK++GF Q K+ D ++LK  I+  + AAI++EP+
Sbjct: 125 FDGAFHGRTYGAINAAANPSYTEGFGPKMQGFHQLKWGDHEALKAAIAEPNCAAIIVEPV 184

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG R +P+  L+ LR++CD    L+IFDEVQ G GR+GKL+A+EWA + PDIM +AK
Sbjct: 185 QGEGGCRAMPDVCLRGLRELCDQHGVLIIFDEVQCGMGRSGKLWAHEWAGMAPDIMAVAK 244

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
            +GGGFPIGACLAT E A  M  G+HGST+GGN LAM +G    N I SD  L NV  IA
Sbjct: 245 ALGGGFPIGACLATTEAAKGMTVGAHGSTFGGNPLAMAVGLAAFNAINSDAILGNVNEIA 304

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDE-CLLTAPSSDNVVR 364
             L + L  +K RFP++  +VRG+GLLIGLK V +        RDE  LL A   DN VR
Sbjct: 305 GYLKQQLHGLKERFPDVIEDVRGKGLLIGLKLVPNNREFMGWARDEQHLLIAGGGDNCVR 364

Query: 365 ILPPLTITAEEIHEGLERIERT 386
           +LPPL +T +E  E +E++ERT
Sbjct: 365 MLPPLNLTLDEAREAIEKLERT 386


>gi|167645196|ref|YP_001682859.1| acetylornithine transaminase protein [Caulobacter sp. K31]
 gi|167347626|gb|ABZ70361.1| acetylornithine and succinylornithine aminotransferase [Caulobacter
           sp. K31]
          Length = 404

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/381 (49%), Positives = 262/381 (68%), Gaps = 2/381 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y+++ + FE+G+GA LFS +G  +LD  +GIA + LGH+HP LV  LK+Q EKLWH
Sbjct: 14  IMGVYNRAPLAFERGRGARLFSTDGEAYLDCVAGIATDGLGHAHPVLVEALKTQGEKLWH 73

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN+Y+  +QE  A+ L  ++FAD VFFTNSG E++ECA+KTAR+YH   G+  +  I  
Sbjct: 74  VSNIYRIPEQEELADKLCANSFADVVFFTNSGTEAIECALKTARKYHTANGQPERVEIYG 133

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SNDTAAILIEPI 185
           F+G+FHGR+ A ++A G   Y+EGFGP++ G+ Q  F D+ ++K    S  TAAI+IEP+
Sbjct: 134 FDGSFHGRSYAAVNAAGNPSYVEGFGPRLPGYTQLTFGDIDAIKAACASPTTAAIIIEPV 193

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA-NVKPDIMTIA 244
           QGEGG R V E  L +LR++  D   LLI+DEVQ G GRTGKLFAYEWA +  PDIM IA
Sbjct: 194 QGEGGARAVTEAQLDELRQLTRDNGVLLIYDEVQCGMGRTGKLFAYEWASDAAPDIMCIA 253

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K +GGGFP+GACLAT E A  M  G HGST+GGN LAM +G+  L+ I +   L+NV  +
Sbjct: 254 KALGGGFPVGACLATAEAAKGMTVGVHGSTFGGNPLAMAVGKAALDTINTPEILDNVKTV 313

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
           A    + L  +K+RFP++ +++RG+GLLIG+K + +        RD+ LL A   DN VR
Sbjct: 314 AGYFTQQLNGLKDRFPDVIVDIRGKGLLIGIKLIPNNREFMVLARDQYLLVAGGGDNCVR 373

Query: 365 ILPPLTITAEEIHEGLERIER 385
           +LPPL +T EE  E + ++E+
Sbjct: 374 LLPPLNLTVEEASEAIAKLEK 394


>gi|254419675|ref|ZP_05033399.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Brevundimonas sp. BAL3]
 gi|196185852|gb|EDX80828.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Brevundimonas sp. BAL3]
          Length = 397

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/384 (50%), Positives = 265/384 (69%), Gaps = 2/384 (0%)

Query: 3   KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSE 62
             + L   Y+++ +  E+G+GA L+S +G  +LD  +GI+ N LGH+HPELV  +K Q+E
Sbjct: 2   STNHLMGVYNRAPLEVERGRGARLWSTDGTEYLDCVAGISTNGLGHAHPELVQAVKDQAE 61

Query: 63  KLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKF 122
           KLWHVSN+++   QE  A+ L  S+FAD VFFTNSG E+VECA+KTAR+YH   G   + 
Sbjct: 62  KLWHVSNIFRIPGQEALADALCESSFADVVFFTNSGTEAVECALKTARKYHSAKGAPERI 121

Query: 123 RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT-AAIL 181
            I  F+G+FHGRT   I+A     Y EGFGP ++GF Q K+ D  ++K  I+N T AAI+
Sbjct: 122 DIYGFDGSFHGRTYGAINAAANPSYTEGFGPAMQGFHQLKWGDHDAIKAAIANPTTAAII 181

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGG R +PE+ L+ LR++CD+   L+IFDEVQ G GRTGKL+A+EWA + PDIM
Sbjct: 182 VEPVQGEGGCRAMPEQCLRGLRELCDEHGVLIIFDEVQCGMGRTGKLWAHEWAGMSPDIM 241

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
            +AK +GGGFPIGACLAT   A+ M  G HGST+GGN LAM +G K L++I +   L NV
Sbjct: 242 AVAKALGGGFPIGACLATARAASGMTVGVHGSTFGGNPLAMAVGLKALSLINTPETLANV 301

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSD 360
            +IA  L + L  +++RFP++ ++VRG+GLLIG+K V +     A  RD + LL A   D
Sbjct: 302 NDIAGYLKQQLAGLQSRFPDIIVDVRGKGLLIGVKLVPNNREFMALARDTQQLLIAGGGD 361

Query: 361 NVVRILPPLTITAEEIHEGLERIE 384
           N VR+LPPL +T +E  E + R E
Sbjct: 362 NCVRLLPPLNLTLDEARELIVRFE 385


>gi|163744066|ref|ZP_02151433.1| acetylornithine aminotransferase [Phaeobacter gallaeciensis 2.10]
 gi|161382682|gb|EDQ07084.1| acetylornithine aminotransferase [Phaeobacter gallaeciensis 2.10]
          Length = 394

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/381 (50%), Positives = 257/381 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+GAWL   +G  FLD A+GIAVN+LGH+HP LV  L  Q+E LWH
Sbjct: 5   VLPTYNRAPLSFVKGEGAWLIEADGRRFLDLAAGIAVNALGHAHPALVKALTDQAETLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY   QQ+  A+ L+  +FAD VFFTNSG ES E A+K AR+Y +  G+  +  I+T
Sbjct: 65  VSNLYHIPQQQALADRLVEHSFADTVFFTNSGTESCELAVKMARKYFHDKGQPERVEILT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A ISA G  +   GFGP + GF    F DL  + + I++ TAAILIEP+Q
Sbjct: 125 FSGSFHGRSSAGISAAGSEKMTAGFGPMLPGFKHLMFGDLDGVTDAITDQTAAILIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  ++ LR+ICD+   LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 185 GEGGIRPVPDNEMKALRQICDEHGLLLILDEVQCGVGRTGKLFAHEWAGITPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E A+ M  G+HGSTYGGN L   +G  V++ +    FL  V   A 
Sbjct: 245 IGGGFPLGAVLATEEAASGMTAGTHGSTYGGNPLGCAVGCAVMDHVTDPEFLAEVSRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +    P +F  VRG GL++GLK V +   + A   +  ++T P++DNVVR+L
Sbjct: 305 LLRQKLEGLVAAHPQVFEAVRGSGLMLGLKCVAANTDVVAAGYEAEVVTVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPLT+T E+I E   R+++ A
Sbjct: 365 PPLTLTDEDIAEAFARLDQAA 385


>gi|260575312|ref|ZP_05843312.1| acetylornithine and succinylornithine aminotransferase [Rhodobacter
           sp. SW2]
 gi|259022572|gb|EEW25868.1| acetylornithine and succinylornithine aminotransferase [Rhodobacter
           sp. SW2]
          Length = 392

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/385 (49%), Positives = 262/385 (68%), Gaps = 3/385 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F  G G WL +ENG  +LD  +GIAVN+LGH+HP LVA L  Q+ KLWH
Sbjct: 5   VLPTYSRAPVAFTHGSGCWLTAENGSRYLDLGAGIAVNALGHAHPALVAALTEQAGKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  +QE+ A+ L+  TFAD VFFTNSG E+ E AIK  R+Y Y   +  +  I+T
Sbjct: 65  VSNLYRVPEQEVLADLLVEHTFADTVFFTNSGTEAAELAIKMVRKYWYDKAEP-RTEILT 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGR+   I+A G  +  +GFGP + GF    F D  +L+  ++  TAA++IEPIQ
Sbjct: 124 FEGAFHGRSTGAIAAAGSEKLTKGFGPLMPGFRALPFGDHDALRAAVTRQTAAVMIEPIQ 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP++ L+ LR +CD+  ALL+FDEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 184 GEGGIRSVPDQCLKGLRDLCDETGALLVFDEVQCGMGRTGKLFAHEWAGITPDIMMVAKG 243

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT + A+ M  G+HGSTYGGN L   +G +V+ +I +D FL  V   A 
Sbjct: 244 IGGGFPLGALLATEDAASGMTSGTHGSTYGGNPLGCAVGAEVMRLIANDAFLAEVNRKAA 303

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT-VFSPALLAAKFRDECLLTAPSSDNVVRI 365
           +  +GL ++    P +F  VRGQGL++GLK    + A+L A +  E LLT P++DN +R+
Sbjct: 304 LFRQGLESLVASHPEVFEAVRGQGLMLGLKCRAANTAVLQAAYA-EHLLTVPAADNCLRL 362

Query: 366 LPPLTITAEEIHEGLERIERTAIKL 390
           LP L I   +I E L R++  AI++
Sbjct: 363 LPALNIPDADITEALHRLDAAAIRV 387


>gi|92116261|ref|YP_575990.1| acetylornithine transaminase protein [Nitrobacter hamburgensis X14]
 gi|91799155|gb|ABE61530.1| acetylornithine aminotransferase apoenzyme [Nitrobacter
           hamburgensis X14]
          Length = 403

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/385 (51%), Positives = 262/385 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   + ++D+ FE G+GAWL   +G  +LDF SG+AVN+LGH HP LVA L++Q+ KLWH
Sbjct: 9   LLPVFARADLSFESGEGAWLVGSDGGRYLDFTSGVAVNALGHCHPHLVAALQAQAAKLWH 68

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL++S   E  A  L   +FAD  FF NSGAE+VECAIK  RRYH   G   ++R+VT
Sbjct: 69  VSNLFKSPDGERLAARLCEQSFADFAFFANSGAEAVECAIKVVRRYHASKGHPERYRLVT 128

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLA ++A G  +YL+G+GP  +GFDQ    D++++K  +   TA ILIEP+Q
Sbjct: 129 FEGAFHGRTLAALAATGSKKYLDGYGPPTDGFDQVPIDDIEAVKKAVGPATAGILIEPLQ 188

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR+    F + LR+ CD+   LL FDEVQTG GRTG LFAY    V PD+M++AK 
Sbjct: 189 GEGGVREPSHAFFRALRQFCDERGLLLAFDEVQTGMGRTGDLFAYRRIGVAPDVMSLAKA 248

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A+ M  GSHGST+GGN LA+     VL+++   GF E    ++ 
Sbjct: 249 LGGGFPIGACLATAEAASGMTPGSHGSTFGGNPLAVAAANAVLDVMLEPGFFERTRKMSL 308

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L ++ +R  ++  EVRG+GLLIGLK V     L    R+E LLT  + DNVVR+L
Sbjct: 309 LLKQKLASVVDRHRDVLSEVRGEGLLIGLKAVVPSGDLVGALREEKLLTVGAGDNVVRLL 368

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL ++  EI E + R+ER   KLS
Sbjct: 369 PPLIVSEVEIEESVRRLERACAKLS 393


>gi|115526872|ref|YP_783783.1| acetylornithine transaminase protein [Rhodopseudomonas palustris
           BisA53]
 gi|115520819|gb|ABJ08803.1| acetylornithine aminotransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 404

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/390 (50%), Positives = 261/390 (66%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
                L   + ++D+ FE+G+G WL   +G  +LDF SG+AVN+LGH+HP LV  L+ Q+
Sbjct: 5   TSTSHLLPVFARADLAFERGEGVWLIGTDGERYLDFTSGVAVNALGHAHPHLVEALREQA 64

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            KLWH+SNL++S   E  A  L   +FAD VFF NSG E++ECAIK  R+YH   G   +
Sbjct: 65  TKLWHMSNLFKSPDGERLAARLCEQSFADYVFFANSGTEAIECAIKVTRKYHASKGHPER 124

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
           +RI+TFEGAFHGRTLA ++A G  +YL+G+GP ++GFDQ    DL ++K  I   TA I+
Sbjct: 125 YRIITFEGAFHGRTLAALAATGAAKYLDGYGPPLDGFDQVPLGDLDAVKAAIGPATAGIV 184

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           IEP+QGEGGVR     F + LR++CD    LLIFDEVQTG GR+G+LFAY+   V PD+M
Sbjct: 185 IEPVQGEGGVRAASPAFFKALRELCDAHGLLLIFDEVQTGMGRSGELFAYQRLGVAPDVM 244

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
            +AK +GGGFPIGACL T E A+ M  GSHGST+GGN LA+     VL+++ + GF   V
Sbjct: 245 ALAKALGGGFPIGACLVTAEAASGMTPGSHGSTFGGNPLAVAAANAVLDVMLAPGFFARV 304

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDN 361
             IA +  + L ++ +R+P +  EVRG+GLLIGLK V   A L    R E LLT  + DN
Sbjct: 305 QQIALLAKQKLASVVDRYPQVLSEVRGEGLLIGLKAVVPAADLMVALRAEKLLTVAAGDN 364

Query: 362 VVRILPPLTITAEEIHEGLERIERTAIKLS 391
           VVR+LPPL ++  EI + + R+ER    LS
Sbjct: 365 VVRLLPPLIVSEAEIDDAVARLERACATLS 394


>gi|84499550|ref|ZP_00997838.1| acetylornithine aminotransferase [Oceanicola batsensis HTCC2597]
 gi|84392694|gb|EAQ04905.1| acetylornithine aminotransferase [Oceanicola batsensis HTCC2597]
          Length = 392

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 264/385 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+G+WL  E+G  FLD  SGIAV +LGH+HP +V  L  Q++KLWH
Sbjct: 5   VLPTYSRAPLHFVKGEGSWLIEEDGRRFLDLGSGIAVAALGHAHPAIVQALTDQAQKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  QQ+  A+ L+ +TFAD VFFTNSG ES+E  +K AR+YHY  G+ ++  I+T
Sbjct: 65  VSNLYEIPQQQALADRLVAATFADTVFFTNSGTESMELGVKMARKYHYERGEPDRVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGR+ A I+A G  + ++GFGP + GF Q  + D+++L+  +S  TAAILIEP+Q
Sbjct: 125 FSGAFHGRSSAAIAAVGTEKMVKGFGPLLPGFVQVPWGDMEALEAAVSERTAAILIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+   P+  L++LR +CD+  ALL+ DE+Q+G GRTG+LFA+EWA V PDIM +AKG
Sbjct: 185 GEGGINVAPDTVLKKLRALCDESGALLMADEIQSGMGRTGRLFAHEWAGVAPDIMLVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A+ M  G+HGSTYGGN L   +G  V+  I + GFLE V     
Sbjct: 245 IGGGFPLGAVLATGAAASGMTAGTHGSTYGGNPLGCAVGLAVVEAITAPGFLEEVRRKGA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L  +    P +F EVRG G ++GLK   +   +     +E L+T P++DNV+R+L
Sbjct: 305 LFRQKLEGLVAGNPEVFEEVRGTGFMLGLKCRPANGDVVKAGYEEQLITVPAADNVIRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           P LT+  +EI E  +R++R A +++
Sbjct: 365 PALTLGDDEIAEAADRLDRVAKRVA 389


>gi|83594607|ref|YP_428359.1| acetylornithine aminotransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83577521|gb|ABC24072.1| acetylornithine aminotransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 396

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/391 (48%), Positives = 262/391 (67%), Gaps = 1/391 (0%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M+    +  TY + D+ F++G+GAWL + +G  FLDFASGIAV  LGH+HP LV  L SQ
Sbjct: 1   MSTVPAVMPTYSRVDLSFDRGEGAWLLANDGRRFLDFASGIAVTGLGHAHPHLVEALTSQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY-HYMAGKT 119
           + KLWH SNL++   QE  A  L+  +FAD VFFTNSGAE++E A+K ARR+ H + G+T
Sbjct: 61  AAKLWHCSNLFRIPGQERLAQRLVDGSFADSVFFTNSGAEAIEAALKLARRHQHVVRGET 120

Query: 120 NKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAA 179
            ++R +    AFHGRTLAT++AGG+ ++++GF P +EGFD+  F DL + +  ++ +TAA
Sbjct: 121 ARYRTIVTRNAFHGRTLATVTAGGQAKHVKGFEPLVEGFDRVDFGDLDAARAAVTEETAA 180

Query: 180 ILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD 239
           IL+EPIQGEGG+   PE +L  LR++ D+   LLI DEVQTG GRTGKLFA+EW  + PD
Sbjct: 181 ILVEPIQGEGGIFPAPEGYLSGLRRLADEHGLLLILDEVQTGVGRTGKLFAHEWDGIIPD 240

Query: 240 IMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE 299
           ++ IAKG+G GFP+GACLA    A+ +  GSHGST+GGN LAM +G  VL+II ++GFL+
Sbjct: 241 VVAIAKGIGAGFPMGACLAREPYASALVAGSHGSTFGGNPLAMAVGNAVLDIILAEGFLD 300

Query: 300 NVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSS 359
            V      L   L  + +R P +   VRG+GL+IGL       ++    R++ LL  P+ 
Sbjct: 301 GVSARGADLIARLDGLVHRHPTILAGVRGRGLMIGLVCAAPNGVVLNALREQGLLAVPAE 360

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
             VVR+LPP+ I   E+    E I+R  + L
Sbjct: 361 AGVVRLLPPMIIGEAEVTAAEEMIDRACVHL 391


>gi|262277635|ref|ZP_06055428.1| acetylornithine and succinylornithine aminotransferases subfamily
           [alpha proteobacterium HIMB114]
 gi|262224738|gb|EEY75197.1| acetylornithine and succinylornithine aminotransferases subfamily
           [alpha proteobacterium HIMB114]
          Length = 388

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 263/384 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY +  + F  GKG +LFS +   +LDF SGIAVN+LGH H  LV  ++ Q+ KLWH
Sbjct: 4   ILGTYARRPVSFSHGKGCYLFSTSNDKYLDFVSGIAVNALGHCHDHLVKTVQEQAAKLWH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN ++  +QE  A  L+ +TFAD V F NSGAE+ E +IK AR+Y +  G++ K RI+T
Sbjct: 64  VSNAFEIPEQERLAQRLVENTFADYVIFMNSGAEATEASIKIARKYFFEKGQSEKNRIIT 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+GAFHGRTLA++ A     +++GF PK+EGFDQ  F D ++LK  I+ +TAAI++E I 
Sbjct: 124 FKGAFHGRTLASLFAANNPDHIKGFEPKVEGFDQVDFGDHEALKKAINKNTAAIMVETIL 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG++ +P++ LQ LRK+CD+ D LLI DEVQ G GR+GK FA++WA ++PDI+ IAKG
Sbjct: 184 GEGGIKIIPDQCLQGLRKLCDEHDLLLILDEVQCGIGRSGKFFAFDWAGIEPDIVPIAKG 243

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACL   +  + M  G+HGST+GGN LAM +G  VL+II   GFLENV+ I +
Sbjct: 244 IGGGFPVGACLVNKKAGSGMKPGNHGSTFGGNPLAMSVGNAVLDIILEKGFLENVVKIGE 303

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
                L  +K ++P++  EVRG+GLL G+K     A    K  +  +L   +S+NVVR+L
Sbjct: 304 YFEAQLLKLKEKYPSVIEEVRGKGLLRGIKLKSDNAKFLNKLFEHKMLAVKASENVVRLL 363

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL +  +EI E +  IE+   KL
Sbjct: 364 PPLIVKEKEIDEAISIIEKVCEKL 387


>gi|260753075|ref|YP_003225968.1| acetylornithine transaminase protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258552438|gb|ACV75384.1| acetylornithine and succinylornithine aminotransferase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 396

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/379 (50%), Positives = 255/379 (67%), Gaps = 1/379 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+G +LF E G  +LDFASGIAVN LGH HP LV  ++ Q+  L H
Sbjct: 6   LMPVYPRCAVRPVRGEGCYLFGEQGERYLDFASGIAVNILGHGHPHLVKAIQEQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN+Y S Q E FA  L+   FAD VFFTNSGAE++ECAIKTARR+H   G   +F+++T
Sbjct: 66  VSNMYGSPQGEAFAKRLLSHCFADTVFFTNSGAEAIECAIKTARRFHDANGNPERFKLIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRT+ TISA  + + ++GF P + GF   +F DL + +  + + TA  L+EPIQ
Sbjct: 126 FSNAFHGRTMGTISATNQPKMVDGFKPLLPGFQVVEFNDLAAAEAAVDDQTAGFLVEPIQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R   +EF++ LR+ICD+   +L+ DEVQ GYGR+G  FA+E   +KPDIM +AKG
Sbjct: 186 GEGGIRPATDEFMKGLRRICDEKGLMLVLDEVQCGYGRSGTFFAHEQYGIKPDIMAVAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT   A  M  G+HGSTYGGN LAM  G+ +L+II  DGF ++V  +  
Sbjct: 246 IGGGFPLGACLATEHAAKGMVFGTHGSTYGGNPLAMAAGQSILDIILEDGFFDHVQKMGN 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNVVRI 365
           IL E L  I  ++P + LE RG+GL+ GLK       + A  RD   LLT  ++DNV+RI
Sbjct: 306 ILAEKLETIVKKYPELCLEARGRGLIRGLKLSVPSRDVVAYLRDNHGLLTVAAADNVIRI 365

Query: 366 LPPLTITAEEIHEGLERIE 384
           LPPL I  + I E +E++E
Sbjct: 366 LPPLVIEEKHIDEFMEKLE 384


>gi|254488152|ref|ZP_05101357.1| acetylornithine aminotransferase [Roseobacter sp. GAI101]
 gi|214045021|gb|EEB85659.1| acetylornithine aminotransferase [Roseobacter sp. GAI101]
          Length = 407

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/385 (49%), Positives = 265/385 (68%), Gaps = 2/385 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F +G+GAWL  ++G  FLD  +GIAVN+LGH++P LVA L  Q+ KLWH
Sbjct: 21  VLPTYSRAPLSFVEGEGAWLIEQDGRRFLDLGAGIAVNALGHANPALVAALTEQAGKLWH 80

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLYQ  QQ+  A+ L+  TFAD VFFTNSG ES E A+K AR+Y Y  G+ ++  I+T
Sbjct: 81  TSNLYQIPQQQALADKLVALTFADTVFFTNSGTESCELAVKMARKYFYDKGQPDRVEIIT 140

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  +  +GFGP + GF    F D  +L+  I++ TAAILIEP+Q
Sbjct: 141 FSGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFVHLDFGDHDALRAAITDTTAAILIEPVQ 200

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP++ L+ LR +CD+   LLI DEVQ G GRTGKLFA+EW+ + PDIM +AKG
Sbjct: 201 GEGGIRPVPDQCLKGLRDLCDENGILLIMDEVQCGVGRTGKLFAHEWSGIAPDIMMVAKG 260

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT + A+ M  G+HGSTYGGN L   +G  V++II +  FL  V   A 
Sbjct: 261 IGGGFPLGAVLATEDAASGMTAGTHGSTYGGNPLGCAVGNAVIDIISAPDFLAEVNRKAG 320

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT-VFSPALLAAKFRDECLLTAPSSDNVVRI 365
           ++ + L  +    P++F  VRG GL++GLK    +  +++A +  E ++T P++DNV+R+
Sbjct: 321 LILQKLEGLVAGHPDIFESVRGSGLMLGLKCKATNSDVVSAGYAHE-VITVPAADNVIRL 379

Query: 366 LPPLTITAEEIHEGLERIERTAIKL 390
           LPPL IT EEI E + R+++ A  L
Sbjct: 380 LPPLNITDEEIAEAISRLDQAAGSL 404


>gi|163747268|ref|ZP_02154623.1| acetylornithine aminotransferase [Oceanibulbus indolifex HEL-45]
 gi|161379543|gb|EDQ03957.1| acetylornithine aminotransferase [Oceanibulbus indolifex HEL-45]
          Length = 391

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 261/386 (67%), Gaps = 2/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+G WL   +G  FLD  +GIAVN+LGH+HP LV  L  Q++ LWH
Sbjct: 5   VLPTYNRAPLTFVKGEGTWLIEADGRRFLDLGAGIAVNALGHAHPALVKALTDQAQALWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY   QQE  A+ L+  TFAD  FF NSG E+ E A+K AR+Y Y AG+  +  I+T
Sbjct: 65  TSNLYHIPQQEALADRLVAETFADTAFFCNSGTEACELAVKMARKYFYEAGQPKRVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  +  +GFGP + GF      D  +L+  I++ TAAI++EP+Q
Sbjct: 125 FSGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFVHLDLGDSDALEAAITDKTAAIMVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  LQQ+R +CD    LLI DEVQ G GRTG+LFA+EWA V PDIM +AKG
Sbjct: 185 GEGGIRAVPDAELQQMRALCDQHGLLLIMDEVQCGVGRTGRLFAHEWAGVTPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT + A+ M  G+HGSTYGGN L   +G  VL+++  + FL  V   A 
Sbjct: 245 IGGGFPLGAVLATEKAASGMTAGTHGSTYGGNPLGCAVGSAVLDVVADEAFLAEVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT-VFSPALLAAKFRDECLLTAPSSDNVVRI 365
           ++ + L  +    P +F EVRG GL++GLK  V +  ++ A + +E L+T P++DNV+R+
Sbjct: 305 LMRQRLEGLVAEHPEVFEEVRGAGLMLGLKCKVVNADVVTAGYANE-LITVPAADNVIRL 363

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPLTI+ +EI E + R++  A +L+
Sbjct: 364 LPPLTISDDEIAEAVTRLDAIARELT 389


>gi|254456330|ref|ZP_05069759.1| acetylornithine aminotransferase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083332|gb|EDZ60758.1| acetylornithine aminotransferase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 388

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/387 (50%), Positives = 261/387 (67%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
            +L   Y++  I F+ GKG++L+S +G  +LDF  GIAVNSLGH+HP+L+  +  QS+KL
Sbjct: 2   SYLAKNYNRKKISFKYGKGSFLYSTDGKKYLDFVQGIAVNSLGHAHPKLINTVHKQSKKL 61

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WHVSN +Q  + E+ A  L   TFAD V F NSGAE+ E AIK ARRY Y  GK  K RI
Sbjct: 62  WHVSNAFQIPEGELLAKKLAKKTFADYVMFQNSGAEATEAAIKVARRYFYSIGKPKKNRI 121

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           +  + +FHGRT+A I A G  +  EGFGPK+ GFD  +F +  SLK +IS +TAAI+IE 
Sbjct: 122 LCVKNSFHGRTIAAIYASGSKKMTEGFGPKVSGFDHFEFGNHSSLKKKISKNTAAIMIET 181

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           I GEGG++ VP+  L +LRKICD  + LLI DEVQ G GR+G  FA+E + VKPDI+ IA
Sbjct: 182 IMGEGGIKVVPDWCLIELRKICDKKNILLILDEVQCGIGRSGDFFAFEKSKVKPDIVPIA 241

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           KG+GGGFPIGA L   +VA+ M  G+HGST+GGN LAM +G  VL+II +  FL+NV  I
Sbjct: 242 KGIGGGFPIGAVLMNKKVASGMIGGTHGSTFGGNPLAMSVGNTVLDIIHNKKFLDNVKKI 301

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
           +K     L  IK ++PN+  E+RG+GLLIG++          K  D  LLT  +++NVVR
Sbjct: 302 SKYFLLNLNFIKEKYPNVINEIRGKGLLIGIQLKADQTKFIKKLMDNRLLTIRAAENVVR 361

Query: 365 ILPPLTITAEEIHEGLERIERTAIKLS 391
           +LPPL +   EI++ L+ I +   +++
Sbjct: 362 VLPPLNVKKSEINQALKIINKVCWEMN 388


>gi|297172480|gb|ADI23452.1| ornithine/acetylornithine aminotransferase [uncultured nuHF1
           cluster bacterium HF0770_35I22]
          Length = 391

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/380 (49%), Positives = 263/380 (69%), Gaps = 2/380 (0%)

Query: 10  TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN 69
           TY + +    KG+GA+++   G  +LDF SGIAVNS+GH HP LV  L+ Q+E  WH SN
Sbjct: 8   TYGRYNFALVKGEGAYVYDAKGHRYLDFGSGIAVNSVGHCHPHLVKTLQRQAETFWHCSN 67

Query: 70  LYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
           LY    Q+  A+ LI ++F   VFF NSGAE+ E ++K ARR+    G T +FR +T EG
Sbjct: 68  LYYIPNQDKLADRLIENSFPGAVFFNNSGAEATELSVKVARRFQSSLGFTKRFRTITIEG 127

Query: 130 AFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEG 189
           AFHGR+LA ++AG + ++L+GFGP +EGFDQ KF +L S++  I+++TAA+++EPIQGEG
Sbjct: 128 AFHGRSLAMLAAGKQEKHLKGFGPIVEGFDQVKFGNLTSVERAITDETAAVIVEPIQGEG 187

Query: 190 GVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGG 249
           GVR +   FL+ LR++CD    LLI DEVQ+G GRTGKLFAY+ A + PDIM +AKG+GG
Sbjct: 188 GVRSMDSSFLKGLRQLCDKTGILLIVDEVQSGVGRTGKLFAYQHAGITPDIMALAKGLGG 247

Query: 250 GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILF 309
           GFPIGAC+A +++A  M  GSHGST+GGN LA  + + VL++I + GFLENV  ++ +LF
Sbjct: 248 GFPIGACIARSDIALSMGAGSHGSTFGGNPLATAVADAVLDVILAPGFLENVKRVSSLLF 307

Query: 310 EGLTAIKNRFPNMFLEVRGQGLLIGLKTV--FSPALLAAKFRDECLLTAPSSDNVVRILP 367
           + L  + ++   +F EVRG GL+IGLK        ++     +  LLT P+ DNVVR++P
Sbjct: 308 KKLEVLISQNNEVFSEVRGVGLMIGLKCQENVENGVVVNSLMENGLLTVPAGDNVVRLIP 367

Query: 368 PLTITAEEIHEGLERIERTA 387
           PL I  E++ E +  +  T+
Sbjct: 368 PLIIDDEQVSEAINILHETS 387


>gi|99080506|ref|YP_612660.1| acetylornithine transaminase protein [Ruegeria sp. TM1040]
 gi|99036786|gb|ABF63398.1| acetylornithine aminotransferase [Ruegeria sp. TM1040]
          Length = 391

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/378 (49%), Positives = 257/378 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+G+WL   +G  FLD  SGIAVN+LGH+HP LV  L +Q++ LWH
Sbjct: 5   VLPTYNRAPLNFVKGEGSWLIEADGRRFLDLGSGIAVNALGHAHPALVEALTAQAQNLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  QQ+  A+ L+  +FAD VFFTNSG ES E A+K AR+YHY  G   K  I+T
Sbjct: 65  VSNLYEIPQQQALADKLVAESFADTVFFTNSGTESCELAVKMARKYHYEKGHPEKVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEG+FHGR+ A I+A G  +  +GFGP + GF    + D Q++   I + TAAIL+EP+Q
Sbjct: 125 FEGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFVHLPWGDAQAVAAAIDDKTAAILVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P++ L+ LR +CD+   LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 185 GEGGIRPMPDQDLKDLRALCDEHGLLLILDEVQCGVGRTGKLFAHEWAGIAPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LA+ E A+ M  G+HGSTYGGN L   +G  V++ + +  FL  V   A 
Sbjct: 245 IGGGFPLGAVLASEEAASGMTAGTHGSTYGGNPLGCAVGCAVMDHVAAPDFLSEVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +    P++F EVRG GL++GLK     A +     D  ++T P++DNV+R+L
Sbjct: 305 LLRQKLEGLVASHPDVFEEVRGSGLMLGLKCRAVNAEVVKAGYDAEVITVPAADNVIRLL 364

Query: 367 PPLTITAEEIHEGLERIE 384
           P LTIT  +I E + R++
Sbjct: 365 PALTITDADIEEAITRLD 382


>gi|146279135|ref|YP_001169294.1| acetylornithine transaminase protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557376|gb|ABP71989.1| acetylornithine aminotransferase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 393

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/379 (49%), Positives = 254/379 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F  G+G+WL +E G  +LD  +GIAVN+LGH+HP LV  L +Q+ +LWH
Sbjct: 5   VLPTYNRAPLAFVTGEGSWLTAEEGSRYLDLGAGIAVNALGHAHPALVETLSAQAGRLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  +QE  A  L+ +TFAD VFFTNSG E+ E AIK  R+Y    G+ ++  I+ 
Sbjct: 65  VSNLYRIPEQERLAEKLVEATFADTVFFTNSGTEAAELAIKMVRKYWSAKGQPDRIEILC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGR+   I+A G  +  +G+GP + GF Q  F D ++L+  IS+ TAA++IEP+Q
Sbjct: 125 FEGAFHGRSTGAIAAAGSEKMTKGYGPLMPGFRQLPFGDHEALRAAISDKTAAVMIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P+  L+ LR  CD + ALL+FDEVQ G GRTGKLFA+EWA ++PDIM +AKG
Sbjct: 185 GEGGIRVLPDVCLKGLRDACDSVGALLVFDEVQCGMGRTGKLFAHEWAGIEPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LA  E AA M  G+HGSTYGGN L   +G KV+ II    FL  V     
Sbjct: 245 IGGGFPLGAVLAKEEAAAPMTVGTHGSTYGGNPLGCAVGAKVMEIIADPAFLAEVNRKGA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L  +    P +F EVRG GL++GLK       L      + LLT P++DNVVR+L
Sbjct: 305 LFRQKLEGLVAAHPQIFEEVRGAGLMLGLKCRAPNTDLVQAAYGQHLLTVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIER 385
           P LTI  E+I E + R++R
Sbjct: 365 PALTIPDEDIAEAVARLDR 383


>gi|329890976|ref|ZP_08269319.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Brevundimonas diminuta ATCC 11568]
 gi|328846277|gb|EGF95841.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Brevundimonas diminuta ATCC 11568]
          Length = 391

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/381 (49%), Positives = 258/381 (67%), Gaps = 2/381 (0%)

Query: 8   FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV 67
              Y+++ +  E+G+G  L+S +G  +LD  SGI+ N+LGH+HP+LV  +K Q+EKLWHV
Sbjct: 1   MGVYNRAPLEVERGQGVRLWSTDGTEYLDCVSGISTNALGHAHPKLVQAVKDQAEKLWHV 60

Query: 68  SNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTF 127
           SN+++   Q+  A+ L   +FAD VFFTNSG E++ECA+KTAR++H   G+  +  I  F
Sbjct: 61  SNIFKIPGQDALADSLCEKSFADVVFFTNSGTEAIECALKTARKFHVANGQPERIDIYGF 120

Query: 128 EGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-DTAAILIEPIQ 186
           +G+FHGRT   I+A     Y EGFGPK+EGF Q K+ D  +L     N +TAAI++EP+Q
Sbjct: 121 DGSFHGRTYGAINAAANPSYTEGFGPKMEGFHQLKWGDKAALTAAFENPNTAAIILEPVQ 180

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG R  P+  L+ +R++ D    L+IFDEVQ G GRTGKL+A+EWA + PDIM IAK 
Sbjct: 181 GEGGCRATPDADLRWMREMADKYGVLIIFDEVQCGMGRTGKLWAHEWAGMTPDIMAIAKA 240

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT E A  M  G HGST+GGN LAM +G+   + + SD  L+NV  +A 
Sbjct: 241 LGGGFPIGACLATAEAAKGMTVGVHGSTFGGNPLAMAVGQAAFDEVSSDAILDNVNEVAG 300

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC-LLTAPSSDNVVRI 365
            L + L  +K RFP++ +EVRG+GLL+G+K V +        RDE  LL A   DN+VR+
Sbjct: 301 YLTQQLHGLKERFPDVIVEVRGKGLLLGVKLVPNNREFMGWARDEARLLVAGGGDNLVRV 360

Query: 366 LPPLTITAEEIHEGLERIERT 386
           LPPL IT +E  E +E+ E+ 
Sbjct: 361 LPPLNITLDEAREAIEKFEKA 381


>gi|167041257|gb|ABZ06013.1| putative aminotransferase class-III [uncultured marine
           microorganism HF4000_005D21]
 gi|167045761|gb|ABZ10407.1| putative aminotransferase class-III [uncultured marine bacterium
           HF4000_APKG3108]
          Length = 388

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 260/385 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY + DI F++GKG+++F+ENG  +LDF  GIAVN LGH H  LV  +K QSEKLWH
Sbjct: 4   ILGTYARKDISFKEGKGSYVFAENGDKYLDFVQGIAVNVLGHCHEHLVKAIKEQSEKLWH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN +   +QE  A  L  +TFAD   F NSG E+ E +IK  R+Y +  GK  K RI+T
Sbjct: 64  VSNSFVILEQERLAKRLTDNTFADFCMFQNSGTEATEASIKITRKYFHKIGKPEKNRIIT 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+GAFHGRTLA + A    ++ EGFGPK++GFDQ  F D +++K  I+ +TAAIL+E IQ
Sbjct: 124 FQGAFHGRTLAALFAANNPKHTEGFGPKVDGFDQVPFADHEAIKKIINKNTAAILLETIQ 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG++ VP+  L+ LR++CD+ + LLI DEVQ G GRTG  FA+E + + PDI+ IAKG
Sbjct: 184 GEGGIKVVPDVCLKGLREVCDEHNLLLILDEVQCGVGRTGNFFAFEKSGIVPDIVPIAKG 243

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACL T +V+  M  G+HGST+GGN LAM +G  VL+II    FLENV    K
Sbjct: 244 IGGGFPLGACLVTKKVSVGMTPGTHGSTFGGNPLAMSVGNAVLDIIFGKDFLENVKQKGK 303

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
              +GL  +K+++P +  E+RG GL+ GLK +        K  +  +L   + +NV R+ 
Sbjct: 304 YFDQGLNKMKDKYPKIIAEIRGTGLIKGLKMIVDNTEFIKKLMNHKMLAIKAEENVTRLF 363

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL ++ +E+ E +E+I++   ++S
Sbjct: 364 PPLIVSNKELDEAIEKIDKVCKEMS 388


>gi|83952796|ref|ZP_00961526.1| acetylornithine aminotransferase [Roseovarius nubinhibens ISM]
 gi|83835931|gb|EAP75230.1| acetylornithine aminotransferase [Roseovarius nubinhibens ISM]
          Length = 392

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/381 (48%), Positives = 254/381 (66%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+G+WL   +G  FLD  +GIAVN+LGH+HP+LVA L  Q+ KLWH
Sbjct: 5   ILPTYNRAPLSFVKGEGSWLIEADGRRFLDLGAGIAVNALGHAHPKLVAALTEQAGKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY    Q+  A+ L+  +FAD VFFTNSG ES E A+K AR+Y Y      +  I+ 
Sbjct: 65  TSNLYHIPAQQALADKLVEHSFADTVFFTNSGTESCELAVKMARKYWYEKNAPERVEIIA 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  +  +GFGP + GF    + DL+ LK  I + TAA+L+EP+Q
Sbjct: 125 FHGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFKHLDWGDLEGLKGAIDSRTAAVLLEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R + +  L+ LR+ICD+   LLIFDEVQ G GRTG+LFA+EWA V PDIM +AKG
Sbjct: 185 GEGGIRPMADHDLRALRQICDEAGILLIFDEVQCGMGRTGRLFAHEWAGVTPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A  M  GSHGSTYGGN LA  +G  V++ + + GFLE V   A 
Sbjct: 245 IGGGFPLGAVLATEAAAVAMTAGSHGSTYGGNPLACAVGCAVMDEVTAPGFLETVNTRAS 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L + L  +   +P +F E+RG GL++GLK V     +     +  L+T P+ DNV+R+L
Sbjct: 305 QLQQKLGGLVEAYPEVFAELRGSGLMLGLKCVAPNTDVLQACYEAGLITVPAGDNVIRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPLT++ +E+ E + R++  A
Sbjct: 365 PPLTLSEDEVTEAVSRLDHAA 385


>gi|89053515|ref|YP_508966.1| acetylornithine transaminase protein [Jannaschia sp. CCS1]
 gi|88863064|gb|ABD53941.1| acetylornithine aminotransferase apoenzyme [Jannaschia sp. CCS1]
          Length = 395

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/379 (49%), Positives = 252/379 (66%), Gaps = 1/379 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  +Y ++++ F KG+G+WL   +G  FLDFASGIAV SLGH HP++V+ L  Q+  LWH
Sbjct: 5   VLPSYSRANLSFVKGEGSWLVDADGRRFLDFASGIAVMSLGHGHPKVVSALMEQAHALWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+  QQ+  A  L+  TFAD VFF NSG E+ E AIK AR+Y    G  ++  I+T
Sbjct: 65  TSNLYEVPQQKALAERLVDHTFADTVFFCNSGTEAAELAIKMARKYRTETGSPDRMTILT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-DTAAILIEPI 185
           FEG+FHGR+   ISA G  +   GFGP + GF    F D  +L+   S  D  AI++EPI
Sbjct: 125 FEGSFHGRSTGAISAAGSEKLSAGFGPLLGGFKTLPFGDHDALRAAASAPDVGAIMVEPI 184

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+R VP++ L+ LR +CD+   LLIFDE+Q G GRTGKLFA+EWA + PDIM +AK
Sbjct: 185 QGEGGIRPVPDQCLKGLRDLCDEHGLLLIFDEIQCGVGRTGKLFAHEWAGIAPDIMLVAK 244

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+G GFPIGA LAT E A  M  G+HGSTYGGN L   +G  V+++I  DGFL++V   A
Sbjct: 245 GIGSGFPIGALLATEEAAQGMTAGTHGSTYGGNPLGCAVGTAVMDVITEDGFLDDVNAKA 304

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
             L + L  +    P +F  VRG GLL+GLK   +P  + A+     +LT P++DNVVR+
Sbjct: 305 GFLRQKLEGLVASHPTIFEGVRGAGLLLGLKCRIAPGDVVAEGYKHDVLTVPAADNVVRV 364

Query: 366 LPPLTITAEEIHEGLERIE 384
           LP LTI+ +EI  G+ R++
Sbjct: 365 LPALTISEDEISTGISRLD 383


>gi|332188912|ref|ZP_08390615.1| acetylornithine and succinylornithine aminotransferases family
           protein [Sphingomonas sp. S17]
 gi|332011052|gb|EGI53154.1| acetylornithine and succinylornithine aminotransferases family
           protein [Sphingomonas sp. S17]
          Length = 396

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 247/373 (66%), Gaps = 1/373 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+G +L+ ENG  +LDFA+GIAVN+LGH HP+LV  +  Q+  L H
Sbjct: 6   LMPVYPRCGVRPVRGEGVYLYGENGEQYLDFAAGIAVNALGHGHPKLVEAIAKQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY S Q E FA  L+ STFAD VFFTNSGAE+VECAIKTARRYH+  G   +  ++T
Sbjct: 66  VSNLYGSPQGEHFAQRLVDSTFADTVFFTNSGAEAVECAIKTARRYHFANGNPQRHTLIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRTL  ISA  + +  +GF P + GF  A F DL++    I ++TA  L+EPIQ
Sbjct: 126 FNNAFHGRTLGAISATNQPKMRDGFEPLLPGFAYAPFDDLEAALALIDDNTAGFLVEPIQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R    EFLQ LRK CD+   LL+ DEVQ GYGRTGK FA+E   V PDIM +AKG
Sbjct: 186 GEGGLRPARMEFLQGLRKACDEHGLLLVLDEVQCGYGRTGKFFAHELYGVTPDIMAVAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLA+ E A  M  G+HGSTYGGN LAM  GE VL++IQ  GFLE+V  + +
Sbjct: 246 IGGGFPLGACLASEEAAKGMVIGTHGSTYGGNPLAMAAGEAVLDVIQEPGFLEHVEAMGQ 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNVVRI 365
            L   L  +   F ++F EVRG GL+ GLK         A  RD   LL   + +NV+RI
Sbjct: 306 RLRSTLEQMIPNFDHLFEEVRGHGLMQGLKMKSDSRRFVAHCRDHHGLLLVAAGENVIRI 365

Query: 366 LPPLTITAEEIHE 378
           LPPLTI    I E
Sbjct: 366 LPPLTIDESHITE 378


>gi|149204777|ref|ZP_01881740.1| acetylornithine and succinylornithine aminotransferase [Roseovarius
           sp. TM1035]
 gi|149141746|gb|EDM29799.1| acetylornithine and succinylornithine aminotransferase [Roseovarius
           sp. TM1035]
          Length = 411

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 253/384 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+GAWL   +G  FLD  +GIAVNSLGH+HP+LVA L  Q+E LWH
Sbjct: 25  ILPTYNRAPLSFVKGEGAWLIEADGRRFLDLGAGIAVNSLGHAHPKLVAALTKQAEALWH 84

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLYQ   Q+  A+ L+ +TFAD VFFTNSG E+ E A+K AR++ Y AG+  +  I+ 
Sbjct: 85  TSNLYQIPAQQELADRLVAATFADTVFFTNSGTEACELAVKMARKHFYEAGQPERTDIIA 144

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEG+FHGR+ A I+A G  +  +GFGP + GF    + D   L   I + TAAILIEP+Q
Sbjct: 145 FEGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFKHVAWGDHDGLHAAIDDHTAAILIEPVQ 204

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P++ L+ LR +CD+   LLI DEVQ G GRTG+LFA+EWA V PDIM +AKG
Sbjct: 205 GEGGIRPLPDQCLKGLRALCDERGILLILDEVQCGVGRTGRLFAHEWAGVTPDIMMVAKG 264

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A+ M  G+HGSTYGGN L   +G  V++ I +  FL  V   A 
Sbjct: 265 IGGGFPLGAVLATEHAASGMTAGTHGSTYGGNPLGCAVGCAVMSEIATPEFLAEVNRKAA 324

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L + L  +    P +F  VRG GL++GLK     A +        + T P++DNV+R+L
Sbjct: 325 FLRQRLEGLVAAHPTVFEAVRGMGLMLGLKCKVPNAEVVQAGYAALVATVPAADNVLRLL 384

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPLTIT +EI E + R++  A  L
Sbjct: 385 PPLTITDDEIAEAVTRLDAAATAL 408


>gi|16124838|ref|NP_419402.1| succinylornithine transaminase [Caulobacter crescentus CB15]
 gi|221233557|ref|YP_002515993.1| acetylornithine aminotransferase/succinyldiaminopimelate
           aminotransferase [Caulobacter crescentus NA1000]
 gi|41016922|sp|Q9AAL3|ASTC_CAUCR RecName: Full=Succinylornithine transaminase; AltName: Full=Carbon
           starvation protein C; AltName: Full=Succinylornithine
           aminotransferase
 gi|13421782|gb|AAK22570.1| succinylornithine transaminase, putative [Caulobacter crescentus
           CB15]
 gi|220962729|gb|ACL94085.1| acetylornithine aminotransferase/succinyldiaminopimelate
           aminotransferase [Caulobacter crescentus NA1000]
          Length = 392

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/381 (49%), Positives = 252/381 (66%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L NTY +++I   +G+G WL+ ++G  +LD A+G+AVN+LGH  P LV  LK+Q++ LWH
Sbjct: 4   LMNTYARANIDIVRGEGCWLYDQDGRDYLDLAAGVAVNTLGHGDPRLVQALKTQADILWH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+   QE  A  L  +TFADRVFF NSGAE+VE AIKTARR+    G+  ++R++T
Sbjct: 64  ASNLYRLPAQEALATKLTDATFADRVFFANSGAEAVEAAIKTARRWQGAKGRPERYRVLT 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRTLATISA  +++  EGF P  + FD   F D++     I+  TAAIL+EPIQ
Sbjct: 124 FGNAFHGRTLATISATDQMKVREGFTPLYDAFDTTPFNDIEGAARAITPQTAAILVEPIQ 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+      FL  LR +CD  D LLI DEVQTG GRTG LFA+E   V+PDI+ +AKG
Sbjct: 184 GEGGLTPATPGFLAGLRALCDQHDLLLILDEVQTGIGRTGHLFAHELYGVRPDIIAVAKG 243

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT + A+ M  GSHGSTYGGN LA  +   VL+ + + GFLE V   A 
Sbjct: 244 LGGGFPIGACLATEDAASGMTPGSHGSTYGGNPLACAVASAVLDAVLAPGFLETVRERAA 303

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++   L  +  R  ++F+  +G GL+ GL+   S   + A  RD  ++T  +  +VVR+L
Sbjct: 304 LVDALLERLLRRHSDLFVRAQGHGLMRGLQVRASARDVVAHLRDFGVMTVAAGADVVRLL 363

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPLTI+  EI E   R+ R A
Sbjct: 364 PPLTISELEIAEAEARLLRAA 384


>gi|209965757|ref|YP_002298672.1| acetylornithine and succinylornithine aminotransferase
           [Rhodospirillum centenum SW]
 gi|209959223|gb|ACI99859.1| acetylornithine and succinylornithine aminotransferase
           [Rhodospirillum centenum SW]
          Length = 396

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 254/385 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY + D+ FE+G+G++L+   G  +LDF SGIAVN+LGH+HP LV  L  Q+ +LWH
Sbjct: 5   VMPTYARIDVIFERGEGSYLWDTEGRRYLDFTSGIAVNALGHAHPYLVQKLTEQAHRLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL++   QE  A  L   TFAD VFFTNSG E+ ECA+KT R+YH+  G   + R + 
Sbjct: 65  TSNLFRVAGQESLARRLTALTFADTVFFTNSGVEAWECAVKTVRKYHHETGNPQRTRFIV 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
             GAFHGRT   I+A    + ++GFGP ++ FDQ  F +L  L+  I+ +T AI++EPI 
Sbjct: 125 AGGAFHGRTTTAIAAAKSEKMVKGFGPLLDAFDQVAFNNLNELRAAITPETGAIMVEPIL 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+     ++L+ LR+  D+   LL+FDE+QTG GRTG+LFA+EWA+V PD+M IAKG
Sbjct: 185 GEGGIIPADLDYLRALRRTADEFGLLLVFDEIQTGVGRTGRLFAHEWADVAPDVMCIAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G+HGST+GGN LAM +G  VL+++ + GFLE V     
Sbjct: 245 IGGGFPMGACLATEKAAVGMTAGTHGSTFGGNPLAMAVGNAVLDVVTAPGFLERVEETGS 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L   L A+  R P +    RG+GL++GL+ V   A L  + R   LL   ++DN +RIL
Sbjct: 305 LLRTRLEALVERHPTVLETARGRGLMLGLRCVVPNADLVTRLRLNGLLVVGAADNAIRIL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL +   EI E +  ++RT  +L+
Sbjct: 365 PPLIVGETEIDEAVAILDRTCRELA 389


>gi|259419289|ref|ZP_05743206.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Silicibacter sp. TrichCH4B]
 gi|259345511|gb|EEW57365.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Silicibacter sp. TrichCH4B]
          Length = 391

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/378 (48%), Positives = 257/378 (67%), Gaps = 2/378 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+G+WL   +G  FLD  SGIAVN+LGH+HP LV  L SQ++ LWH
Sbjct: 5   VLPTYNRAPLNFVKGEGSWLIEADGRRFLDLGSGIAVNALGHAHPALVEALTSQAQNLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  QQ+  A+ L+  TFAD VFFTNSG E+ E A+K AR+YH+  G   K  I+T
Sbjct: 65  VSNLYEIPQQQALADKLVAETFADTVFFTNSGTEACELAVKMARKYHFEKGTPEKVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEG+FHGR+ A I+A G  +  +GFGP + GF    + D Q++   I  +TAAIL+EP+Q
Sbjct: 125 FEGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFVHLPWGDAQAVAAAIDENTAAILVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P++ L+ LR +CD+   LLI DEVQ G GRTGKLFA+EWA + PDIM +AKG
Sbjct: 185 GEGGIRPMPDQDLKDLRALCDEHGILLILDEVQCGVGRTGKLFAHEWAGITPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A+ M  G+HGSTYGGN L   +G  V++ + +  FL  V   A 
Sbjct: 245 IGGGFPLGAVLATENAASGMTAGTHGSTYGGNPLGCAVGCAVMDHVAAPEFLAEVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT-VFSPALLAAKFRDECLLTAPSSDNVVRI 365
           +L + L  +    P +F EVRG GL++GLK    +  ++ A +  E ++T P++DNV+R+
Sbjct: 305 LLRQKLEGLVASHPEVFEEVRGSGLMLGLKCKAVNAEVVKAGYAAE-VITVPAADNVIRL 363

Query: 366 LPPLTITAEEIHEGLERI 383
           LP LTI+  +I E + R+
Sbjct: 364 LPALTISDADIEEAISRL 381


>gi|254293918|ref|YP_003059941.1| acetylornithine and succinylornithine aminotransferase [Hirschia
           baltica ATCC 49814]
 gi|254042449|gb|ACT59244.1| acetylornithine and succinylornithine aminotransferase [Hirschia
           baltica ATCC 49814]
          Length = 401

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/391 (46%), Positives = 263/391 (67%), Gaps = 1/391 (0%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M +   +F TY    I+FE+G+G  L+      +LDF SGI+VN+LGH+HP+L+  L++Q
Sbjct: 1   MQRRSHIFPTYAPPAIQFERGEGVRLWDTERREYLDFISGISVNTLGHAHPDLIKSLENQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++KLWH+SN++    Q   A+     +FADR+FF NSGAE+VECA+K ARRYH+  G+ +
Sbjct: 61  AQKLWHLSNMFDVPGQSELADRYCELSFADRIFFANSGAEAVECALKAARRYHFEKGEPD 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +  I+ F+GAFHGRT ATI+A G   YL+GFGP + G+ +  F D+ + +N +S+ TAA+
Sbjct: 121 RIEIIGFDGAFHGRTYATINAAGNPNYLKGFGPALPGYTKLPFGDMNAFQNALSDKTAAV 180

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA-NVKPD 239
           +IEP+QGEGG+R VP   L  +RK+C +  ALLI+DEVQ G GRTGKLFA+EWA +  PD
Sbjct: 181 IIEPVQGEGGLRPVPLADLTLMRKLCTEAGALLIYDEVQCGAGRTGKLFAHEWAQDATPD 240

Query: 240 IMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE 299
           +M  AKG+GGGFP+G   +T EVA  M  G+HG+TYGGN LA+ +G  VL+ I    FL 
Sbjct: 241 LMATAKGVGGGFPLGMTFSTEEVAQYMVPGTHGTTYGGNALAVAVGHAVLDHISKPNFLR 300

Query: 300 NVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSS 359
           +V  +++ + +G  AIK+   +  ++VRG+GLLIG K   S   +    RD  LL   + 
Sbjct: 301 HVETVSEQIRDGFEAIKSEVSDSIVDVRGKGLLIGAKLAVSNIAVRDATRDLGLLIGVAG 360

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           DNVVR+ P L +++ ++ E + R+ +  I +
Sbjct: 361 DNVVRLAPALNVSSVDVEEAINRLRKALISV 391


>gi|254462243|ref|ZP_05075659.1| acetylornithine aminotransferase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678832|gb|EDZ43319.1| acetylornithine aminotransferase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 391

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/385 (48%), Positives = 260/385 (67%), Gaps = 2/385 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+G+WL   +G  FLD  +GIAVN+LGH+HP LVA L  Q+  LWH
Sbjct: 5   VLPTYSRAPMSFVKGEGSWLIEADGRRFLDLGAGIAVNALGHAHPTLVAALTDQANALWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLYQ  QQ+  A+ L+  TFAD VFFTNSG ES E A+K AR+Y Y  G   +  I+T
Sbjct: 65  VSNLYQIPQQQKLADMLVELTFADTVFFTNSGTESCELAVKMARKYWYEKGVPERVEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEG+FHGR+ A I+A G  +  +GFGP + GF    + D ++L   I++ TAAI+IEP+Q
Sbjct: 125 FEGSFHGRSSAGIAAAGSEKMTKGFGPLLGGFRHLPWNDHKALTTAITDQTAAIMIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P++ L+ LR +CD+   LLI DEVQ G GRTGKLFA+EWA ++PDIM +AKG
Sbjct: 185 GEGGIRPLPDQCLKGLRDLCDEHGILLILDEVQCGVGRTGKLFAHEWAGIEPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A+ M  G+HGSTYGGN L   +G  VL  +    FL +V   A 
Sbjct: 245 IGGGFPLGAVLATENAASGMTAGTHGSTYGGNPLGCAVGCAVLETVAEPDFLADVSRRAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT-VFSPALLAAKFRDECLLTAPSSDNVVRI 365
            L + L  +  + P++F  VRG GL++GLK    +  ++ A F +E ++T P++DNVVR+
Sbjct: 305 ALRQSLEGLIAQHPDVFESVRGAGLMLGLKCKATNIDIVNAGFDNE-VITVPAADNVVRL 363

Query: 366 LPPLTITAEEIHEGLERIERTAIKL 390
           LP L IT ++I E ++R+   A ++
Sbjct: 364 LPALNITEDDISEAVKRLSSAASQI 388


>gi|159043350|ref|YP_001532144.1| acetylornithine transaminase protein [Dinoroseobacter shibae DFL
           12]
 gi|157911110|gb|ABV92543.1| acetylornithine and succinylornithine aminotransferase
           [Dinoroseobacter shibae DFL 12]
          Length = 393

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/374 (49%), Positives = 257/374 (68%), Gaps = 4/374 (1%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+GAWL   +G  FLD  +GIAVN+LGH+HP LVA L  Q++ LWH
Sbjct: 5   ILPTYNRAPLSFVKGEGAWLIEADGRRFLDLGAGIAVNALGHAHPRLVAALTDQAQALWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLYQ   Q+  A  L+  TFAD VFFTNSG ES E A+K  R++ + AG+  +  I+T
Sbjct: 65  VSNLYQIPAQQKLAEMLVAETFADTVFFTNSGTESCELAVKMVRKHFHDAGQPERVEILT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEG+FHGR+ A I+A G  +  +GFGP + GF    F + ++L++ +++ TAAI++EP+Q
Sbjct: 125 FEGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFRHLPFGNHEALQSAVNDRTAAIMVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P+  L+ LR +CD    L+I DEVQ G GRTG+LFA+EWA V PDIM +AKG
Sbjct: 185 GEGGIRALPDACLKGLRDLCDQHGILMILDEVQCGVGRTGRLFAHEWAGVSPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT + A+ M  G+HGSTYGGN L   +G  VL  + +DGFLE V   A 
Sbjct: 245 IGGGFPLGAVLATADAASGMTAGTHGSTYGGNPLGCAVGCAVLETVCADGFLEEVRRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP--ALLAAKFRDECLLTAPSSDNVVR 364
           ++ + L  +   FP +F EVRG GL++GL    +P   ++ A +  E +L  P+++NVVR
Sbjct: 305 LMRQALEGLVAEFPGVFAEVRGAGLMLGL-VCRAPNTDVVQAGYGAE-VLVVPAAENVVR 362

Query: 365 ILPPLTITAEEIHE 378
           +LPPLTIT  EI E
Sbjct: 363 LLPPLTITDAEIRE 376


>gi|126731532|ref|ZP_01747338.1| acetylornithine aminotransferase [Sagittula stellata E-37]
 gi|126708068|gb|EBA07128.1| acetylornithine aminotransferase [Sagittula stellata E-37]
          Length = 393

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/383 (50%), Positives = 259/383 (67%), Gaps = 2/383 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+GAWL  E+G  FLD  SGIAVN+LGH++P+L A L  Q+ KLWH
Sbjct: 5   VLPTYNRAPLHFVKGEGAWLIEEDGRRFLDLGSGIAVNALGHANPDLTAALTEQASKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  QQ+  A  L+  TFAD VFFTNSG E+ E A+K AR+Y Y  G+  K  I+T
Sbjct: 65  VSNLYEIPQQQALAGKLVEVTFADTVFFTNSGTEACELAVKMARKYWYEKGEKEKIEILT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G FHGR+ A I+A G  + ++GFGP ++GF    + D  +L   I++ TAAILIEP+Q
Sbjct: 125 FSGCFHGRSSAAIAASGSEKMVKGFGPVLDGFVHLDWGDHDALNEAITDRTAAILIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P++ L+ LRK+CD+   LLI DEVQ G GRTG+LFA+EWA V PDIM +AKG
Sbjct: 185 GEGGIRPLPDQCLKGLRKLCDEKGILLILDEVQCGVGRTGRLFAHEWAGVTPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E A+ M  G+HGSTYGGN L   +G+ V++ I    FL++V   A 
Sbjct: 245 IGGGFPLGAVLATEEAASGMVAGTHGSTYGGNPLGCAVGKAVIDRISDPAFLDSVNASAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC--LLTAPSSDNVVR 364
           +L + L  +    P+ F EVRG GL++GLK     A            ++T P++DNVVR
Sbjct: 305 LLRQKLEGLVAAHPDTFEEVRGMGLMLGLKCTPKAAAADVVKAGYAAEVITVPAADNVVR 364

Query: 365 ILPPLTITAEEIHEGLERIERTA 387
           +LPPL IT  EI E L R+++ A
Sbjct: 365 LLPPLNITEAEIAEALARLDKAA 387


>gi|77462555|ref|YP_352059.1| acetylornithine transaminase protein [Rhodobacter sphaeroides
           2.4.1]
 gi|77386973|gb|ABA78158.1| acetylornithine aminotransferase [Rhodobacter sphaeroides 2.4.1]
          Length = 393

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/381 (48%), Positives = 256/381 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F  G+G+WL +E+G  +LD  +GIAVN+LGH++P LV ++ +Q+ KLWH
Sbjct: 5   VLPTYNRAPLAFVAGEGSWLTAEDGSRYLDLGAGIAVNALGHANPALVEVISAQAAKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  +QE  A  L+ +TFAD VFFTNSG E+ E +IK  R+Y    G+ ++  I+ 
Sbjct: 65  VSNLYRIPEQERLAEKLVEATFADTVFFTNSGTEAAELSIKMVRKYWSEKGQPDRIEILC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGR+   I+A G  +  +G+GP + GF Q  F D ++L+  IS  TAA+++EP+Q
Sbjct: 125 FEGAFHGRSTGAIAAAGSEKMTKGYGPLMPGFRQLPFGDHEALRAAISEKTAAVMLEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P+  L+ LR  CD + ALL+FDEVQ G GRTG+LFA+EWA ++PDIM +AKG
Sbjct: 185 GEGGIRVLPDVCLKGLRDACDAVGALLVFDEVQCGMGRTGRLFAHEWAGIEPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LA    AA M  G+HGSTYGGN L   +G KV+ I+    FL  V   A 
Sbjct: 245 IGGGFPLGAVLAKKAAAAAMTAGTHGSTYGGNPLGCAVGAKVMEIVADPAFLAEVNRKAA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L  +    P +F EVRG GL++GLK     A L      + LLT P++DNVVR+L
Sbjct: 305 LFRQKLEGLVAAHPQVFEEVRGAGLMLGLKCRAPNADLVKAAYGQHLLTVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           P L I  E+I E + R++R A
Sbjct: 365 PALNIPDEDIAEAVARLDRAA 385


>gi|84514443|ref|ZP_01001807.1| acetylornithine aminotransferase [Loktanella vestfoldensis SKA53]
 gi|84511494|gb|EAQ07947.1| acetylornithine aminotransferase [Loktanella vestfoldensis SKA53]
          Length = 394

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/385 (47%), Positives = 254/385 (65%), Gaps = 1/385 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F  G GAWL   +G  FLD  +GIAVN+LGH+HP LVA L +Q++ LWH
Sbjct: 5   VLPTYSRAPLTFTSGSGAWLTEADGRRFLDLGAGIAVNALGHAHPALVAALTAQAQSLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY    Q+  A+ L+  TFAD VFFTNSG E+ E A+K AR+Y Y  G+ ++  I+T
Sbjct: 65  VSNLYHIPAQQKLADLLVEHTFADTVFFTNSGTEACELAVKMARKYWYDKGQPDRTEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT-AAILIEPI 185
           F G+FHGR+ A I+A G  +  +GFGP + GF    F D  +L    + D  AAI++EP+
Sbjct: 125 FTGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFTHLDFGDHDALTLAAARDNIAAIMVEPV 184

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+R +P+  L+ LR +CD    L+I DEVQ G GRTGKLFA+EWA + PDIM +AK
Sbjct: 185 QGEGGIRPLPDVCLKGLRDLCDRHGILMILDEVQCGMGRTGKLFAHEWAGITPDIMMVAK 244

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GA LA    A+ M+ G+HGSTYGGN LA  +G  V+ I+    FL  V   A
Sbjct: 245 GIGGGFPLGAVLANENAASGMSAGTHGSTYGGNPLACAVGCAVMEIVADPAFLAEVNRKA 304

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
            +L + L  +    P++F+ VRG GL++GLK   +   +     D+ +LT P++DNV+R+
Sbjct: 305 GLLRQKLEGLVAAHPDVFVAVRGSGLMLGLKCKATNTDIVKAGYDQGVLTVPAADNVIRL 364

Query: 366 LPPLTITAEEIHEGLERIERTAIKL 390
           LPPLTIT EEI + + R++  A+ +
Sbjct: 365 LPPLTITDEEIGQAVARLDAVALHM 389


>gi|329114398|ref|ZP_08243160.1| Acetylornithine aminotransferase [Acetobacter pomorum DM001]
 gi|326696474|gb|EGE48153.1| Acetylornithine aminotransferase [Acetobacter pomorum DM001]
          Length = 402

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/374 (47%), Positives = 255/374 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++D+ FE+G+G+WL + +G  FLDFA+GIA  S+GH+HP++V  + +Q+ K+ H
Sbjct: 5   LMPTYKRADLAFERGEGSWLQTSDGRRFLDFAAGIATCSIGHAHPKMVEAISTQAAKVMH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL+Q  Q E  A  L+  +FAD VFF NSGAE+ E  +K ARR   MAG   +  I+ 
Sbjct: 65  VSNLFQIPQAEKLARRLVEHSFADSVFFCNSGAEANEGMVKMARRAQMMAGHPERTDIIC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            +GAFHGRTLA +SA G  +YLEGFG  ++GF    F D++++K  I+ +TAA+++EPIQ
Sbjct: 125 MDGAFHGRTLAMLSATGNPKYLEGFGEPVKGFLHVPFNDIEAVKAAITPNTAAVMLEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE G++    E+LQ LR +CD+   LL+ DEVQ G GRTG+LFA+EWA +KPDI++ AKG
Sbjct: 185 GESGIKVASPEYLQALRALCDETGVLLVLDEVQCGVGRTGRLFAHEWAGIKPDIISTAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGA L T  +A  M  G+HG+T+GGN LA   G  VL++I + GFL+ V   A 
Sbjct: 245 LGGGFPIGAILTTETIAKAMTPGTHGTTFGGNPLACAAGNAVLDVILAPGFLDQVCARAA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L E L ++    P++F + RG GLLIGL+ V +   +    +D  LL   + DNV+R++
Sbjct: 305 LLDELLDSLVADAPDIFAQRRGLGLLIGLRCVPAVGDVQGAAQDAGLLCVTAGDNVLRLV 364

Query: 367 PPLTITAEEIHEGL 380
           PPLT++ EE  + +
Sbjct: 365 PPLTVSEEECRQAV 378


>gi|163797270|ref|ZP_02191224.1| Ornithine/acetylornithine aminotransferase [alpha proteobacterium
           BAL199]
 gi|159177565|gb|EDP62119.1| Ornithine/acetylornithine aminotransferase [alpha proteobacterium
           BAL199]
          Length = 394

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 258/386 (66%), Gaps = 1/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY + DI FE+G+G +LF+ +G  +LDFA+GIA NSLGH+HP LV  +  Q+ K+ H
Sbjct: 5   VMPTYGRIDIAFERGEGPYLFATDGRRYLDFAAGIATNSLGHAHPHLVKAISEQAAKVMH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  +QE  A+ L+ S+FAD VFF NSG E++E + K ARRYH+  G+ ++ RI+ 
Sbjct: 65  VSNLYRIPEQERLADRLVASSFADTVFFCNSGVEALEGSTKVARRYHFHNGEPHRTRIIC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
              +FHGRTL  +SA  K  Y EGFGP++EGF    F +L  ++  + +D AAIL+EPIQ
Sbjct: 125 CTHSFHGRTLGMLSATDKEAYREGFGPRVEGFSHVAFGNLNEMRAAVGDDAAAILVEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG      ++L+ LR+I D+   LLIFDEVQ G GRTGK++A+EWA++ PDI+  AKG
Sbjct: 185 GEGGANAASNDYLRALREIADEFGLLLIFDEVQCGAGRTGKMWAHEWADMAPDILATAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LA  + A+ M  G HG+T+GGN LAM     VL+++ + GFL+ V  IAK
Sbjct: 245 LGGGFPVGAVLANEKAASGMKPGLHGTTFGGNPLAMAAANAVLDVLLAPGFLDGVDRIAK 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNVVRI 365
           +L + L A+  R   +  EVRG GLL+GLK V     L    R+ + +L+  ++DNV+R+
Sbjct: 305 LLRQKLEAVVRRHSTVVEEVRGAGLLLGLKCVVPNGDLQTALREGQSMLSVGAADNVLRL 364

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPL I    + E ++ I+     L+
Sbjct: 365 LPPLIIDESHVDEAVKAIDAACAGLA 390


>gi|315497561|ref|YP_004086365.1| acetylornithine and succinylornithine aminotransferase
           [Asticcacaulis excentricus CB 48]
 gi|315415573|gb|ADU12214.1| acetylornithine and succinylornithine aminotransferase
           [Asticcacaulis excentricus CB 48]
          Length = 407

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/383 (48%), Positives = 257/383 (67%), Gaps = 1/383 (0%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           D LF  Y+++ +  E+G+G  L++ +G  F+D   G+A N LGH HP L+  +K+QSEKL
Sbjct: 11  DHLFGVYNRAAMEVERGEGVRLYARDGRVFIDLVQGVATNGLGHCHPRLIEAVKTQSEKL 70

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WHVSN+++   Q+  A  L   +FAD+VFFTNSG E+VECA+K AR+YH   G+  +  I
Sbjct: 71  WHVSNIFRIPDQQTLAARLCEDSFADQVFFTNSGTEAVECALKLARKYHDAKGQPERIDI 130

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAA-ILIE 183
           +TF GAFHGR+   ++AGG   YL GFGPK+ G+    F D ++LK   +  TAA IL+E
Sbjct: 131 ITFTGAFHGRSYGAVNAGGNDAYLAGFGPKLPGYVHLSFGDHEALKAAAAAPTAAAILVE 190

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG R+VPE+ L+ LR +CD    LL+FDE+Q G GR+GKL+A++W+ V+PD+M  
Sbjct: 191 PVQGEGGTRQVPEQCLRGLRDLCDQYGLLLMFDEIQCGMGRSGKLWAHQWSGVEPDVMMT 250

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGACLAT E A+ M  GSHGST+GGN LAM +G      + S   L++V  
Sbjct: 251 AKALGGGFPIGACLATKEAASGMVFGSHGSTFGGNPLAMAVGLVAYGELSSPEMLDHVNQ 310

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVV 363
           ++  L + L  +K  FP++  E+RG+GLL+G+K   S   + A  RD  LL A  SDN +
Sbjct: 311 VSGFLRQQLQGLKAAFPDIIDEIRGKGLLVGIKVKPSNRDVMALARDNGLLIAGGSDNCI 370

Query: 364 RILPPLTITAEEIHEGLERIERT 386
           R+LPPL +T EE  E L   E+T
Sbjct: 371 RLLPPLNLTIEEAREALALFEKT 393


>gi|332557440|ref|ZP_08411762.1| acetylornithine transaminase protein [Rhodobacter sphaeroides WS8N]
 gi|332275152|gb|EGJ20467.1| acetylornithine transaminase protein [Rhodobacter sphaeroides WS8N]
          Length = 393

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 257/381 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F  G+G+WL +E+G  +LD  +GIAVN+LGH++P LV ++ +Q+ KLWH
Sbjct: 5   VLPTYNRAPLAFVAGEGSWLTAEDGSRYLDLGAGIAVNALGHANPALVEVISAQAAKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  +QE  A  L+ +TFAD VFFTNSG E+ E +IK  R+Y    G+ ++  I+ 
Sbjct: 65  VSNLYRIPEQERLAEKLVEATFADTVFFTNSGTEAAELSIKMVRKYWSEKGQPDRIEILC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGR+   I+A G  +  +G+GP + GF Q  F D ++L+  IS  TAA+++EP+Q
Sbjct: 125 FEGAFHGRSTGAIAAAGSEKMTKGYGPLMPGFRQLPFGDHEALRAAISEKTAAVMLEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P+  L+ LR  CD + ALL+FDEVQ G GRTG+LFA+EWA ++PDIM +AKG
Sbjct: 185 GEGGIRVLPDVCLKGLRDACDAVGALLVFDEVQCGMGRTGRLFAHEWAGIEPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LA    AA M  G+HGSTYGGN L   +GEKV+ I+    FL  V   A 
Sbjct: 245 IGGGFPLGAVLAKEAAAAAMTAGTHGSTYGGNPLGCAVGEKVMEIVADPAFLAEVNRKAA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L  +    P +F EVRG GL++GLK     A L      + LLT P++DNVVR+L
Sbjct: 305 LFRQKLEGLVAAHPQVFEEVRGAGLMLGLKCRAPNADLVKAAYGQHLLTVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           P L I  E+I E + R++R A
Sbjct: 365 PALNIPDEDIAEAVARLDRAA 385


>gi|103486845|ref|YP_616406.1| acetylornithine transaminase protein [Sphingopyxis alaskensis
           RB2256]
 gi|98976922|gb|ABF53073.1| acetylornithine aminotransferase [Sphingopyxis alaskensis RB2256]
          Length = 395

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/382 (50%), Positives = 243/382 (63%), Gaps = 1/382 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+GA+L  E G  +LDFASGIAVN LGH HP L   ++ Q+  L H
Sbjct: 6   LMPVYPRCAVRPVRGEGAYLIGERGERYLDFASGIAVNLLGHGHPHLTRAIQDQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY S Q E FA  L+ +TFAD VFFTNSGAE+VECAIKTAR YH  AG   K  ++T
Sbjct: 66  VSNLYGSPQGEAFAQRLVDNTFADTVFFTNSGAEAVECAIKTARAYHSSAGNAEKHNLIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRTL TISA  + +  +GF P + GF  A F DL +  + + ++TA  LIEP+Q
Sbjct: 126 FNNAFHGRTLGTISATNQEKLRKGFDPLLPGFAYAPFDDLNAALDLVDDNTAGFLIEPVQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R   + FLQ LR IC++ D +LIFDEVQ G  RTG L+AYE   + PDIM  AKG
Sbjct: 186 GEGGIRPASQPFLQGLRDICNERDLMLIFDEVQCGVARTGTLYAYEQYGIAPDIMATAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G+HGSTYGGN LAM  G+ V ++I  DGFL+ V    +
Sbjct: 246 IGGGFPLGACLATEKAARGMVIGTHGSTYGGNPLAMAAGQAVFDVILEDGFLDQVKATGE 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNVVRI 365
            L   L  +      +F  VRG GL++G+K         A  RD   LLT  + DNVVRI
Sbjct: 306 RLRGALEQLIPNHDQLFESVRGMGLMLGVKMRSDSRAFVAHLRDNHGLLTVAAGDNVVRI 365

Query: 366 LPPLTITAEEIHEGLERIERTA 387
           LPPL I    I E +E++   A
Sbjct: 366 LPPLNIEQGHIDECIEKLSAGA 387


>gi|297183467|gb|ADI19598.1| ornithine/acetylornithine aminotransferase [uncultured SAR11
           cluster bacterium HF0770_37D02]
          Length = 387

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 254/385 (65%), Gaps = 1/385 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           + +TY +  I F KGKG++LF+ENG  +LDF  GIAVN LGH H  LV  ++ QS+KLWH
Sbjct: 4   VLDTYARKAISFTKGKGSYLFAENGDKYLDFVQGIAVNVLGHCHKHLVKTIQEQSKKLWH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN +   +QE  A  L  +TFAD V F NSG E+ E +IK AR+Y +  GK  K RI+T
Sbjct: 64  VSNTFIVPEQEKLAKRLTDNTFADFVCFQNSGTEATEASIKIARKYFHKIGKPEKNRIIT 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLA + A    ++ EGFGPK+EGFDQ  F D +++K  IS +TAAI+IE I 
Sbjct: 124 FEGAFHGRTLAALFAANNPKHTEGFGPKVEGFDQVPFADHEAVKKAISKNTAAIMIETIM 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG++ VP+  ++ L++IC++   LLI DEVQ  Y RTG  FA+E + V PDI+ IAKG
Sbjct: 184 GEGGIKVVPDVCIKGLKEICNEHGILLILDEVQCAY-RTGNFFAFEKSGVTPDIVPIAKG 242

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACL T +V+  M  G+HGST+GGN +A  +G  VL+II   GF   V    +
Sbjct: 243 IGGGFPLGACLVTKKVSIGMTPGTHGSTFGGNPMACSVGHAVLDIILEKGFFAKVKQKGQ 302

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
              EGL  IK ++P +  E+RG GL+ GLK +        K  +  +LT  +++NV+R  
Sbjct: 303 YFDEGLKKIKEKYPKIIGEIRGVGLIKGLKMLVDNDEFIKKLMNHKMLTIKAAENVIRFF 362

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPL +   E+ E +++IE+   ++S
Sbjct: 363 PPLIVNNNELDEAIDKIEKVCKEMS 387


>gi|258541825|ref|YP_003187258.1| acetylornithine/succinylornithine aminotransferase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632903|dbj|BAH98878.1| acetylornithine/succinylornithine aminotransferase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635960|dbj|BAI01929.1| acetylornithine/succinylornithine aminotransferase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639015|dbj|BAI04977.1| acetylornithine/succinylornithine aminotransferase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642069|dbj|BAI08024.1| acetylornithine/succinylornithine aminotransferase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645124|dbj|BAI11072.1| acetylornithine/succinylornithine aminotransferase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648179|dbj|BAI14120.1| acetylornithine/succinylornithine aminotransferase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651232|dbj|BAI17166.1| acetylornithine/succinylornithine aminotransferase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654223|dbj|BAI20150.1| acetylornithine/succinylornithine aminotransferase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 415

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 255/374 (68%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++D+ FE+G+G+WL + +G  FLDFA+GIA  S+GH+HP++V  + +Q+ K+ H
Sbjct: 18  LMPTYKRADLAFERGEGSWLQTSDGRRFLDFAAGIATCSIGHAHPKMVEAVSTQAAKVMH 77

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL+Q  Q E  A  L+ ++FAD  FF NSGAE+ E  +K ARR   MAG   +  I+ 
Sbjct: 78  VSNLFQIPQAEKLARRLVENSFADSAFFCNSGAEANEGMVKMARRAQMMAGHPERTDIIC 137

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            +GAFHGRTLA +SA G  +YLEGFG  ++GF    F D++++K  I+ +TAA+++EPIQ
Sbjct: 138 MDGAFHGRTLAMLSATGNPKYLEGFGEPVKGFLHVPFNDIEAVKAAITPNTAAVMLEPIQ 197

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE G++    E+L+ LR +CD+   LL  DEVQ G GRTG+LFA+EWA +KPDI++ AKG
Sbjct: 198 GESGIKVASPEYLRALRALCDETSVLLALDEVQCGVGRTGRLFAHEWAGIKPDIVSTAKG 257

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGA L T  +A  M  G+HG+T+GGN LA   G  VL++I + GFL+ V   A 
Sbjct: 258 LGGGFPIGAILTTETIAKSMTPGTHGTTFGGNPLACAAGNAVLDVILAPGFLDQVCTRAA 317

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L E L ++    P++F + RG GLLIGL+ V +   +    ++E LL   + DNV+R++
Sbjct: 318 LLDELLDSLVADAPDIFAQRRGLGLLIGLRCVPAVGDVQGAAQNEGLLCVTAGDNVLRLV 377

Query: 367 PPLTITAEEIHEGL 380
           PPLT++ EE  + +
Sbjct: 378 PPLTVSEEECRKAV 391


>gi|110678979|ref|YP_681986.1| acetylornithine transaminase protein [Roseobacter denitrificans OCh
           114]
 gi|109455095|gb|ABG31300.1| acetylornithine aminotransferase [Roseobacter denitrificans OCh
           114]
          Length = 391

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/385 (48%), Positives = 254/385 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY ++ + F KG+G+WL   +G  FLD A+GIAV +LGH+HP+LV  L  Q+E LWH
Sbjct: 5   LLPTYARAPLSFVKGEGSWLIEADGRCFLDLAAGIAVTALGHAHPKLVKALSDQAEALWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLYQ  QQ+  A+ L   TFAD VFFTNSG E+ E A+K AR+Y    G+  K +I+ 
Sbjct: 65  TSNLYQIPQQQDLADRLTDLTFADTVFFTNSGTEACELAVKMARKYWNDKGQPEKSQILA 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  +  +GFGP + GF    F D  +L       TAA++IEP+Q
Sbjct: 125 FSGSFHGRSAAGIAAAGSEKMTKGFGPLLPGFTHLDFGDHDALNAAFDETTAAVIIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP++ L+ LR +CD    LLIFDEVQ G  RTG+LFA+EWA V PDIM +AKG
Sbjct: 185 GEGGIRPVPDQCLKGLRDLCDTHGVLLIFDEVQCGVARTGRLFAHEWAGVTPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGA LAT E A+ M  G+HGSTYGGN L   +G  VL+ +    FL +V     
Sbjct: 245 IGGGFPIGAVLATEEAASGMTLGTHGSTYGGNPLGCAVGCAVLDHVADPAFLADVARKGA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ + L  +    P +F  VRG GL++G+K   + + + A   +E +LT P++DNVVR+L
Sbjct: 305 LMRQRLEGLVAEHPEVFDSVRGAGLMLGIKCRATNSDVVAAGYEELILTVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKLS 391
           PPLTI+ +EI E + R++  A ++S
Sbjct: 365 PPLTISDDEISEAIARLDAAARRVS 389


>gi|221638410|ref|YP_002524672.1| acetylornithine transaminase protein [Rhodobacter sphaeroides
           KD131]
 gi|221159191|gb|ACM00171.1| Acetylornithine aminotransferase [Rhodobacter sphaeroides KD131]
          Length = 393

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/381 (48%), Positives = 256/381 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F  G+G+WL +E+G  +LD  +GIAVN+LGH++P LV ++ +Q+ KLWH
Sbjct: 5   VLPTYNRAPLAFVAGEGSWLTAEDGSRYLDLGAGIAVNALGHANPALVEVISAQAAKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  +QE  A  L+ +TFAD VFFTNSG E+ E +IK  R+Y    G+ ++  I+ 
Sbjct: 65  VSNLYRIPEQERLAEKLVEATFADTVFFTNSGTEAAELSIKMVRKYWSEKGQPDRIEILC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGR+   I+A G  +  +G+GP + GF Q  F D ++L+  IS  TAA+++EP+Q
Sbjct: 125 FEGAFHGRSTGAIAAAGSEKMTKGYGPLMPGFRQLPFGDHEALRAAISEKTAAVMLEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P+  L+ LR  CD + ALL+FDEVQ G GRTG+LFA+EWA ++PDIM +AKG
Sbjct: 185 GEGGIRVLPDVCLKGLRDACDAVGALLVFDEVQCGMGRTGRLFAHEWAGIEPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LA    AA M  G+HGSTYGGN L   +G KV+ I+    FL  V   A 
Sbjct: 245 IGGGFPLGAVLAKEAAAAAMTAGTHGSTYGGNPLGCAVGAKVMEIVADPAFLAEVNRKAA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L  +    P +F EVRG GL++GLK     A L      + LLT P++DNVVR+L
Sbjct: 305 LFRQKLEGLVAAHPQVFEEVRGAGLMLGLKCRAPNADLVKAAYGQHLLTVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           P L I  E+I E + R++R A
Sbjct: 365 PALNIPDEDIAEAVARLDRAA 385


>gi|126461489|ref|YP_001042603.1| acetylornithine transaminase protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103153|gb|ABN75831.1| acetylornithine aminotransferase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 393

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/381 (48%), Positives = 256/381 (67%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F  G+G+WL +E+G  +LD  +GIAVN+LGH++P LV ++ +Q+ KLWH
Sbjct: 5   VLPTYNRAPLAFVAGEGSWLTAEDGSRYLDLGAGIAVNALGHANPALVEVISAQAAKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  +QE  A  L+ +TFAD VFFTNSG E+ E +IK  R+Y    G+ ++  I+ 
Sbjct: 65  VSNLYRIPEQERLAEKLVEATFADTVFFTNSGTEAAELSIKMVRKYWSEKGQPDRIEILC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGR+   I+A G  +  +G+GP + GF Q  F D ++L+  IS  TAA+++EP+Q
Sbjct: 125 FEGAFHGRSTGAIAAAGSEKMTKGYGPLMPGFRQLPFGDHEALRAAISEKTAAVMLEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P+  L+ LR  CD + ALL+FDEVQ G GRTG+LFA+EWA ++PDIM +AKG
Sbjct: 185 GEGGIRVLPDVCLKGLRDACDAVGALLVFDEVQCGMGRTGRLFAHEWAGIEPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LA    AA M  G+HGSTYGGN L   +G KV+ I+    FL  V   A 
Sbjct: 245 IGGGFPLGAVLAKEAAAAAMTAGTHGSTYGGNPLGCAVGAKVMEIVADPAFLAEVNRKAA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +  + L  +    P +F EVRG GL++GLK     A L      + LLT P++DNVVR+L
Sbjct: 305 LFRQKLEGLVAAHPQVFEEVRGAGLMLGLKCRAPNADLVKAAYGQHLLTVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           P L I  E+I E + R++R A
Sbjct: 365 PALNIPDEDIAEAVARLDRAA 385


>gi|126733282|ref|ZP_01749029.1| acetylornithine aminotransferase [Roseobacter sp. CCS2]
 gi|126716148|gb|EBA13012.1| acetylornithine aminotransferase [Roseobacter sp. CCS2]
          Length = 393

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 247/371 (66%), Gaps = 2/371 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F  G+G+WL   +G  FLD  +GIAVN+LGH+HP LVA L  Q+  LWH
Sbjct: 5   ILPTYSRAPLTFVSGEGSWLTEADGRRFLDLGAGIAVNALGHAHPALVAALSGQANALWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY    Q+  A+ L+  TFAD VFFTNSG E+ E A+K AR+Y Y   +  +  I+T
Sbjct: 65  VSNLYNIPAQQQLADALVDKTFADTVFFTNSGTEACELAVKMARKYWYDKDQPERTEIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  +  +GFGP + GF   +F D  +L+  +S+ TAAI++EP+Q
Sbjct: 125 FSGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFTHLEFGDHDALQAAVSDKTAAIMVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P+  L+ LR +CD    L+I DEVQ G GRTGKLFA+EWA V PDIM +AKG
Sbjct: 185 GEGGIRPLPDACLKGLRDLCDAHGILMILDEVQCGMGRTGKLFAHEWAGVTPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A+ M  G+HGSTYGGN LA  +G KV+ I+  D FL  V   A 
Sbjct: 245 IGGGFPLGAVLATQTAASGMTAGTHGSTYGGNPLACAVGAKVMEIVADDAFLSEVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT-VFSPALLAAKFRDECLLTAPSSDNVVRI 365
           ++ + L  +    P++F  VRG GL++GLK  V +   + A F  + +LT P++DNVVR+
Sbjct: 305 LMRQKLEGLVAAHPDVFEAVRGSGLMLGLKCKVANSDFVTAGFA-KGVLTVPAADNVVRL 363

Query: 366 LPPLTITAEEI 376
           LP L I  E+I
Sbjct: 364 LPALNIPDEDI 374


>gi|297182776|gb|ADI18930.1| ornithine/acetylornithine aminotransferase [uncultured SAR11
           cluster bacterium HF0010_09O16]
          Length = 388

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 247/387 (63%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
            +L   Y++  I F +GKG++L++  G  +LDF  GIAVN LGH+HP+L+  +K QS+KL
Sbjct: 2   SYLAKNYNRKKIAFARGKGSYLYTATGAKYLDFVQGIAVNCLGHAHPKLIQAIKKQSKKL 61

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WHVSN ++  + E  A  L+  TFAD V F NSG E  E  IK ARRY +  GK +K RI
Sbjct: 62  WHVSNAFEINESEELAKKLVKKTFADYVMFQNSGTECTELCIKLARRYFFSIGKPHKNRI 121

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           +   GAFHGRTLA I A G  +  EGF P + GFD   F   +SLK +I+ +TAAI+IEP
Sbjct: 122 LCVRGAFHGRTLAAIYASGSKKMTEGFLPAVSGFDHFTFGSHESLKKKITKNTAAIMIEP 181

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           I GEGG+R +P+  L+ LR++C++   LLI DE+QTG  RTGK FA+E A ++PDI  +A
Sbjct: 182 ILGEGGIRVIPDHCLKGLRQLCNEKKILLIVDEIQTGCARTGKFFAFEHAKIRPDITPVA 241

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           KG+ GG+PIGA L T +VA  +  G HGST+GG  L   +G  V++II    FL NV   
Sbjct: 242 KGLAGGYPIGAVLMTKKVAKAVKPGIHGSTFGGQPLQTKVGSVVMDIISKKSFLNNVTKN 301

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
           +K     L  +K ++P +  E+RG+GLLIG++     +    K  D  LLT  ++D+VVR
Sbjct: 302 SKYFLSNLNKLKEKYPKIIKEIRGRGLLIGIQLYKDQSNFIKKLMDNKLLTIRAADHVVR 361

Query: 365 ILPPLTITAEEIHEGLERIERTAIKLS 391
           ILPPL +  +EI + L+ I +   +L 
Sbjct: 362 ILPPLNVKKKEIDQALKIINKVCAELK 388


>gi|87201153|ref|YP_498410.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87136834|gb|ABD27576.1| acetylornithine aminotransferase apoenzyme [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 397

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/378 (49%), Positives = 246/378 (65%), Gaps = 1/378 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+   L SE+G  +LDFASGIAVN LGHS+  L+  ++ Q+  L H
Sbjct: 6   LMPVYPRCGVRPVRGEHCHLISEDGTRYLDFASGIAVNLLGHSNEHLIGAIQKQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY S Q E  A  L+  TFAD VFFTNSGAE+VECAIKTAR YH   G  +K+ ++T
Sbjct: 66  VSNLYGSPQGEHLAQRLVDLTFADTVFFTNSGAEAVECAIKTARAYHSSVGNDHKYELIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+ AFHGRT+ATISA  + +  +GF P +EGF    F DL+  K  +  +TA  L+EPIQ
Sbjct: 126 FKNAFHGRTMATISASKQEKMHKGFLPLLEGFKYVDFDDLEGAKAAMGPNTAGFLVEPIQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R   +EFL+ LR +CD+ D +LIFDEVQ G  RTG L+AYE   + PD+M  AKG
Sbjct: 186 GEGGIRDASDEFLKGLRALCDEHDLVLIFDEVQCGVARTGTLYAYEQYGITPDVMATAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGACLAT + A  M  G+HGSTYGGN LAM  GE VL+++ ++ FL  V    +
Sbjct: 246 IGGGFPIGACLATEKAARGMVAGTHGSTYGGNPLAMAAGEAVLDVVANEEFLGEVRAKGE 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNVVRI 365
            L   +      +P++F+ VRG+GL++GL     P    A  RD   LLT  + DN VR+
Sbjct: 306 RLRGRIEQFIGNYPDLFIGVRGRGLMLGLMMKVEPRPFVAHMRDNHQLLTVSAGDNTVRV 365

Query: 366 LPPLTITAEEIHEGLERI 383
           +PPL I    I E +ER+
Sbjct: 366 IPPLVIDDSHIDEFMERL 383


>gi|310816623|ref|YP_003964587.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Ketogulonicigenium vulgare Y25]
 gi|308755358|gb|ADO43287.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Ketogulonicigenium vulgare Y25]
          Length = 415

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 258/385 (67%), Gaps = 1/385 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + FE+G+G+WL + +G  +LDFA+GIAVN LGH++P LV  L +Q+ K+WH
Sbjct: 28  ILPTYNRAPLTFERGEGSWLITTDGDRYLDFAAGIAVNVLGHANPVLVEALTAQANKMWH 87

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY   +QE  A  L+  +FAD  FFTNSG E+ E A+K  R++    G+  +FRI+T
Sbjct: 88  VSNLYHIAEQEALAERLVEHSFADTCFFTNSGTEAAELAVKMVRKFWTTEGQPERFRILT 147

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SNDTAAILIEPI 185
           FEG+FHGR+ A I+A G  + ++GFGP + GF Q  + D+ +++  I ++D AA++ EP+
Sbjct: 148 FEGSFHGRSSAAIAAAGSEKMVKGFGPLLPGFTQLPWGDVAAIREHIFADDIAAVMFEPV 207

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
            GEGG+R VP+  L+ +R +CD+   LL+ DEVQ G GRTGKLFAYEWA + PDIM + K
Sbjct: 208 LGEGGIRPVPDADLKAIRALCDEAGVLLVLDEVQCGIGRTGKLFAYEWAGISPDIMMVGK 267

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GA LAT   A  M  GSHGSTYGGN LA  +G  V++++ +  FL  V   A
Sbjct: 268 GIGGGFPLGALLATENAAKGMTAGSHGSTYGGNPLACAVGNAVMDVVATPKFLGEVNRKA 327

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
            +L +GL A+    P++F EVRG GL++GLK       L        +LT  ++DNVVR+
Sbjct: 328 GLLRQGLEALVASHPDVFEEVRGAGLMMGLKCKPPAGELVNAGYAANVLTVGAADNVVRL 387

Query: 366 LPPLTITAEEIHEGLERIERTAIKL 390
           LP L I   +I EGL+R++  A  L
Sbjct: 388 LPALNIPDADIAEGLQRLDAAATAL 412


>gi|330813145|ref|YP_004357384.1| acetylornithine aminotransferase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486240|gb|AEA80645.1| acetylornithine aminotransferase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 388

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 245/370 (66%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L N Y++  I F KGKG++L+S NG  +LDF  GIAVNSLGH+HP+LVA L  QS+K+WH
Sbjct: 4   LANNYNRKKIAFLKGKGSFLYSTNGSKYLDFVQGIAVNSLGHAHPKLVAALNKQSKKVWH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN +Q  + E  A  L   TFAD V F NSGAE+ E AIK ARRY Y  G+  K RI+ 
Sbjct: 64  VSNAFQIPEGEKLAKKLTQHTFADYVLFQNSGAEATEAAIKVARRYFYSIGQPKKNRIIC 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            + +FHGRTLATI A G  +  EGF PK+ GFD  KF D   LK  I+  TAAI++E + 
Sbjct: 124 IKDSFHGRTLATIFASGSKKMTEGFYPKVPGFDHFKFGDHTKLKKLITKKTAAIMVETVM 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG++ +P+  L+ LRK+C++   LLI DEVQ G GRTGK FA+E A VKPDI+ IAKG
Sbjct: 184 GEGGIKVIPDWCLKGLRKLCNEKKILLILDEVQCGIGRTGKFFAFEHAKVKPDIVPIAKG 243

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA L   + A+ M  G+HGST+GGN LAM +G  VL +I    FL+NV  I+ 
Sbjct: 244 IGGGFPMGAVLMNKKTASAMVAGTHGSTFGGNPLAMSVGSAVLEVILKKSFLKNVTKISN 303

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
                L  ++ ++P +  EVRG GLL+GL+          K  D  LLT  +++NV+R+L
Sbjct: 304 YFHLELKKLQKQYPKIIKEVRGAGLLVGLQLHKDQTTFIKKLMDNKLLTIRAAENVIRLL 363

Query: 367 PPLTITAEEI 376
           PPLT+   EI
Sbjct: 364 PPLTVKKNEI 373


>gi|296536735|ref|ZP_06898793.1| acetylornithine transaminase [Roseomonas cervicalis ATCC 49957]
 gi|296262939|gb|EFH09506.1| acetylornithine transaminase [Roseomonas cervicalis ATCC 49957]
          Length = 400

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 260/387 (67%), Gaps = 2/387 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY+++D+ FE+G+GAWL++  G  FLDF SGIA  S+GH+HP LV  +  Q+ K+ H
Sbjct: 5   LMPTYNRADLAFERGEGAWLWTVEGRRFLDFGSGIATTSIGHAHPHLVRTVAEQAAKVMH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  Q E  A  L+ ++FAD VFF NSGAE+ E  +K  R+YH   G   KFR + 
Sbjct: 65  VSNLYRVPQAERLAARLVETSFADSVFFCNSGAEANEGMMKAVRKYHAENGHPEKFRFIC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEGAFHGRTLA ++A G  +YLEGFGP  EGFD   F ++ ++++ I  +TAAI+IEPIQ
Sbjct: 125 FEGAFHGRTLAALAATGNPKYLEGFGPAPEGFDHIPFGNMNAVRDAIGPNTAAIMIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR     FL++LR +CD+   LL  DEVQTG GR+GKL+A++WA ++PD+M+ AKG
Sbjct: 185 GEGGVRPAELRFLRELRAVCDEFGLLLALDEVQTGMGRSGKLWAHQWAGIEPDVMSSAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LA  +VA  +  G+HG+TYGGN LA   G  VL++I + GFLE V  +A+
Sbjct: 245 IGGGFPLGAILAKEKVAKYLKPGTHGTTYGGNPLACAAGNAVLDVILAPGFLEQVDRVAR 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV--FSPALLAAKFRDECLLTAPSSDNVVR 364
            L+  +  +  R P +   VRG GLL+GL+ V   +   L A    E LLT  +  NV+R
Sbjct: 305 HLWRSMQDLAARHPQVATGVRGAGLLLGLQLVPEVTNTELQAAAVAEGLLTVAAGQNVLR 364

Query: 365 ILPPLTITAEEIHEGLERIERTAIKLS 391
           + P L IT  E+ + +E ++R   +++
Sbjct: 365 VAPSLIITEAEVDQAVEMLDRALRRVT 391


>gi|94495446|ref|ZP_01302026.1| ornithine/acetylornithine aminotransferase [Sphingomonas sp. SKA58]
 gi|94424834|gb|EAT09855.1| ornithine/acetylornithine aminotransferase [Sphingomonas sp. SKA58]
          Length = 398

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 246/384 (64%), Gaps = 3/384 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y + D+R  +G+G +L  E G  +LDFASGIAVN LGH HP LV  +  Q+  L H
Sbjct: 6   LMPVYPRCDVRPVRGEGCYLIGERGERYLDFASGIAVNLLGHGHPRLVKTIADQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY     E FA  L+ +TFAD VFFTNSGAE+VECAIKTARRYH+  G+ ++ +I++
Sbjct: 66  TSNLYGMPLGEEFAQKLVDNTFADTVFFTNSGAEAVECAIKTARRYHFANGEAHRHKIIS 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+ AFHGRTL TISA  + +  +GF P + GF    F DL++    + ++TA  L+EP+Q
Sbjct: 126 FDNAFHGRTLGTISATSQPKMRDGFEPLLPGFQVVPFNDLEAATAAVDDNTAGFLLEPVQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGV    ++FL+ LR++CD+   LLI DEVQ GY RTG  FA+E   V PDIM +AKG
Sbjct: 186 GEGGVTPATQDFLKGLRQLCDERGLLLILDEVQCGYARTGTFFAHEQYGVAPDIMAVAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT E A  M  G+HGSTYGGN LAM +G  VL+ + +DGFL++V  +  
Sbjct: 246 IGGGFPLGACLATEEAAKGMVFGTHGSTYGGNPLAMAVGLTVLDEVLADGFLDHVKTMGA 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-ECLLTAPSSDNVV 363
            L   L  +     +MF +VRG GL++G  +K  +         RD   LL   +  NV+
Sbjct: 306 RLRAALEQLIPNHDDMFADVRGMGLMLGVRMKDAYDARAFVGHLRDHHGLLAVSAGQNVL 365

Query: 364 RILPPLTITAEEIHEGLERIERTA 387
           RILPPL I    I E +E+I   A
Sbjct: 366 RILPPLVIEESHIAEAIEKISAGA 389


>gi|294013052|ref|YP_003546512.1| acetylornithine aminotransferase [Sphingobium japonicum UT26S]
 gi|292676382|dbj|BAI97900.1| acetylornithine aminotransferase [Sphingobium japonicum UT26S]
          Length = 396

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/386 (49%), Positives = 250/386 (64%), Gaps = 8/386 (2%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y + D+R  +G+G +L  E G  +LDFASGIAVN LGH HP+LV  +  Q+  L H
Sbjct: 6   LMPVYPRCDVRPVRGEGCYLIGERGERYLDFASGIAVNLLGHGHPKLVKAIADQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY     E FA  L+ +TFAD VFFTNSGAE+VECAIKTARRYHY  G+ ++ +I++
Sbjct: 66  TSNLYGMPLGEKFAQRLVDTTFADTVFFTNSGAEAVECAIKTARRYHYANGQAHRHKIIS 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+ AFHGRTL TISA  + +  +GF P + GF    F DL++    + ++TA  L+E +Q
Sbjct: 126 FDNAFHGRTLGTISATSQPKMRDGFEPLLPGFTVVPFNDLEAATAAVDDNTAGFLVETVQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGV    +EFL  LRK+CDD   LLI DEVQ GY RTG  FA+E   + PDIM +AKG
Sbjct: 186 GEGGVTPATQEFLSGLRKLCDDHGLLLILDEVQCGYARTGTFFAHEQYGLTPDIMAVAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G GFP+GACLAT E A  M  G+HGSTYGGN LAM +G  VL+ +  +GFL++V +I  
Sbjct: 246 IGAGFPLGACLATEEAAKGMVFGTHGSTYGGNPLAMAVGLTVLDEVLGEGFLDHVKSIGA 305

Query: 307 ILFEGLTAIKNRFPN--MFLEVRGQGLLIG--LKTVFSPALLAAKFRD-ECLLTAPSSDN 361
            L    +A++   PN  MF +VRG GL++G  +K+ +      A  RD   LLT  +  N
Sbjct: 306 RL---RSALEQLIPNHDMFEDVRGLGLMLGVKMKSDYDARAFVAHLRDNHGLLTVSAGQN 362

Query: 362 VVRILPPLTITAEEIHEGLERIERTA 387
           VVRILPPL I    + E +ER+   A
Sbjct: 363 VVRILPPLVIEESHVAECVERLSAGA 388


>gi|254439460|ref|ZP_05052954.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Octadecabacter antarcticus 307]
 gi|198254906|gb|EDY79220.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Octadecabacter antarcticus 307]
          Length = 393

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/386 (46%), Positives = 252/386 (65%), Gaps = 1/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F  G G+WL   +G  FLD  +GIAVN LGH+HP+LVA L  Q+ KLWH
Sbjct: 5   ILPTYNRAPLTFVSGSGSWLVEADGRRFLDLGAGIAVNVLGHAHPDLVAALTQQANKLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY    Q+  A+ L+  TFAD VFFTNSG E+ E A+K AR+YHY  G   +  I+T
Sbjct: 65  VSNLYHIGPQQKLADLLVEHTFADTVFFTNSGTEACELAVKMARKYHYDNGAPERTDIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT-AAILIEPI 185
           F+G+FHGR+ A I+A G  +  +GFGP + GF    F D  +L     + T  AI++EP+
Sbjct: 125 FDGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFVHLPFGDHDALIEAAKSPTVGAIMVEPV 184

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+R VP+  L+ LR +CD+   L+I DEVQ G  RTGKLFA+EWA + PDIM +AK
Sbjct: 185 QGEGGIRAVPDACLRGLRDLCDEHGILMILDEVQCGVARTGKLFAHEWAGIMPDIMMVAK 244

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GA LA+   A+ M  G+HGSTYGGN LA  +G KV+ I+    F+ +V   A
Sbjct: 245 GIGGGFPLGAVLASQNAASGMTAGTHGSTYGGNPLACAVGCKVMEIVADPAFIADVNRKA 304

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
            +L + L  +    P +F +VRG GL++GLK       +     +E LLT P++ NV+R+
Sbjct: 305 GLLRQKLEGLVAGNPAVFEDVRGSGLMLGLKCKAINIDIVQAGYNENLLTVPAAYNVIRL 364

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
           LPPL IT  EI + + R+++ A +++
Sbjct: 365 LPPLNITDAEIEDAVVRLQKAATRVA 390


>gi|163734104|ref|ZP_02141545.1| acetylornithine aminotransferase [Roseobacter litoralis Och 149]
 gi|161392640|gb|EDQ16968.1| acetylornithine aminotransferase [Roseobacter litoralis Och 149]
          Length = 391

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/381 (48%), Positives = 250/381 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+G+WL   +G  FLD A+GIAV +LGH+HP+LV  L  Q+E LWH
Sbjct: 5   ILPTYARAPLSFVKGEGSWLIEADGRRFLDLAAGIAVTALGHAHPKLVKALTDQAEALWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLYQ  QQ+  A+ L   TFAD VFFTNSG E+ E A+K AR+Y    GK  K +I+ 
Sbjct: 65  TSNLYQIPQQQNLADKLTDLTFADTVFFTNSGTEACELAVKMARKYWNDKGKPEKSQILA 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGR+ A I+A G  +  +GFGP + GF   +F D  +L     + TAA++IEPIQ
Sbjct: 125 FSGSFHGRSAAGIAAAGSEKMTKGFGPLLPGFTHLEFGDHDALTAAFDDTTAAVIIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP++ L+ LR +CD    LLIFDEVQ G  RTG+LFA+EWA V PDIM +AKG
Sbjct: 185 GEGGIRPVPDQCLKGLRDLCDTHGVLLIFDEVQCGVARTGRLFAHEWAGVTPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPIGA LAT E A  M  G+HGSTYGGN L   +G  VL+ +    FL +V     
Sbjct: 245 IGGGFPIGAVLATEEAACGMTLGTHGSTYGGNPLGCAVGCAVLDHVADPAFLADVARKGA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ + L  +    P +F  VRG GL++G+K   +   + A   +E +LT P++DNVVR+L
Sbjct: 305 LMRQRLEGLVAEHPEVFESVRGSGLMLGIKCRAANTDVVAAGYNELILTVPAADNVVRLL 364

Query: 367 PPLTITAEEIHEGLERIERTA 387
           PPLTI+ +EI + + R+   A
Sbjct: 365 PPLTISDDEISDAVARLGAAA 385


>gi|307293821|ref|ZP_07573665.1| acetylornithine and succinylornithine aminotransferase [Sphingobium
           chlorophenolicum L-1]
 gi|306879972|gb|EFN11189.1| acetylornithine and succinylornithine aminotransferase [Sphingobium
           chlorophenolicum L-1]
          Length = 396

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 247/386 (63%), Gaps = 8/386 (2%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y + D+R  +G+G +L  E G  +LDFASGIAVN LGH HP+LV  +  Q+  L H
Sbjct: 6   LMPVYPRCDVRPVRGEGCYLIGERGERYLDFASGIAVNLLGHGHPKLVKAIADQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY     E FA  L+ +TFAD VFFTNSGAE+VECAIKTARRYHY  G+ ++ +I++
Sbjct: 66  TSNLYGMPLGEKFAQRLVDTTFADTVFFTNSGAEAVECAIKTARRYHYANGQAHRHKIIS 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+ AFHGRTL TISA  + +  +GF P + GF    F DL++    + ++TA  L+E +Q
Sbjct: 126 FDNAFHGRTLGTISATSQPKMRDGFEPLLPGFTVVPFNDLEAATVAVDDNTAGFLVETVQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGV    +EFL  LRK+CDD   LLI DEVQ GY RTG  FA+E   + PDIM +AKG
Sbjct: 186 GEGGVTPATQEFLSGLRKLCDDHGLLLILDEVQCGYARTGTFFAHEQYGLTPDIMAVAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G GFP+GACLAT E A  M  G+HGSTYGGN LAM +G  VL+ +  DGFL++V  I  
Sbjct: 246 IGAGFPLGACLATEEAAKGMVFGTHGSTYGGNPLAMAVGMAVLDEVLGDGFLDHVKAIGA 305

Query: 307 ILFEGLTAIKNRFPN--MFLEVRGQGLLIGLKTV--FSPALLAAKFRD-ECLLTAPSSDN 361
            L    +A++   PN  MF +VRG GL++G+K           A  RD   LLT  +  N
Sbjct: 306 RL---RSALEQLIPNHDMFEDVRGMGLMLGVKVKDEHDARAFVAHLRDNHGLLTVSAGQN 362

Query: 362 VVRILPPLTITAEEIHEGLERIERTA 387
           VVRILPPL I    + E +ER+   A
Sbjct: 363 VVRILPPLVIEESHVAECVERLSAGA 388


>gi|126725180|ref|ZP_01741023.1| Acetylornithine Aminotransferase class-III [Rhodobacterales
           bacterium HTCC2150]
 gi|126706344|gb|EBA05434.1| Acetylornithine Aminotransferase class-III [Rhodobacterales
           bacterium HTCC2150]
          Length = 390

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/384 (45%), Positives = 253/384 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F KG+G+WL +++G  +LD  +GIAVN+LGH++P+LVA L  Q+ +LWH
Sbjct: 5   ILPTYARAPMTFVKGEGSWLIADDGQRYLDLGAGIAVNALGHANPDLVAALTEQAGQLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY    QE  A+ L+ +TFAD VFFTNSG E+ E A+K AR+Y +  G+  +  I+ 
Sbjct: 65  TSNLYNIPGQEKLADQLVDATFADNVFFTNSGTEACELAVKMARKYWHEKGQPERVEILA 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEG+FHGR+ A I+A G  +  +GFGP + GF    F D  ++   I + TAAI++EP+Q
Sbjct: 125 FEGSFHGRSSAGIAAAGGDKLTKGFGPLLPGFKHLPFGDHDAIIAAIGDTTAAIIVEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG++ + +  L+ LR  CD    LLI+DEVQ G  RTGKLFA+EW++ +PDIM +AKG
Sbjct: 185 GEGGIKPLSDACLKGLRDACDSAGILLIYDEVQCGVARTGKLFAHEWSDAEPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LATNE ++ M  G+HGSTYGGN LAM +G +V+ ++    FL  V   A 
Sbjct: 245 IGGGFPLGAVLATNEASSGMGAGTHGSTYGGNPLAMAVGNRVVELVNDPEFLSEVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           ++ + L  +    P++F  VRG GL++G+K       +        +LT P++DNV+RIL
Sbjct: 305 LMRQKLEGLVASHPDVFESVRGMGLMLGIKCKAVNMDVVNAGYGAGVLTVPAADNVIRIL 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           P L I  E+I E + R++  A  L
Sbjct: 365 PALNIPDEDIGEAISRLDTAATTL 388


>gi|85703320|ref|ZP_01034424.1| acetylornithine aminotransferase [Roseovarius sp. 217]
 gi|85672248|gb|EAQ27105.1| acetylornithine aminotransferase [Roseovarius sp. 217]
          Length = 411

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 255/385 (66%), Gaps = 2/385 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + F KG+G WL   +G  FLD  +GIAVN++GH+HP LVA L  Q+  LWH
Sbjct: 25  ILPTYNRAPLSFVKGEGTWLIEADGRRFLDLGAGIAVNAMGHAHPALVAALTEQAGALWH 84

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLYQ  +Q+  A+ L+ +TFAD VFFTNSG E+ E A+K AR+  Y AG+  +  I+ 
Sbjct: 85  TSNLYQIPKQQELADRLVAATFADTVFFTNSGTEACELAVKMARKQFYDAGQPERTDIIA 144

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FEG+FHGR+ A I+A G  +  +GFGP + GF    + D  +L   I  +TAAILIEP+Q
Sbjct: 145 FEGSFHGRSAAGIAAAGSEKMTKGFGPLLPGFKHVAWGDHDALHAAIDENTAAILIEPVQ 204

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R +P++ L+ LR +CD+   LLI DEVQ G GRTG+LFA+EWA V PDIM +AKG
Sbjct: 205 GEGGIRPLPDQCLKGLRALCDETGILLILDEVQCGMGRTGRLFAHEWAGVTPDIMMVAKG 264

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT   A+ M  G+HGSTYGGN L   +G  V+  + +  FL  V   A 
Sbjct: 265 IGGGFPLGAVLATEHAASGMTAGTHGSTYGGNPLGCAVGCAVMEHVANSEFLAEVNRKAG 324

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKT-VFSPALLAAKFRDECLLTAPSSDNVVRI 365
           ++ + L  +    P +F  VRG GL++GLK  V +  ++ A +    + T P++DNV+R+
Sbjct: 325 LMRQRLEGLVAAHPTIFEAVRGMGLMLGLKCRVLNTDVVQAGYA-ALIATVPAADNVLRL 383

Query: 366 LPPLTITAEEIHEGLERIERTAIKL 390
           LPPLTIT +EI E + R++  A  L
Sbjct: 384 LPPLTITDDEIAEAVARLDAVATTL 408


>gi|58039690|ref|YP_191654.1| acetylornithine transaminase protein [Gluconobacter oxydans 621H]
 gi|58002104|gb|AAW60998.1| Acetylornithine aminotransferase [Gluconobacter oxydans 621H]
          Length = 427

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 182/384 (47%), Positives = 250/384 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y ++D+ FE+G+G WL + NG  +LDF +GIAV SLGH+HP+LV  +  Q+ K+ H
Sbjct: 34  LMPNYKRADLAFEQGEGVWLTATNGRRYLDFGAGIAVTSLGHAHPKLVKTIAEQAAKVMH 93

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  Q E  A  L+ +TFAD V F NSGAE+ E  +K  RR  +  G   +  I+ 
Sbjct: 94  VSNLYRIPQAEKLAELLVQNTFADSVLFCNSGAEANEGMVKMIRRAQFENGHPERTNILC 153

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+GAFHGRTLA ISA G   Y +GFGP +EGFD A F +  +L++ I+  TA I++EP+Q
Sbjct: 154 FDGAFHGRTLAMISATGNPAYQKGFGPVVEGFDHAPFNNTNTLRDAITPHTAGIVVEPVQ 213

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE G++    EF++ LR +CD+    L FDEVQTG GRTGKLFA+EW  V+PD++++AKG
Sbjct: 214 GESGIKPATREFMEGLRAVCDEFGLYLGFDEVQTGVGRTGKLFAHEWYGVRPDVISVAKG 273

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA LAT E+A  +  GSHG+T+GGN LA   G  VL  I S GFLE+V ++  
Sbjct: 274 IGGGFPLGAVLATEELARHLTPGSHGTTFGGNPLACAAGVTVLEEILSPGFLEHVRSVGD 333

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
              + L  + +R   +F  VRG GL+ GL  V   A +     ++ LLT  + DNV+R++
Sbjct: 334 AFGKMLEDVVSRSEGVFDNVRGIGLMRGLHCVPPVADVMQAVLNQELLTVSAGDNVLRLV 393

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL +T  E  E  ER+ + A  L
Sbjct: 394 PPLVVTEAECREACERLVKAAHSL 417


>gi|326388067|ref|ZP_08209670.1| acetylornithine aminotransferase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207233|gb|EGD58047.1| acetylornithine aminotransferase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 400

 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 177/385 (45%), Positives = 251/385 (65%), Gaps = 2/385 (0%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           M+ N+ L   Y+++ +  ++G+G WL + +G  +LD  SGIA N+LGH HP LVA LK Q
Sbjct: 1   MSGNEALMGVYNRAPLEVDRGEGVWLHATDGRVYLDCVSGIATNALGHCHPRLVAALKDQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           +EKLWHVSN+++   QE  A+ L  ++FAD  FF NSG E++ECAIKTARRYH   G  +
Sbjct: 61  AEKLWHVSNIFRIPAQEQLAHKLTQASFADVAFFANSGTEAIECAIKTARRYHAARGDGH 120

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCD-LQSLKNQISNDTAA 179
           +  ++ F G+FHGRT A ++A G   YL+GFGP++ G+ Q    D    +    +   AA
Sbjct: 121 RIDVIGFAGSFHGRTYAAVNASGNAAYLDGFGPRLPGYVQIDLDDEAALVAAIAAPTAAA 180

Query: 180 ILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA-NVKP 238
           +L+EP+QGEGG R +  E+L +L+ +C     L+I DEVQ G GRTG+LFA++WA   +P
Sbjct: 181 VLVEPVQGEGGARALSPEWLLRLKDMCRKAGVLVIHDEVQCGMGRTGRLFAHQWAPGAEP 240

Query: 239 DIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFL 298
           DIM IAK MGGGFPIGACLAT + A+ M  GSHG+T+GGN LAM +G    +++     L
Sbjct: 241 DIMAIAKAMGGGFPIGACLATRDAASGMVVGSHGTTFGGNPLAMAVGLAAFDLLADPTLL 300

Query: 299 ENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPS 358
           ++   + +    GL  +   F ++ L+VRG+GLLIG+K   +   + A  RD  LL A  
Sbjct: 301 DHARQMGERFMSGLGKLVVAFGDIALDVRGKGLLIGVKLAVNNREMMATARDHGLLVAGG 360

Query: 359 SDNVVRILPPLTITAEEIHEGLERI 383
            DN +R+LPPL IT +E+ E L+R+
Sbjct: 361 GDNCIRLLPPLIITDKEVDEALDRL 385


>gi|114797121|ref|YP_759309.1| acetylornithine/succinylornithine aminotransferase [Hyphomonas
           neptunium ATCC 15444]
 gi|114737295|gb|ABI75420.1| acetylornithine/succinylornithine aminotransferase [Hyphomonas
           neptunium ATCC 15444]
          Length = 395

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 255/385 (66%), Gaps = 2/385 (0%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           +    +   Y   +  F +G+G +LF+E+G  +LDF +GIAV +LGH+HP +V  L+ Q+
Sbjct: 3   DPRQHILPVYRPPEEVFVQGEGVYLFTEDGRRYLDFIAGIAVTALGHAHPAMVEALRDQA 62

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            KLWH SN+++   QE  A+ +   +FADRVFFTNSG E++ECAIK AR+YH+ AG  ++
Sbjct: 63  GKLWHTSNMFRVKGQEELADKICRDSFADRVFFTNSGTEAIECAIKAARKYHWAAGNADR 122

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLK-NQISNDTAAI 180
             I+TF GAFHGR++  I+AGG  +YLEGFGPK+ GF   ++ D  +LK    ++  AA+
Sbjct: 123 LDIITFTGAFHGRSIGAINAGGNPKYLEGFGPKLPGFVHLEWGDHDALKAAVAASTAAAV 182

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW-ANVKPD 239
           L+EP+QGEGGVR +PE+ L+ LR +C++   LLI+DEVQ G GRTG+L+ Y+W A   PD
Sbjct: 183 LVEPVQGEGGVRAMPEQCLKGLRDLCNEHGVLLIYDEVQCGMGRTGQLWGYQWAAGADPD 242

Query: 240 IMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE 299
           I+  AKG+GGGFP GACL T  V   M  GSHGSTYGGN LAM +G  V +II S+ FL 
Sbjct: 243 ILCAAKGIGGGFPFGACLMTEAVGEPMQPGSHGSTYGGNPLAMAVGNVVWDIISSEEFLA 302

Query: 300 NVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSS 359
           NV  ++  L +GL ++ +  P+    V G+GLL GL+    P  L    RD  LLT  + 
Sbjct: 303 NVRRVSGTLQQGLKSLADSHPDKVEGVTGKGLLTGLRLKADPKNLQGICRDGGLLTGVAG 362

Query: 360 DNVVRILPPLTITAEEIHEGLERIE 384
           +NV+R+ PPL I   ++ + +  I+
Sbjct: 363 NNVLRLAPPLIIDDAQVRDAIGMID 387


>gi|329847859|ref|ZP_08262887.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Asticcacaulis biprosthecum C19]
 gi|328842922|gb|EGF92491.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Asticcacaulis biprosthecum C19]
          Length = 402

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 183/384 (47%), Positives = 249/384 (64%), Gaps = 1/384 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ND LF  Y ++ I  ++G+G  L+  +G  +LDF  GIA N LGH+ P LV  ++ QSEK
Sbjct: 5   NDHLFGVYARAPIEVDRGQGVRLYDRHGRSWLDFVQGIATNGLGHAAPVLVDAVRKQSEK 64

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWHVSN++   +Q   A  L  ++FADRVFFTNSG E+VECA+K AR+YH   G   +  
Sbjct: 65  LWHVSNIFTIPEQGELAEKLCAASFADRVFFTNSGTEAVECALKLARKYHASRGNEERID 124

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAA-ILI 182
           I+ FEGAFHGRT A ++A G   YL+GFGP++ GF      D  +++      TAA IL+
Sbjct: 125 IIGFEGAFHGRTYAAVTAAGNETYLKGFGPRLPGFVHLSLDDHDAIRAAAEAPTAAAILV 184

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           EP+QGEGG R + +  L  LR++CD    LLIFDE+Q G GR+GK++AYE++ V PD+M 
Sbjct: 185 EPVQGEGGARALTDAELTLLRELCDANGLLLIFDEIQCGMGRSGKMWAYEYSGVIPDVMC 244

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
           +AK +GGGFP+GACLAT + A+ M  G+HGST+GGN LAM +G      I S   L+NV 
Sbjct: 245 VAKALGGGFPVGACLATEDAASGMTVGAHGSTFGGNPLAMAVGLAAFGEISSPELLDNVR 304

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNV 362
             A  L + L  +K  +P+M  E+RG+GLLIG+K   +   +    RD  LL A  SDN 
Sbjct: 305 KQAGYLKQQLEGLKQTWPDMIDEIRGRGLLIGIKLKPNNREIMTLARDNGLLIAGGSDNC 364

Query: 363 VRILPPLTITAEEIHEGLERIERT 386
           VR+LPPL +T +E  E +  +E+T
Sbjct: 365 VRLLPPLNVTEDECREAVGLLEKT 388


>gi|148554329|ref|YP_001261911.1| acetylornithine transaminase protein [Sphingomonas wittichii RW1]
 gi|148499519|gb|ABQ67773.1| acetylornithine aminotransferase [Sphingomonas wittichii RW1]
          Length = 396

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 194/387 (50%), Positives = 241/387 (62%), Gaps = 9/387 (2%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+G +L  E G  +LDFASGIAVN LGH HP+LV  +  Q+  L H
Sbjct: 6   LMPVYPRCGVRPVRGEGCYLIGERGERYLDFASGIAVNILGHGHPDLVKAIADQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY S Q E FA  L+  TFAD VFFTNSGAE+VECAIKTARRYHY+ G   + +I++
Sbjct: 66  TSNLYGSPQGEAFAQKLVDKTFADTVFFTNSGAEAVECAIKTARRYHYVNGSPERTKIIS 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRTL TISA  + +  +GF P + GF    F DL++ +  +   TA  L+EP+Q
Sbjct: 126 FSNAFHGRTLGTISATSQPKMRDGFEPLLPGFQVVPFNDLEAARAAVDATTAGFLVEPVQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+     EFL+ LR+ICD+   LLI DEVQ GY RTG  FA+E   + PDIM +AKG
Sbjct: 186 GEGGMTPSKPEFLKGLRQICDEQGLLLILDEVQCGYCRTGTFFAHEQYGITPDIMAVAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           + GGFP+GACLAT E A  M  G+HGSTYGGN LAM  GE V  +  +D FL NV     
Sbjct: 246 IAGGFPLGACLATEEAAKGMVFGTHGSTYGGNPLAMAAGEAVFKVAVNDEFLANVRATGD 305

Query: 307 ILFEGLTAIKNRFPN---MFLEVRGQGLLIG--LKTVFSPALLAAKFRD-ECLLTAPSSD 360
            L +   AI+   PN   +F  VRG GL+IG  LK         A  RD   LLT  + +
Sbjct: 306 RLRQ---AIEQLIPNHDGVFDSVRGLGLMIGIKLKDAVEARAFVAHLRDHHGLLTVAAGE 362

Query: 361 NVVRILPPLTITAEEIHEGLERIERTA 387
           NVVRILPPL I    I E +E++   A
Sbjct: 363 NVVRILPPLVIEESHIAECIEKLSAGA 389


>gi|326389104|ref|ZP_08210685.1| bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206410|gb|EGD57246.1| bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 397

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 190/382 (49%), Positives = 239/382 (62%), Gaps = 1/382 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+   L SE+G  +LDFASGIAVN LGHS+  L+  ++ Q+  L H
Sbjct: 6   LMPVYPRCGVRPVRGEHCHLISEDGTRYLDFASGIAVNLLGHSNEHLIGAIQRQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY S Q E  A  L+  TFAD VFFTNSGAE+VECAIKTAR YH   G  +K+ ++T
Sbjct: 66  VSNLYGSPQGEKVAQRLVDLTFADTVFFTNSGAEAVECAIKTARAYHQSVGNLDKYELIT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRT+ATISA  + +  +GF P + GF  A F DL + +  I  +TA  L+EPIQ
Sbjct: 126 FNNAFHGRTMATISASNQEKMHKGFLPLLPGFKYAPFDDLAAAEALIGPNTAGFLVEPIQ 185

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR    EFL  LR + D  D +LIFDEVQ G  RTG  +AYE   V PDI+  AKG
Sbjct: 186 GEGGVRDASPEFLAGLRALADKHDLMLIFDEVQCGVARTGTFYAYEQYGVVPDILATAKG 245

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G+HGSTYGGN LAM   E VL+++ +D FL  V    +
Sbjct: 246 IGGGFPVGACLATEKAARGMVAGTHGSTYGGNPLAMAAAEAVLDVVANDEFLAQVKATGE 305

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNVVRI 365
            L   L      +P+MF  VRG+GL++GLK    P    A  RD   LLT  + D  +RI
Sbjct: 306 RLRSRLEQFIGNYPDMFELVRGRGLMLGLKLRIEPRAFVAHLRDNHQLLTVAAGDTTLRI 365

Query: 366 LPPLTITAEEIHEGLERIERTA 387
           LPPL I    I E +E++   A
Sbjct: 366 LPPLVIDDSHIDEFMEKLSAGA 387


>gi|149185383|ref|ZP_01863699.1| ornithine/acetylornithine aminotransferase [Erythrobacter sp.
           SD-21]
 gi|148830603|gb|EDL49038.1| ornithine/acetylornithine aminotransferase [Erythrobacter sp.
           SD-21]
          Length = 396

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 184/383 (48%), Positives = 245/383 (63%), Gaps = 2/383 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  KG+   L  E+G  +LDFASGIAVN LGHSHP L+  ++ Q+E L H
Sbjct: 6   LMPVYPRCGVRPVKGEHCHLIDEDGTRYLDFASGIAVNLLGHSHPGLIGAIQRQAETLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYH-YMAGKTNKFRIV 125
           VSNLY S Q E  A  L+  TFAD VFFTNSGAE++ECAIKTAR YH +  G +N+  ++
Sbjct: 66  VSNLYGSPQGEDLAQRLVDKTFADTVFFTNSGAEAMECAIKTARAYHQHEDGDSNRTELI 125

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           TF  AFHGRT+ATISA  + +  +GF P + GF  A+F +L+S K  +S+ TA  L+EPI
Sbjct: 126 TFTNAFHGRTMATISASNQEKMHKGFYPMLAGFQYAEFDNLESAKALVSDKTAGFLVEPI 185

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+R   +EF+  L+ +CD+ D +L+FDEVQ G  RTGKL+AYE   +KPDIM  AK
Sbjct: 186 QGEGGIRPASDEFIHGLKALCDEHDLMLVFDEVQCGVARTGKLYAYEHYGIKPDIMASAK 245

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GACLAT + A  M  G+HGSTYGGN LAM  G  V+  + +D FL  V    
Sbjct: 246 GLGGGFPVGACLATEKAARGMGFGTHGSTYGGNPLAMAAGVAVMEAVANDEFLAEVTEKG 305

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNVVR 364
           + L   L      +P++F  VRG+GL++G++            RD   LLT  + D  +R
Sbjct: 306 ERLRSRLEQFIGNYPDLFDFVRGKGLMLGIRMKVESRPFFVHLRDNHQLLTVAAGDQTLR 365

Query: 365 ILPPLTITAEEIHEGLERIERTA 387
           +LPPL     E  E ++++   A
Sbjct: 366 VLPPLVADNAEFDEFMDKLSAGA 388


>gi|71083208|ref|YP_265927.1| acetylornithine aminotransferase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062321|gb|AAZ21324.1| Acetylornithine aminotransferase [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 388

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 185/380 (48%), Positives = 249/380 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y++  I F+ GKG++L+S NG  +LDF  GIAVNSLGH++P L+  +  QS+KLWH
Sbjct: 4   LAKNYNRKKISFKYGKGSFLYSTNGKKYLDFVQGIAVNSLGHANPNLIKAVNKQSKKLWH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN +   + E  A  L   TFAD + F NSGAE+ E AIK ARRY Y  G+ +K RI+ 
Sbjct: 64  VSNAFIIPEGEKLAKRLAKKTFADFIIFQNSGAEATEAAIKVARRYFYSIGQPSKNRILC 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            + +FHGRTLATI A G  +  EGFGPK++GFD  +F + +  K +I+  TAAI++E + 
Sbjct: 124 VKNSFHGRTLATIYASGSKKMTEGFGPKVDGFDHFEFGNHKDFKKKITKKTAAIMVETVM 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG++ +P   L++LRKICD    LLI DEVQ G GR+G  FA+E + +KPDI+ IAKG
Sbjct: 184 GEGGIKVIPNWCLKELRKICDKKKILLILDEVQCGIGRSGNFFAFENSKIKPDIVPIAKG 243

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA L   +VA+ M  G+HGST+GGN LAM +G  VL+ I   GFL NV  ++K
Sbjct: 244 IGGGFPLGAVLMNKKVASGMTAGTHGSTFGGNPLAMSVGNAVLDQISKKGFLSNVKKLSK 303

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
                L  ++ +FP +  EVRG GLLIGL+          K  D  LLT  +++NV+RIL
Sbjct: 304 YFHSELNILRKKFPKIIKEVRGVGLLIGLQLHNDQTKFIQKLMDNKLLTIRAAENVIRIL 363

Query: 367 PPLTITAEEIHEGLERIERT 386
           PPL +  EEI   +  IE+ 
Sbjct: 364 PPLNVKKEEIKIAINIIEKV 383


>gi|148261524|ref|YP_001235651.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Acidiphilium cryptum JF-5]
 gi|146403205|gb|ABQ31732.1| acetylornithine aminotransferase apoenzyme [Acidiphilium cryptum
           JF-5]
          Length = 398

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 237/372 (63%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y++ D+ F  G+GAWL + +G  FLDF +GIA +SLGH HP L   +  Q+ K+ H
Sbjct: 5   LMPNYNRIDVEFSHGEGAWLTAADGRRFLDFGAGIATSSLGHGHPGLTRAIADQAAKVIH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  Q E  A  L+ ++FAD VFF NSGAE+ E  +K  R+     GK  ++R++ 
Sbjct: 65  VSNLYRVPQAERLAARLVAASFADSVFFCNSGAEANEALVKAFRKTMAREGKPERYRVIC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            +GAFHGRTLA ISA G  +YLEGFGP ++GFD   F +L +L++ I+ +TA IL+EPIQ
Sbjct: 125 AQGAFHGRTLAMISATGNSKYLEGFGPPVDGFDHVPFNNLNALRDAITPETAGILVEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R    E+L+ LR   D+   LL FDEVQ G GRTGKLFA+EWA V PD ++ AKG
Sbjct: 185 GEGGIRPATMEYLRGLRAAADEFGLLLGFDEVQCGMGRTGKLFAHEWAGVVPDAVSTAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           + GGFP+GA LA   VAA +  GSHG+TYGG  LA   G  VL+ + + GFL+ V    +
Sbjct: 245 IAGGFPLGALLAGERVAASLVPGSHGTTYGGGPLACAAGNAVLDTVLAPGFLDAVERTGR 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L  GL  +  R P++F  VRGQGL+ GL        +      E LL   + DNVVR++
Sbjct: 305 RLRAGLETLAARHPDVFSGVRGQGLMQGLVCTVPNGEVQNACFAEGLLIVAAGDNVVRLV 364

Query: 367 PPLTITAEEIHE 378
           PPL +   E+ E
Sbjct: 365 PPLIVRDAEVDE 376


>gi|296117454|ref|ZP_06836041.1| acetylornithine transaminase protein [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295975975|gb|EFG82766.1| acetylornithine transaminase protein [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 468

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 172/369 (46%), Positives = 244/369 (66%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY+++D+ FE+G+GAWL++ +G  FLDF +GIA +SLGH++P LVA +  Q+ ++ H
Sbjct: 73  LMPTYNRADLAFERGEGAWLYAADGRRFLDFGAGIATSSLGHNNPHLVAAIAQQASRVMH 132

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  Q E  A  L+ ++FAD  FF NSGAE+ E  IK  RR    +G   + RI+ 
Sbjct: 133 VSNLYRIPQAERLAERLVAASFADSAFFCNSGAEANEGMIKMIRRAQAKSGHPERVRIIC 192

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGRTLAT++A G  +YL+GFGP ++GFD     ++ +++  I+ +TA I+IEPIQ
Sbjct: 193 FNGAFHGRTLATLAATGNAKYLDGFGPVVDGFDHVPMNNMNAVRAAITAETAGIMIEPIQ 252

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE GV      FL++LR  CD+    L  DEVQ G GRTGKLFA+EW+ + PD+M+ AKG
Sbjct: 253 GESGVNPADPRFLRELRTACDEYGLFLGMDEVQCGMGRTGKLFAHEWSGITPDVMSTAKG 312

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           + GGFP+GA LA  +VA  +  GSHG+T+GGN LA      VL++I + GFL+ V    K
Sbjct: 313 IAGGFPMGAILAVEDVARHLTAGSHGTTFGGNPLACAAANAVLDVILAPGFLDQVNARGK 372

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L +    +  ++P++F   RG GL+IGL  V    ++      E LL+  +  NV+R++
Sbjct: 373 MLSKEFDTLVAQYPDIFASHRGLGLMIGLHCVAPVDVVQDAAMHEGLLSVTAGGNVLRLV 432

Query: 367 PPLTITAEE 375
           PPLTIT EE
Sbjct: 433 PPLTITGEE 441


>gi|91762362|ref|ZP_01264327.1| Acetylornithine aminotransferase [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718164|gb|EAS84814.1| Acetylornithine aminotransferase [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 388

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/380 (48%), Positives = 250/380 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y++  I F+ GKG++L+S NG  +LDF  GIAVNSLGH++P L+  +  QS+KLWH
Sbjct: 4   LAKNYNRKKISFKYGKGSFLYSTNGKKYLDFVQGIAVNSLGHANPYLIKAVNKQSKKLWH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN +   + E  A  L   TFAD + F NSGAE+ E AIK ARRY Y  G+ +K RI+ 
Sbjct: 64  VSNAFIIPEGEKLAKRLAKKTFADFIIFQNSGAEATEAAIKIARRYFYSIGQPSKNRILC 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            + +FHGRTLATI A G  +  EGFGPK++GFD  +F + +  K +I+  TAAI++E + 
Sbjct: 124 VKNSFHGRTLATIYASGSKKMTEGFGPKVDGFDHFEFGNHKDFKKKITKKTAAIMVETVM 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG++ +P   L++LRK+CD    LLI DEVQ G GR+G  FA+E + +KPDI+ IAKG
Sbjct: 184 GEGGIKVIPNWCLKELRKVCDKRKILLILDEVQCGIGRSGNFFAFENSKIKPDIVPIAKG 243

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GA L   +VA+ M  G+HGST+GGN LAM +G  VL+ I   GFL NV  ++K
Sbjct: 244 IGGGFPLGAVLMNKKVASGMTAGTHGSTFGGNPLAMSVGNAVLDQILKKGFLSNVKKLSK 303

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
             +  L  ++ +FP +  EVRG GLLIGL+          K  D  LLT  +++NV+RIL
Sbjct: 304 YFYSELNKLRKKFPKIIKEVRGVGLLIGLQLHDDQTKFIQKLMDNKLLTIRAAENVIRIL 363

Query: 367 PPLTITAEEIHEGLERIERT 386
           PPL +  EEI   +  I++ 
Sbjct: 364 PPLNVKKEEIDIAINIIKKV 383


>gi|326405012|ref|YP_004285094.1| acetylornithine aminotransferase [Acidiphilium multivorum AIU301]
 gi|325051874|dbj|BAJ82212.1| acetylornithine aminotransferase [Acidiphilium multivorum AIU301]
          Length = 393

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 177/368 (48%), Positives = 236/368 (64%)

Query: 11  YDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL 70
           Y++ D+ F  G+GAWL + +G  FLDF +GIA +SLGH HP L   +  Q+ K+ HVSNL
Sbjct: 4   YNRIDVEFSHGEGAWLTAADGRRFLDFGAGIATSSLGHGHPGLTRAIADQAAKVIHVSNL 63

Query: 71  YQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGA 130
           Y+  Q E  A  L+ ++FAD VFF NSGAE+ E  +K  R+     GK  ++R++  +GA
Sbjct: 64  YRVPQAERLAARLVAASFADSVFFCNSGAEANEALVKAFRKTMAREGKPERYRVICAQGA 123

Query: 131 FHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGG 190
           FHGRTLA ISA G  +YLEGFGP ++GFD   F +L +L++ I+ +TA IL+EPIQGEGG
Sbjct: 124 FHGRTLAMISATGNPKYLEGFGPPVDGFDHVPFNNLNALRDAITPETAGILVEPIQGEGG 183

Query: 191 VRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGG 250
           +R    E+L+ LR   D+   LL FDEVQ G GRTGKLFA+EWA V PD ++ AKG+ GG
Sbjct: 184 IRPATMEYLRGLRAAADEFGLLLGFDEVQCGMGRTGKLFAHEWAGVVPDAVSTAKGIAGG 243

Query: 251 FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFE 310
           FP+GA LA   VAA +  GSHG+TYGG  LA   G  VL+ + + GFL+ V    + L  
Sbjct: 244 FPLGALLAGERVAASLVPGSHGTTYGGGPLACAAGNAVLDTVLAPGFLDAVERTGRRLRA 303

Query: 311 GLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLT 370
           GL  +  R P++F  VRGQGL+ GL        +      E LL   + DNVVR++PPL 
Sbjct: 304 GLETLAARHPDVFSGVRGQGLMQGLVCTVPNGEVQNACFAEGLLIVAAGDNVVRLVPPLI 363

Query: 371 ITAEEIHE 378
           +   E+ E
Sbjct: 364 VRDAEVDE 371


>gi|57238944|ref|YP_180080.1| acetylornithine transaminase protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578877|ref|YP_197089.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58616935|ref|YP_196134.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Ehrlichia ruminantium str. Gardel]
 gi|57161023|emb|CAH57929.1| acetylornithine/succinyldiaminopimelate aminotransferase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58416547|emb|CAI27660.1| Acetylornithine aminotransferase [Ehrlichia ruminantium str.
           Gardel]
 gi|58417503|emb|CAI26707.1| Acetylornithine aminotransferase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 391

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 181/381 (47%), Positives = 243/381 (63%), Gaps = 2/381 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           N  +   YD S + F  GKG +L+  +G  ++DF SGIA +SLGH+HP LV  LK Q EK
Sbjct: 3   NSPILQVYDPSTVTFSHGKGVYLYGHDGKKYIDFHSGIATSSLGHAHPVLVETLKRQGEK 62

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SNL+   +    A  L+  +FAD+VFF NSGAESVECA+K AR Y    G T ++R
Sbjct: 63  LWHLSNLHTIPEAIKLAQKLVDISFADKVFFNNSGAESVECALKIARSYQCGKGNTQRYR 122

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
            +T   +FHGRT    SA     +     P +E FD A+  D+ S+KN ++ +T AILIE
Sbjct: 123 FITLRRSFHGRTYTACSANEPNNFSPLLKPYVEWFDSAE-PDINSIKNALTENTGAILIE 181

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGG+  +   F+++LR ICD  D LLIFD VQ G GRTGK FA+E  NV PDI T+
Sbjct: 182 PIQGEGGINVLDASFIKELRTICDQNDILLIFDCVQCGAGRTGKFFAHEHINVTPDICTL 241

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFP+ ACL+TN  +  M  G HGST+GGN LA  +   V++ I  DGFLENV  
Sbjct: 242 AKGLGGGFPVSACLSTNNASQFMTPGMHGSTFGGNPLATTIAGAVVDEILKDGFLENVTK 301

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVV 363
             + L + L  + N+F ++  +++G+GLLIG+K       L     +  LL + +S NV+
Sbjct: 302 NGQYLHKKLEDLSNKF-SVIEQIKGKGLLIGVKVNTDSRALMKDLLNYGLLLSTASGNVL 360

Query: 364 RILPPLTITAEEIHEGLERIE 384
           RI+PPL IT +EI EG+  +E
Sbjct: 361 RIMPPLIITQQEIDEGISLLE 381


>gi|190571185|ref|YP_001975543.1| acetylornithine aminotransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018587|ref|ZP_03334395.1| acetylornithine aminotransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357457|emb|CAQ54891.1| acetylornithine aminotransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995538|gb|EEB56178.1| acetylornithine aminotransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 389

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 183/373 (49%), Positives = 249/373 (66%), Gaps = 3/373 (0%)

Query: 10  TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSN 69
            Y   +I F  GKG +L+  +   ++DF SGIAV+SLGH++P L  +LK Q EKLWH+SN
Sbjct: 9   VYSPVNINFSYGKGIYLYDIDNKRYIDFHSGIAVSSLGHANPRLTDVLKLQGEKLWHISN 68

Query: 70  LYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
            Y  +    FA +LI+++FA+ VFF NSG+E+VEC +K AR Y    G  N++RI+TF G
Sbjct: 69  TYNISTANKFAENLINNSFANTVFFANSGSEAVECGLKIARAYQNGKGNKNRYRILTFHG 128

Query: 130 AFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEG 189
           AFHGRT  T +   + ++ E   P I+  D  +  +++S+K  ISN    ILIEPIQG+G
Sbjct: 129 AFHGRTFLTCATNDRQKFSELLNPYIDWCDNIE-PNIESVKKAISNGIGVILIEPIQGQG 187

Query: 190 GVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGG 249
           G++ + E F+++LR++C++ D LL FD VQ G GRTGKLFAYE   +KPDI  +AKG+GG
Sbjct: 188 GIKVMSEVFMKELRELCNENDILLFFDCVQCGAGRTGKLFAYEHIGIKPDICALAKGIGG 247

Query: 250 GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILF 309
           GFP+GACLAT +VA  M  G HGST+GGN LA  +G  VL+ + S GFLENV    K L 
Sbjct: 248 GFPLGACLATEKVAKYMAVGMHGSTFGGNPLATSVGNAVLDELLSPGFLENVEVRGKYLK 307

Query: 310 EGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLT-APSSDNVVRILPP 368
             L  + ++FP M  EVRG+GL++G+K   +    A +     LLT   +SDNV+RILPP
Sbjct: 308 NKLENLASKFP-MIEEVRGKGLMLGIKVKMNNQKFAEELSHRGLLTVGVTSDNVLRILPP 366

Query: 369 LTITAEEIHEGLE 381
           L IT +EI EG+E
Sbjct: 367 LIITEKEIDEGIE 379


>gi|209544309|ref|YP_002276538.1| acetylornithine transaminase protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531986|gb|ACI51923.1| acetylornithine and succinylornithine aminotransferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 401

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 167/384 (43%), Positives = 246/384 (64%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY+++D+ FE+G+G WL++ +G  FLD  +GIA +SLGH++P LV+ +  Q+ ++ H
Sbjct: 5   LMPTYNRADLAFERGEGCWLYAADGRRFLDLGAGIATSSLGHNNPRLVSAIAEQAARVMH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  Q E  A  L+ ++FAD VFF NSGAE+ E  +K  RR     G   + RI+ 
Sbjct: 65  VSNLYRVPQAERLAERLVAASFADSVFFCNSGAEANEGMVKMIRRAQARGGHPERNRIIC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+GAFHGRTLA ++A G  +YL+GFGP++ GFD     ++ +++  I+ +TA I+IEP+Q
Sbjct: 125 FDGAFHGRTLAMLAATGNPKYLDGFGPEVAGFDHVPMNNMNAVRAAITAETAGIMIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE G+      FLQ+LR  CD+    L  DEVQ G GRTG+LFA+EW+ V PD+++ AKG
Sbjct: 185 GESGINVADPRFLQELRAACDEFGLYLGMDEVQCGMGRTGRLFAHEWSGVTPDVLSTAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           + GGFP+GA LAT  VA  +  GSHG+T+GGN LA      VL+++ + GFL+ V     
Sbjct: 245 IAGGFPMGAILATETVARHLTPGSHGTTFGGNPLACAAANVVLDVLLAPGFLDQVQARGA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L   L  +   FP++F   RG GL++GL+     AL+      E +L+  + DNV+R++
Sbjct: 305 QLARALDELVAEFPDLFDGRRGIGLMLGLRCTVPVALVQDAAMHEGVLSVTAGDNVLRLV 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL IT  +  E   R+   A+++
Sbjct: 365 PPLVITEADCAEAGRRLRHAALRV 388


>gi|162147259|ref|YP_001601720.1| acetylornithine transaminase protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785836|emb|CAP55407.1| Acetylornithine aminotransferase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 401

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 167/384 (43%), Positives = 246/384 (64%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY+++D+ FE+G+G WL++ +G  FLD  +GIA +SLGH++P LV+ +  Q+ ++ H
Sbjct: 5   LMPTYNRADLAFERGEGCWLYAADGRRFLDLGAGIATSSLGHNNPHLVSAIAEQAARVMH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  Q E  A  L+ ++FAD VFF NSGAE+ E  +K  RR     G   + RI+ 
Sbjct: 65  VSNLYRVPQAERLAERLVAASFADSVFFCNSGAEANEGMVKMIRRAQAHGGHPERNRIIC 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+GAFHGRTLA ++A G  +YL+GFGP++ GFD     ++ +++  I+ +TA I+IEP+Q
Sbjct: 125 FDGAFHGRTLAMLAATGNPKYLDGFGPEVAGFDHVPMNNMNAVRAAITAETAGIMIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE G+      FLQ+LR  CD+    L  DEVQ G GRTG+LFA+EW+ V PD+++ AKG
Sbjct: 185 GESGINVADPRFLQELRAACDEFGLYLGMDEVQCGMGRTGRLFAHEWSGVTPDVLSTAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           + GGFP+GA LAT  VA  +  GSHG+T+GGN LA      VL+++ + GFL+ V     
Sbjct: 245 IAGGFPMGAILATEAVARHLTPGSHGTTFGGNPLACAAANVVLDVLLAPGFLDQVQARGA 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L   L  +   FP++F   RG GL++GL+     AL+      E +L+  + DNV+R++
Sbjct: 305 QLARALDELVAEFPDLFDGRRGIGLMLGLRCTVPVALVQDAAMHEGVLSVTAGDNVLRLV 364

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPL IT  +  E   R+   A+++
Sbjct: 365 PPLVITEADCAEAGRRLRHAALRV 388


>gi|73666845|ref|YP_302861.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Ehrlichia canis str. Jake]
 gi|72393986|gb|AAZ68263.1| acetylornithine aminotransferase apoenzyme [Ehrlichia canis str.
           Jake]
          Length = 391

 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 184/383 (48%), Positives = 243/383 (63%), Gaps = 4/383 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           N  L   Y  S + F  GKG +L+  +G  +LDF +GIA +SLGH+HP LV  LK+Q EK
Sbjct: 3   NSPLLPVYSPSSVTFSHGKGVYLYGYDGRKYLDFHAGIATSSLGHAHPVLVNALKTQGEK 62

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SNL+   +    A  L+  +FAD+VFF NSGAESV+C IK AR Y    G   ++R
Sbjct: 63  LWHLSNLHTIPEAIKLAQKLVDISFADKVFFNNSGAESVDCCIKIARSYQCGKGNNQRYR 122

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
            +T +G+FHGRT A  SA    ++     P +E FD     D+ S+KN I+  T AIL+E
Sbjct: 123 FITMKGSFHGRTYAACSANEPSKFSPLLKPYVEWFDSVN-PDITSIKNAINEHTGAILLE 181

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGG+  +   FL++LR ICD  D LLIFD VQ G GRTGK FAYE   V PDI  I
Sbjct: 182 PIQGEGGINVLDSSFLKELRAICDQNDILLIFDCVQCGAGRTGKFFAYEHVGVTPDICCI 241

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFPI A L+TN  A  M+ G HGST+GGN LA  +G  V+  I  DGFLENV  
Sbjct: 242 AKGLGGGFPISASLSTNNAAQFMSVGMHGSTFGGNPLATTIGMVVVEEILKDGFLENVTK 301

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLK--TVFSPALLAAKFRDECLLTAPSSDN 361
               L++ L  + N+FP +  +V+G+GL+IG+K  T  +   L  +  D  LLT+ +S N
Sbjct: 302 NGHYLYKKLKDLANKFP-IIEQVKGKGLMIGMKFNTNVNARELMYELIDYGLLTSTASGN 360

Query: 362 VVRILPPLTITAEEIHEGLERIE 384
           V+R++PPL I  +E+ EG+  +E
Sbjct: 361 VIRVIPPLIINQQELDEGVAILE 383


>gi|54288319|gb|AAV31607.1| predicted ornithine/acetylornithine aminotransferase [uncultured
           alpha proteobacterium EBAC2C11]
          Length = 418

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 173/379 (45%), Positives = 242/379 (63%), Gaps = 2/379 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY +++I FE+G+G WL SE G  +LD ASGIAVN+LGHSHP LVA L  Q+ KLWH
Sbjct: 27  VMQTYGRAEIGFERGEGCWLISETGDRYLDCASGIAVNTLGHSHPRLVAALIEQAGKLWH 86

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+   QE+ A  L   +  D+VFF NSGAE+ E A+K ARR  Y  G+  +  I+ 
Sbjct: 87  TSNLYRIPGQEVVAKLLASLSGLDQVFFCNSGAEATEAAVKIARRAAYEKGEQERMTILC 146

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            EGAFHGRTL  ++A  +  +  GFGP   GFD   F +L  L++ +    AA+++E +Q
Sbjct: 147 AEGAFHGRTLGMLAATDRPLFRTGFGPMPAGFDHVPFGNLNRLRDAMGPHVAAVMVESVQ 206

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG ++VP+ +L  +R   D+  AL+I DEVQ G GRTG+LF+YE + +KPDI+ +AKG
Sbjct: 207 GEGGAKRVPDGYLLGVRAAADEFGALVIADEVQAGIGRTGRLFSYEDSKIKPDIVALAKG 266

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           + GGFPIGA + +  V   M  G+HGST+GGN LAM   + VL ++  +GFL +V   A 
Sbjct: 267 LAGGFPIGAVITSKVVGDAMTPGTHGSTFGGNPLAMAAAQVVLEVLSEEGFLADVRARAV 326

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLK--TVFSPALLAAKFRDECLLTAPSSDNVVR 364
            L + L A++ +FP    E RG G L G++       A      RD+ LL  P+++N +R
Sbjct: 327 HLDDALQALQEQFPTAIAECRGCGFLRGIRLDETIDLAAFVKTLRDDNLLCVPAAENTLR 386

Query: 365 ILPPLTITAEEIHEGLERI 383
           +LPPLTI+ +EI   + +I
Sbjct: 387 LLPPLTISNDEIDLAVAKI 405


>gi|330994136|ref|ZP_08318064.1| Acetylornithine aminotransferase [Gluconacetobacter sp. SXCC-1]
 gi|329758603|gb|EGG75119.1| Acetylornithine aminotransferase [Gluconacetobacter sp. SXCC-1]
          Length = 429

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 178/384 (46%), Positives = 251/384 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y+++D+ FE+G+GAWL++ +G  FLDF SGIA +S+GH++P LVA +  Q++++ H
Sbjct: 34  LMPNYNRADLAFERGEGAWLYTVDGRRFLDFGSGIATSSVGHNNPHLVAAIAQQAQRVMH 93

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  Q E  A  L+ ++FAD  FF NSGAE+ E  IK  RR    +G   + RI+ 
Sbjct: 94  VSNLYRVPQAERLAERLVANSFADSAFFCNSGAEANEGLIKMIRRAQAKSGHPGRTRIIC 153

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGRTLAT+SA G  +YL+GFGP++EGFD     ++ ++++ IS +TA ILIEP+Q
Sbjct: 154 FNGAFHGRTLATLSATGNPKYLDGFGPRVEGFDHVPLNNMNAVRDVISAETAGILIEPVQ 213

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE G+      F+++LR  CD+    L  DEVQ G GRTG+LFAYEW+ + PDI++ AKG
Sbjct: 214 GESGIHVADFRFMRELRAACDEYGLFLGVDEVQCGMGRTGRLFAYEWSEITPDILSTAKG 273

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           + GGFP+GA L T  +A  M  GSHG+T+GG  LA      VL+I+ + GFLE V   A 
Sbjct: 274 IAGGFPMGAVLTTETIAKHMTPGSHGTTFGGGPLACAAANAVLDIVLAPGFLEGVRARAA 333

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L EG   +   +P++F   RG GLL+GLK     AL+      E +L+  + DNV+R+L
Sbjct: 334 QLDEGFDRLSATYPDIFAGRRGLGLLLGLKCKADVALVQDAAMHEGMLSVTAGDNVLRLL 393

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPLT+T  +  + L  +E  A +L
Sbjct: 394 PPLTVTQADCSQALTMLEGAARRL 417


>gi|296284923|ref|ZP_06862921.1| acetylornithine transaminase protein [Citromicrobium bathyomarinum
           JL354]
          Length = 397

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 240/383 (62%), Gaps = 2/383 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y + D+R  KG+   L  E+G  +LDFASGIAVN LGHSH  L+  ++ Q+E L H
Sbjct: 6   LMPVYPRCDVRPVKGEHCHLIDEDGTRYLDFASGIAVNLLGHSHEGLIGAIQRQAETLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYH-YMAGKTNKFRIV 125
           VSNLY S  QE  A  L+ ++FAD VFFTNSGAE+VECAIKTAR +H +  G   +  ++
Sbjct: 66  VSNLYGSPHQEKLAQMLVDASFADTVFFTNSGAEAVECAIKTARAFHQHEDGDPARTELI 125

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           TF  AFHGRT+ATISA  + +   GF P ++GF   +F DL + K  I   TA  L+EPI
Sbjct: 126 TFTSAFHGRTMATISASNQAKMHHGFLPLLQGFKYCEFDDLAAAKAAIGPQTAGFLVEPI 185

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+R   +EF+Q LR + D+   +L+ DEVQ G  RTGK +A+E   VKPDI+  AK
Sbjct: 186 QGEGGIRPASQEFMQGLRDLADEHGLMLVLDEVQCGVARTGKFYAHELYGVKPDIVASAK 245

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GACLAT   A  M  G+HGSTYGGN LAM  G  V+  + +D FL+ V +  
Sbjct: 246 GIGGGFPLGACLATEHAARGMTFGTHGSTYGGNPLAMAAGVAVMEAVANDEFLQGVRDKG 305

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC-LLTAPSSDNVVR 364
             L   L      +P++F  VRG+GL++G+K            RD+  LLT  + DN +R
Sbjct: 306 ARLKARLEQFIGNYPDLFELVRGEGLMLGIKMKVESRPFFQHLRDKHQLLTVAAGDNTLR 365

Query: 365 ILPPLTITAEEIHEGLERIERTA 387
           +LPPL +   EI E  +++   A
Sbjct: 366 VLPPLVVGDAEIDEFFDKLSAGA 388


>gi|83591516|ref|YP_425268.1| acetylornithine aminotransferase [Rhodospirillum rubrum ATCC 11170]
 gi|83574430|gb|ABC20981.1| acetylornithine aminotransferase [Rhodospirillum rubrum ATCC 11170]
          Length = 313

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 219/305 (71%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D L   +  + + F+ G+GAWL + NG  +LDF +GIAVN+LG+SHP LV  L+ Q  K
Sbjct: 2   SDALLPVFSPASVLFDHGEGAWLVAANGERYLDFGAGIAVNALGYSHPHLVGALERQGRK 61

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+Y+ ++ E  A  L  + FAD  FF NSGAE+ ECAIK ARR+H+  G+  ++R
Sbjct: 62  LWHLSNVYRISEAERLAERLTAACFADVAFFANSGAEANECAIKIARRHHHAHGRPERWR 121

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+TF+GAFHGRTLAT++AGG  +YL+GFGP ++GFDQ    D+++++ ++   TAA++IE
Sbjct: 122 IITFDGAFHGRTLATMAAGGNRKYLDGFGPPVDGFDQCPLEDIEAVRARVGPRTAALMIE 181

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGE G+R V   FL+QLR++CD+   LLIFDE+Q G  RTG LFA++ A V PDIM++
Sbjct: 182 PIQGESGIRPVSHGFLRQLRELCDERGLLLIFDEIQCGMARTGHLFAHQEAGVVPDIMSL 241

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFPIGACLAT   A  M  G+HGST+GGN LA  +   VL+I+  DG L  +  
Sbjct: 242 AKGLGGGFPIGACLATRGAAFGMRPGAHGSTFGGNPLAGAVANAVLDIVMDDGVLAEIRR 301

Query: 304 IAKIL 308
            + +L
Sbjct: 302 KSALL 306


>gi|254450498|ref|ZP_05063935.1| acetylornithine aminotransferase [Octadecabacter antarcticus 238]
 gi|198264904|gb|EDY89174.1| acetylornithine aminotransferase [Octadecabacter antarcticus 238]
          Length = 369

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 240/363 (66%), Gaps = 1/363 (0%)

Query: 30  NGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFA 89
           +G  FLD  +GIAVN LGH+HP+LVA L  Q+ KLWHVSNLY    Q+  A+ L+  TFA
Sbjct: 4   DGRRFLDLGAGIAVNVLGHAHPDLVAALTQQANKLWHVSNLYNIQPQQELADLLVEHTFA 63

Query: 90  DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLE 149
           D VFFTNSG E+ E A+K AR+YHY  G   +  I+TF+G+FHGR+ A I+A G  +  +
Sbjct: 64  DTVFFTNSGTEACELAVKMARKYHYDKGAPERTDIITFDGSFHGRSAAGIAAAGSEKMTK 123

Query: 150 GFGPKIEGFDQAKFCDLQSLKNQISNDT-AAILIEPIQGEGGVRKVPEEFLQQLRKICDD 208
           GFGP + GF    F D  +L    ++ T  AI++EP+QGEGG+R +P+  L+ LR +CD+
Sbjct: 124 GFGPLLPGFVHLPFGDHDALTQAAASPTVGAIMVEPVQGEGGIRALPDACLKGLRDLCDE 183

Query: 209 IDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQ 268
              L+I DEVQ G  RTGKLFA+EW+ + PDIM +AKG+GGGFP+GA LA    A+ M  
Sbjct: 184 HGILMILDEVQCGVARTGKLFAHEWSGITPDIMMVAKGIGGGFPLGAVLAIQNAASGMTA 243

Query: 269 GSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRG 328
           G+HGSTYGGN LA  +G KV++I+ +  F+  V   A +L + L  +    P +F  VRG
Sbjct: 244 GTHGSTYGGNPLACAVGCKVMDIVANPDFIAEVNRKAGLLRQKLEGLVAGHPAVFEAVRG 303

Query: 329 QGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAI 388
            GL++GLK       +      E LLT P++DNV+R+LPPL IT  EI E ++R+++ A 
Sbjct: 304 SGLMLGLKCNAPNTDIVQAGYSENLLTVPAADNVIRLLPPLNITDTEIEEAVDRLKKAAS 363

Query: 389 KLS 391
           K++
Sbjct: 364 KVA 366


>gi|58584389|ref|YP_197962.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418705|gb|AAW70720.1| Ornithine/acetylornithine aminotransferase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 397

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 179/376 (47%), Positives = 246/376 (65%), Gaps = 3/376 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y   +I F  GKG +L++ +G  ++DF SGIAV+SLGH++ +L ++L  Q E+LWH
Sbjct: 6   ILPVYSPININFSYGKGIYLYNIDGKRYIDFHSGIAVSSLGHTNLQLTSVLNLQGERLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN Y       FA  LI+++FAD VFF NSG+E+VEC +K AR Y    G  N++RI+T
Sbjct: 66  ISNTYNIPTANNFAEKLINNSFADTVFFANSGSEAVECGLKIARVYQNGKGNKNRYRILT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGRT  T +   K ++ E   P I+  D  +  +++S+K  ISND   +LIEPIQ
Sbjct: 126 FHGAFHGRTFLTCATNDKRKFSELLNPYIDWCDNIE-PNIESVKKAISNDIGVMLIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           G+GG++ + + F+++LRK+CD+ D LL FD +Q G GRTGKLFAYE   VKPDI  +AKG
Sbjct: 185 GQGGIKVMNDAFMKELRKLCDENDILLFFDCIQCGTGRTGKLFAYEHIGVKPDICALAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+G CLAT + A  +  G HGST+GGN LA  +G  VL+ + S GFL NV    K
Sbjct: 245 IGGGFPLGVCLATEKAAQYITVGMHGSTFGGNPLATSVGNAVLDKLLSPGFLGNVEIRGK 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLT-APSSDNVVRI 365
            L   L  + ++FP +  EVRG+GL++G+K        A +     LLT   +SDNVVRI
Sbjct: 305 HLKNKLEDLASKFP-IIEEVRGKGLMLGIKVKMDNQKFAGELSHRGLLTVGATSDNVVRI 363

Query: 366 LPPLTITAEEIHEGLE 381
            PPL IT +EI EG+E
Sbjct: 364 FPPLIITEKEIDEGIE 379


>gi|42521078|ref|NP_966993.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|42410819|gb|AAS14927.1| acetylornithine aminotransferase, putative [Wolbachia endosymbiont
           of Drosophila melanogaster]
          Length = 391

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 183/376 (48%), Positives = 245/376 (65%), Gaps = 3/376 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y   +I F  GKG +L+  +G  ++DF SGIAV+SLGH++  L++ LK Q EKLWH
Sbjct: 6   ILPVYSPVNINFSHGKGIYLYDVDGERYVDFHSGIAVSSLGHTNSRLISALKLQGEKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN Y       FA  LI+++FAD VFF+NSG+E+VEC +K AR Y    G  N+ RI+T
Sbjct: 66  ISNTYNIPAANNFAEKLINNSFADTVFFSNSGSEAVECGLKIARIYQNGKGNKNRHRILT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGRT  T +   K ++ E   P I+  D  +  +++S+K  IS+    ILIEPIQ
Sbjct: 126 FHGAFHGRTFLTCATNDKQKFSELLNPYIDWCDNIE-PNIESVKKAISSGIGVILIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           G+GG++ + E F+++LR++CD+ D LL FD VQ G GRTGKLFAYE   V+PDI  +AKG
Sbjct: 185 GQGGIKVMNEVFMKELRRLCDENDILLFFDCVQCGAGRTGKLFAYEHIGVEPDICALAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT   A  M  G HGST+GGN LA  +G  VL  + S GFL+NV    K
Sbjct: 245 IGGGFPLGACLATENAAKYMAVGMHGSTFGGNPLATSVGNAVLEELLSPGFLKNVEIRGK 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLT-APSSDNVVRI 365
            L   L  + ++FP +  EVRG+GL++G+K        A +     LLT   +SDNVVRI
Sbjct: 305 YLKNKLEDLASKFP-IIEEVRGKGLMLGIKVKADNQKFAEELSHRGLLTVGVTSDNVVRI 363

Query: 366 LPPLTITAEEIHEGLE 381
           LPPL IT +EI EG+E
Sbjct: 364 LPPLIITEKEIDEGIE 379


>gi|85709644|ref|ZP_01040709.1| ornithine/acetylornithine aminotransferase [Erythrobacter sp. NAP1]
 gi|85688354|gb|EAQ28358.1| ornithine/acetylornithine aminotransferase [Erythrobacter sp. NAP1]
          Length = 399

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 179/385 (46%), Positives = 238/385 (61%), Gaps = 4/385 (1%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+   L  E+G  +LDFASGIAVN LGHSHP L   ++ Q+  L H
Sbjct: 6   LMPVYPRCGVRPVRGEHCHLIDEDGTRYLDFASGIAVNLLGHSHPGLTKAIQDQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGK---TNKFR 123
           VSNLY S Q E  A  L+  TFAD VFFTNSGAE+VE AIK AR YH  AG+    ++F 
Sbjct: 66  VSNLYGSPQGEKLAQQLVDKTFADTVFFTNSGAEAVEGAIKAARAYHQNAGEHGDKDRFE 125

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           ++TF  AFHGRT+ATISA  + +   GF P +EGF  A+F +L+S K  I   TA  L+E
Sbjct: 126 LITFSNAFHGRTMATISASNQTKMHHGFSPMLEGFKYAEFDNLESAKEFIGPRTAGFLVE 185

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGG+R   + F++ LR++ D  D +L+ DEVQ G  RTGK++AY+   ++PDI+  
Sbjct: 186 PIQGEGGIRPASDSFMKGLRELADQHDLMLVLDEVQCGVARTGKMYAYQHYGIEPDILAT 245

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFPIGA LAT + A  M  G+HGSTYGGN LAM  G  V++ + ++ FL  V  
Sbjct: 246 AKGLGGGFPIGAVLATEKAARGMTFGTHGSTYGGNPLAMAAGGAVMDAVANEEFLAEVTE 305

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-ECLLTAPSSDNV 362
             + +   L      +P +F  VRG+GL++G+K            RD   LLT  + D  
Sbjct: 306 KGERIRARLEQFIGNYPELFELVRGKGLMLGIKMKVESRPFFVHLRDNHQLLTVAAGDQT 365

Query: 363 VRILPPLTITAEEIHEGLERIERTA 387
           +R+LPPL I   EI E  E++   A
Sbjct: 366 LRVLPPLVIGDAEIDEFFEKLSAGA 390


>gi|294085449|ref|YP_003552209.1| ornithine/acetylornithine aminotransferase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665024|gb|ADE40125.1| Ornithine/acetylornithine aminotransferase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 398

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 243/372 (65%), Gaps = 2/372 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           + NTY +++I F +G G WL S++G  +LD ASGIAVN+LGH+HP LVA L++Q+ KLWH
Sbjct: 11  VMNTYGRTEIAFVRGDGCWLESDDGTRYLDCASGIAVNTLGHAHPGLVAALQAQAGKLWH 70

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+   QE  A  L   +  D+VFF NSGAE+ E ++K ARR  + AG   +  I+ 
Sbjct: 71  TSNLYRIPGQEAVAKKLASLSGLDQVFFCNSGAEATEASVKIARRAAHEAGMPERMTILC 130

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
             GAFHGRTL  ++A  +  +  GFGP   GF+   F +L SL+  +    AAI+IE +Q
Sbjct: 131 SSGAFHGRTLGMLAATDRPAFRTGFGPMPAGFEHVSFGNLNSLRAAMGPHVAAIMIEAVQ 190

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG ++VP +++ + R   D+  AL+I DEVQ G GRTG +F+++ + +KPDI+ +AKG
Sbjct: 191 GEGGAKQVPSDYMAEARAAADEFGALIIADEVQAGIGRTGHMFSFQESGIKPDIVALAKG 250

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           + GGFP+GA +A+ +V   M  G+HGST+GGN LAM   E VL+ +   GFL +V   A 
Sbjct: 251 LAGGFPVGAVIASEKVGNAMTPGTHGSTFGGNPLAMAAAEVVLDELSKPGFLADVQRRAA 310

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV--FSPALLAAKFRDECLLTAPSSDNVVR 364
           +L +GL  ++N +P+M  E+RG+G L G+     ++ A +    R + +L  P+++N +R
Sbjct: 311 LLDKGLRDLQNSYPHMIKELRGRGFLRGINFADDYNVATIMVGLRAQHVLAVPAAENTLR 370

Query: 365 ILPPLTITAEEI 376
           +LPPL I+  EI
Sbjct: 371 LLPPLIISENEI 382


>gi|89070723|ref|ZP_01157985.1| Acetylornithine Aminotransferase class-III [Oceanicola granulosus
           HTCC2516]
 gi|89043681|gb|EAR49886.1| Acetylornithine Aminotransferase class-III [Oceanicola granulosus
           HTCC2516]
          Length = 394

 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 187/371 (50%), Positives = 243/371 (65%), Gaps = 1/371 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY+++ + FEKG G+WL++ +G  FLD  +GIAVN+LGH+HP LV  L  Q+ K+WH
Sbjct: 5   ILPTYNRAPLSFEKGAGSWLWTTDGRRFLDLGAGIAVNALGHAHPALVETLTEQAGKVWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SNL++  QQ   A+ ++  TFAD VFFTNSG ES E A+K ARRY    G   + RI+T
Sbjct: 65  LSNLFEIPQQTRLADLIVDKTFADTVFFTNSGTESCELAVKMARRYWSDRGAPERSRILT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI-LIEPI 185
           F GAFHGR+ A I+A G  +  +GFGP + GF    F D  +L+   +    A  L+EPI
Sbjct: 125 FTGAFHGRSSAAIAAAGSEKMTKGFGPLLPGFTVLPFGDHDTLREAAAAPDIAAILVEPI 184

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+R +P+  L+ LR +CD+  ALLIFDEVQ G GRTGKLFA+EWA V PDIM IAK
Sbjct: 185 QGEGGIRVLPDVCLKGLRDLCDETGALLIFDEVQCGVGRTGKLFAHEWAGVAPDIMMIAK 244

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GA  AT   A  M  G+HGSTYGGN L   +G +VL I+  D FL  V   A
Sbjct: 245 GIGGGFPLGAVAATEAAARAMTAGTHGSTYGGNPLGCAIGARVLEIVGDDAFLAEVNRKA 304

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
             L + L  +    P +F EVRG GL++GLK     A L A    E +LT  ++DNVVR+
Sbjct: 305 GALRQRLEGLVAAHPEVFEEVRGTGLMLGLKCKPPAADLVAAGYAEEVLTVAAADNVVRL 364

Query: 366 LPPLTITAEEI 376
           LP L I+ E+I
Sbjct: 365 LPALNISDEDI 375


>gi|42520417|ref|NP_966332.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|42410156|gb|AAS14266.1| acetylornithine aminotransferase [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 392

 Score =  342 bits (877), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 170/375 (45%), Positives = 244/375 (65%), Gaps = 2/375 (0%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           D + N Y++ D    +G+GA+LF ++G  +LDFA+GI+  SLGH HP +   LK QS  L
Sbjct: 2   DHVVNAYNRLDTPIVRGEGAYLFDKDGKKYLDFAAGISTTSLGHCHPYITDKLKEQSSSL 61

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WH SN++   +QE  A HL   TFAD+VFF +SG E+ E AIK  RRY Y  G+  + RI
Sbjct: 62  WHCSNIFTIPEQERLAEHLTTLTFADKVFFCSSGLEATEAAIKFIRRYFYSKGQAKRNRI 121

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           +T EG FHGR++A ISAGG  +  EGF P + GFD+    ++++L+ +I+N+ AA+ +EP
Sbjct: 122 ITIEGGFHGRSIAAISAGGNEKSREGFAPLLSGFDKVPRNNIKALEEKINNEIAAVFLEP 181

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQ EGGV  +  E+LQ++R+I      +L FDEVQ GYGR G LF Y+   ++PD++T A
Sbjct: 182 IQSEGGVYPLDVEYLQKVREITKAQGIILCFDEVQCGYGRIGSLFHYQNVGIEPDMLTCA 241

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K MG GFP+ ACL  + +A  +  G+HGSTYGGN LAM +G  VL+I+  +GF ++V  I
Sbjct: 242 KAMGNGFPVAACLVKDYIAEAITPGTHGSTYGGNPLAMTVGNAVLDIMLKEGFFDHVKRI 301

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDNV 362
           +K L E L  +   FP M LEVRG+GLL+G  L T+ +  +++       ++T   ++ V
Sbjct: 302 SKYLKEKLLLLAKEFPEMILEVRGEGLLMGIELATLVADKIISRSLDKGLIITRVLNNKV 361

Query: 363 VRILPPLTITAEEIH 377
           VR+ PPL I  E ++
Sbjct: 362 VRVTPPLIIEDEHVN 376


>gi|58696690|ref|ZP_00372240.1| Acetylornithine aminotransferase (ACOAT) [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58698385|ref|ZP_00373298.1| Acetylornithine aminotransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630986|ref|YP_002727777.1| Ornithine/acetylornithine aminotransferase [Wolbachia sp. wRi]
 gi|58535098|gb|EAL59184.1| Acetylornithine aminotransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58537132|gb|EAL60242.1| Acetylornithine aminotransferase (ACOAT) [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592967|gb|ACN95986.1| Ornithine/acetylornithine aminotransferase [Wolbachia sp. wRi]
          Length = 391

 Score =  342 bits (876), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 245/376 (65%), Gaps = 3/376 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y   +I F  GK  +L+  +G  ++DF SGIAV+SLGH++  L++ LK Q EKLWH
Sbjct: 6   ILPVYSPININFSYGKDIYLYDIDGKRYVDFHSGIAVSSLGHTNSRLISALKLQGEKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN Y       FA  LI+++FAD VFF+NSG+E+VEC +K AR Y    G  N+ RI+T
Sbjct: 66  ISNTYNIPAANNFAEKLINNSFADTVFFSNSGSEAVECGLKIARIYQNGKGNKNRHRILT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGRT  T +   K ++ E   P I+  D  +  +++S+K  IS+    ILIEPIQ
Sbjct: 126 FHGAFHGRTFLTCATNDKQKFSELLNPYIDWCDNIE-PNIESVKKAISSGIGVILIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           G+GG++ + E F+++LR++CD+ D LL FD VQ G GRTGKLFAYE   V+PDI  +AKG
Sbjct: 185 GQGGIKVMNEVFMKELRRLCDENDILLFFDCVQCGAGRTGKLFAYEHIGVEPDICALAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G HGST+GGN LA  +G  VL  + S GFL+NV    K
Sbjct: 245 IGGGFPLGACLATEKAAKYMAVGMHGSTFGGNPLATSVGNAVLEELLSPGFLKNVEIRGK 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLT-APSSDNVVRI 365
            L   L  + ++FP +  EVRG+GL++G+K        A +     LLT   +SDNVVRI
Sbjct: 305 YLKNKLEDLASKFP-IIEEVRGKGLMLGIKVKADNQKFAEELSHRGLLTVGVTSDNVVRI 363

Query: 366 LPPLTITAEEIHEGLE 381
           LPPL IT +EI EG+E
Sbjct: 364 LPPLIITEKEIDEGIE 379


>gi|58696861|ref|ZP_00372379.1| acetylornithine aminotransferase [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58698709|ref|ZP_00373597.1| acetylornithine aminotransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630183|ref|YP_002726974.1| acetylornithine aminotransferase [Wolbachia sp. wRi]
 gi|58534766|gb|EAL58877.1| acetylornithine aminotransferase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58536932|gb|EAL60106.1| acetylornithine aminotransferase [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592164|gb|ACN95183.1| acetylornithine aminotransferase [Wolbachia sp. wRi]
          Length = 392

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/375 (45%), Positives = 243/375 (64%), Gaps = 2/375 (0%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           D + N Y++ D    +G+GA+LF ++G  +LDFA+GI+  SLGH HP +   LK QS  L
Sbjct: 2   DHVVNAYNRLDTPIVRGEGAYLFDKDGKKYLDFAAGISTTSLGHCHPYITDKLKEQSSSL 61

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WH SN++   +QE  A  L   TFAD+VFF +SG E+ E AIK  RRY Y  G+  + RI
Sbjct: 62  WHCSNIFTIPEQERLAERLTTLTFADKVFFCSSGLEATEAAIKFIRRYFYSKGQAKRNRI 121

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           +T EG FHGR++A ISAGG  +  EGF P + GFD+    D+++L+ +I+N+ AA+ +EP
Sbjct: 122 ITIEGGFHGRSIAAISAGGNEKSREGFAPLLSGFDKVPRNDIKALEEKINNEIAAVFLEP 181

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQ EGGV  +  E+LQ++R+I      +L FDEVQ GYGR G LF Y+   ++PD++T A
Sbjct: 182 IQSEGGVYPLDVEYLQKVREITKAQGIILCFDEVQCGYGRIGSLFHYQNVGIEPDMLTCA 241

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K MG GFP+ ACL  + +A  +  G+HGSTYGGN LAM +G  VL+I+  +GF ++V  I
Sbjct: 242 KAMGNGFPVAACLVKDYIAEAITPGTHGSTYGGNPLAMTVGNAVLDIMLKEGFFDHVKRI 301

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDNV 362
           +K L E L  +   FP M LEVRG+GLL+G  L T+ +  +++       ++T   ++ V
Sbjct: 302 SKYLKEKLLLLAKEFPEMILEVRGEGLLMGIELATLVADKIISRSLDKGLIITRVLNNKV 361

Query: 363 VRILPPLTITAEEIH 377
           VR+ PPL I  E ++
Sbjct: 362 VRVTPPLIIEDEHVN 376


>gi|99036041|ref|ZP_01315078.1| hypothetical protein Wendoof_01000072 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 392

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 170/375 (45%), Positives = 243/375 (64%), Gaps = 2/375 (0%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           D + N Y++ D    +G+GA+LF ++G  +LDFA+GI+  SLGH HP +   LK QS  L
Sbjct: 2   DHVVNAYNRLDTPIVRGEGAYLFDKDGKKYLDFAAGISTTSLGHCHPYITDKLKEQSSSL 61

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WH SN++   +QE  A  L   TFAD+VFF +SG E+ E AIK  RRY Y  G+  + RI
Sbjct: 62  WHCSNIFTIPEQERLAERLTTLTFADKVFFCSSGLEATEAAIKFIRRYFYSKGQAKRNRI 121

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           +T EG FHGR++A ISAGG  +  EGF P + GFD+    D+++L+ +I+N+ AA+ +EP
Sbjct: 122 ITIEGGFHGRSIAAISAGGNEKSREGFAPLLSGFDKVPRNDIKALEGKINNEIAAVFLEP 181

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQ EGGV  +  E+LQ++R+I      +L FDEVQ GYGR G LF Y+   ++PD++T A
Sbjct: 182 IQSEGGVYPLDVEYLQKVREITKAQGIILCFDEVQCGYGRIGSLFHYQNVGIEPDMLTCA 241

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K MG GFP+ ACL  + +A  +  G+HGSTYGGN LAM +G  VL+I+  +GF ++V  I
Sbjct: 242 KAMGNGFPVAACLVKDYIAEAITPGTHGSTYGGNPLAMTVGNAVLDIMLKEGFFDHVKRI 301

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDNV 362
           +K L E L  +   FP M LEVRG+GLL+G  L T+ +  +++       ++T   ++ V
Sbjct: 302 SKYLKEKLLLLAKEFPEMILEVRGEGLLMGIELATLVADKIISRSLDKGLIITRVLNNKV 361

Query: 363 VRILPPLTITAEEIH 377
           VR+ PPL I  E ++
Sbjct: 362 VRVTPPLIIEDEHVN 376


>gi|114328938|ref|YP_746095.1| acetylornithine transaminase protein [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317112|gb|ABI63172.1| acetylornithine aminotransferase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 437

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 171/386 (44%), Positives = 252/386 (65%), Gaps = 1/386 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y+++D+ FE+G+GAWL + NG  +LDF +GIA +SLGH+HP L   + +Q+ K+ H
Sbjct: 44  LMPNYNRADLAFERGEGAWLTAVNGRRYLDFGAGIATSSLGHAHPGLTGAIAAQAAKVMH 103

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY+  + E  A  L   +FA+  FF NSGAE+ E  +K  RR     G   ++R++ 
Sbjct: 104 VSNLYRVPEAERLAERLTAHSFAEAAFFCNSGAEANEGLVKLIRRTQSETGHPERWRMIC 163

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+GAFHGRTLA +SA G  +Y  GFGP ++GFDQ    D+ +++  I+ +TA ILIEP+Q
Sbjct: 164 FQGAFHGRTLAMLSATGNPKYQAGFGPAVDGFDQVPPGDIAAVRAAITPETAGILIEPVQ 223

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA-NVKPDIMTIAK 245
           GEGG+R +  +FL+QLR +CD+   LL +DE+Q G GRTG+L+A+EWA +  PD+M+ AK
Sbjct: 224 GEGGIRVIALDFLRQLRALCDEHGLLLGYDEIQCGMGRTGRLWAHEWAGDAAPDVMSSAK 283

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+ GGFP+GA LA + +A  +  G+HG+TYGGN LA      VL+++ + GFL+ V    
Sbjct: 284 GIAGGFPMGAVLARHALARHLTPGTHGTTYGGNPLACAAANAVLDVVLAPGFLDAVQQRG 343

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
           + L  GL AI   +P++F EVRG+GLL+GL    +   +    R+  LL+  + +NV+R+
Sbjct: 344 QQLRTGLEAIARDYPHIFKEVRGKGLLLGLLCGPANTAVQEALRENGLLSVAAGENVLRL 403

Query: 366 LPPLTITAEEIHEGLERIERTAIKLS 391
            PPL +T  +    L  I  TA+  +
Sbjct: 404 APPLVVTEADCDAALSIIRETAVTFA 429


>gi|225677421|ref|ZP_03788387.1| acetylornithine aminotransferase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590527|gb|EEH11788.1| acetylornithine aminotransferase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 392

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 171/375 (45%), Positives = 242/375 (64%), Gaps = 2/375 (0%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           D + N Y++ D    +G+GA+LF E+G  +LDFA+GI+  SLGH HP +   LK QS  L
Sbjct: 2   DHVVNAYNRLDTPIVRGEGAYLFDEDGKKYLDFAAGISTTSLGHCHPYITDKLKEQSSSL 61

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WH SN++   +QE  A  L   TFAD+VFF +SG E+ E AIK  RRY Y  G+  + RI
Sbjct: 62  WHCSNIFTIPEQERLAERLTTLTFADKVFFCSSGLEATEAAIKFIRRYFYSKGQAKRNRI 121

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           +T EG FHGR++A ISAGG  +  EGF P + GFD+    D+++L+ +I+N+ AA+ +EP
Sbjct: 122 ITIEGGFHGRSIAAISAGGNEKSREGFAPLLSGFDKVPRNDIKALEEKINNEIAAVFLEP 181

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQ EGGV  +  E+LQ++R+I      +L FDEVQ GYGR G LF Y+   ++PD++T A
Sbjct: 182 IQSEGGVYPLDVEYLQKVREITKAQGIILCFDEVQCGYGRIGSLFHYQNVGIEPDMLTCA 241

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K MG GFP+ ACL  + +A  +  G+HGSTYGGN LAM +G  VL+I+  +GF ++V  I
Sbjct: 242 KAMGNGFPLAACLVKDYIAEAITPGTHGSTYGGNPLAMTVGNAVLDIMLKEGFFDHVKKI 301

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDNV 362
           +K L E L  +   FP M LEVRG+GLL+G  L T  +  +++       ++T   ++ V
Sbjct: 302 SKDLKEKLLLLAKEFPEMILEVRGEGLLMGIELATPVADKIISRSLDKGLIITRVLNNKV 361

Query: 363 VRILPPLTITAEEIH 377
           VR+ PPL I  E ++
Sbjct: 362 VRVTPPLIIEDEHVN 376


>gi|308051111|ref|YP_003914677.1| acetylornithine aminotransferase apoenzyme [Ferrimonas balearica
           DSM 9799]
 gi|307633301|gb|ADN77603.1| acetylornithine aminotransferase apoenzyme [Ferrimonas balearica
           DSM 9799]
          Length = 405

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 180/398 (45%), Positives = 244/398 (61%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y+ + I   +G+G+ ++ ++G  F+DFA GIAVN LGH HP LV  L  Q  K
Sbjct: 13  DDVMVPNYNPAAIIPVRGEGSRVWDQSGREFIDFAGGIAVNCLGHCHPALVKALNEQGNK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+ STFA+RV+F NSGAE+ E A+K ARRY        K +
Sbjct: 73  LWHLSNVMTNEPALQLAKTLVDSTFAERVYFANSGAEANEAALKLARRYALEHHGEEKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T+S GG+  Y +GFGPK  G D   + D++  K  IS+ T A+++E
Sbjct: 133 IIAFTQGFHGRTFFTVSVGGQPAYSDGFGPKPGGIDHLAYNDIEGFKALISDRTCAVMLE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGG+     EFL+Q+R++CD  +ALLIFDEVQTG GRTGKL+AYE   + PDI+T 
Sbjct: 193 PIQGEGGIVPADAEFLRQVRELCDQHNALLIFDEVQTGVGRTGKLYAYEHYGIAPDILTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T +VAA +  G+HGSTYGGN LA  +   VL+++ +D  L  V  
Sbjct: 253 AKALGGGFPIAAMLTTAKVAASLKVGTHGSTYGGNPLACAVANAVLDVVNTDAVLNGVAQ 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DEC 352
               L  GL AI  +F ++F EVRG+GLL+G       A+L  +++           DE 
Sbjct: 313 REAQLRAGLEAINAKF-DVFSEVRGKGLLMG-------AVLNEQYKGKARDFLVASVDEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           L+   +  NVVR  P L I   ++ EGL R ER   K+
Sbjct: 365 LMCLVAGANVVRFTPSLVIPEADLAEGLARFERAVAKV 402


>gi|85375610|ref|YP_459672.1| acetylornithine transaminase protein [Erythrobacter litoralis
           HTCC2594]
 gi|84788693|gb|ABC64875.1| ornithine/acetylornithine aminotransferase [Erythrobacter litoralis
           HTCC2594]
          Length = 397

 Score =  338 bits (867), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 178/383 (46%), Positives = 233/383 (60%), Gaps = 2/383 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y +  +R  +G+   L  E+G  +LDFASGIAVN LGHSH  L+  ++ Q+  L H
Sbjct: 6   LMPVYPRCGVRPVRGEHCHLIDEDGTRYLDFASGIAVNLLGHSHEGLIGAIQQQAATLMH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMA-GKTNKFRIV 125
           VSNLY S Q E  A  L+  TFAD VFFTNSGAE+VE AIKTAR YH    G   +  ++
Sbjct: 66  VSNLYGSPQGEELARKLVDKTFADTVFFTNSGAEAVETAIKTARAYHQQEDGDAQRTELI 125

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           TF  AFHGRT+ATISA  + +  +GF P + GF   +F DL   K+ I   TA  L+EPI
Sbjct: 126 TFTNAFHGRTMATISASNQEKMHKGFQPLLPGFKYCEFDDLDMAKSLIGPQTAGFLVEPI 185

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+R   + F+  LR +CD+ D +L  DEVQ G  RTG L+AYE   ++PDI+  AK
Sbjct: 186 QGEGGIRPASDAFMHGLRDLCDEHDLMLALDEVQCGVARTGTLYAYEQYGIEPDILATAK 245

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFP+GACLAT + A  M  G+HGSTYGGN LAM  G  V+  + +D FL  V    
Sbjct: 246 GIGGGFPLGACLATEKAARGMVFGTHGSTYGGNPLAMAAGMAVMTAVANDEFLAEVREKG 305

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC-LLTAPSSDNVVR 364
           + +   L      +P++F  VRG+GL++G+K            RD   LLT  + DN +R
Sbjct: 306 ERIRTRLEQFIGNYPDLFELVRGKGLMLGIKMKVESRPFFVHLRDHHQLLTVAAGDNTLR 365

Query: 365 ILPPLTITAEEIHEGLERIERTA 387
           +LPPL I   EI E  +++   A
Sbjct: 366 VLPPLVIGDAEIDEFFDKLSAGA 388


>gi|255263629|ref|ZP_05342971.1| acetylornithine and succinylornithine aminotransferases subfamily
           protein [Thalassiobium sp. R2A62]
 gi|255105964|gb|EET48638.1| acetylornithine and succinylornithine aminotransferases subfamily
           protein [Thalassiobium sp. R2A62]
          Length = 390

 Score =  338 bits (867), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 174/370 (47%), Positives = 243/370 (65%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY ++ + F  G G+WL +++G  +LD  +GIAVN+LGH+HP L   L  Q+ +LWH
Sbjct: 5   VLPTYSRAPLTFVSGAGSWLTTDDGDRYLDLGAGIAVNALGHAHPALTQALTEQAGQLWH 64

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY    Q   A+ L+  TFAD VFFTNSG E+ E A+K AR+Y Y AG   +  I+T
Sbjct: 65  TSNLYNIPAQTALADKLVDLTFADTVFFTNSGTEACELAVKMARKYFYDAGAPERVDIIT 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F+G+FHGR+ A I+A G  +  +GFGP + GF    F D  +L   I++ TAAILIEP+Q
Sbjct: 125 FDGSFHGRSAAGIAAAGSEKMTKGFGPILGGFTHLAFGDHDTLTAAITDTTAAILIEPVQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+R VP+  L+ LR +CD    LLI DEVQ G GRTGKLFA+EW+ + PDIM +AKG
Sbjct: 185 GEGGIRPVPDHCLKGLRDLCDTNGILLIMDEVQCGVGRTGKLFAHEWSGITPDIMMVAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+G  LAT   A+ M  G+HGSTYGGN LA  +G  V++I+ +  FL++V   A 
Sbjct: 245 IGGGFPLGCVLATEHAASGMTAGTHGSTYGGNPLACAVGNAVIDIVSAPEFLDDVNRKAG 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +     ++F EVRG GL++GLK   +   +        ++T P++DNV+R+L
Sbjct: 305 LLRQRLEGLVANQADVFEEVRGSGLMLGLKCKATNMDVVNAGYANGVITVPAADNVIRLL 364

Query: 367 PPLTITAEEI 376
           P L +T ++I
Sbjct: 365 PALNLTDDDI 374


>gi|88658406|ref|YP_507681.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Ehrlichia chaffeensis str. Arkansas]
 gi|88599863|gb|ABD45332.1| acetylornithine/succinyldiaminopimelate aminotransferase [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 392

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 181/386 (46%), Positives = 240/386 (62%), Gaps = 5/386 (1%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           MN +  L   Y  S + F  GKG +L+  N   ++DF +GIA +SLGH+HP LV  LK+Q
Sbjct: 1   MNSSPIL-PVYAPSKVTFSHGKGVYLYDYNNKKYVDFHAGIATSSLGHAHPALVNALKTQ 59

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
            EKLWH+SN++   +    A  L+  +FAD+VFF NSGAESVEC +K AR Y    G T 
Sbjct: 60  GEKLWHISNVHTIPEAIKLAQKLVDISFADKVFFNNSGAESVECCLKIARSYQCGKGNTQ 119

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           ++R +T + ++HGRT A  SA    ++     P +E FD     D+ S+KN I+    AI
Sbjct: 120 RYRFITMKQSYHGRTCAACSANDPSKFSPFLKPYVEWFDCVNP-DITSIKNAINETIGAI 178

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           L+EPIQGEGG+  + + FL++LR ICD  D LLIFD VQ G GRTGK FA+E   V PDI
Sbjct: 179 LLEPIQGEGGINVLDDSFLKELRTICDQNDILLIFDCVQCGSGRTGKFFAHEHTGVTPDI 238

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
             +AKG+GGGFPI A LATN  +  M  G HGST+GGN LA  +G  V+  I  DGFL+N
Sbjct: 239 CCLAKGLGGGFPISATLATNNASQFMGVGMHGSTFGGNPLATTIGMTVVEEILKDGFLDN 298

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLK--TVFSPALLAAKFRDECLLTAPS 358
           V      L++ L  +  +FP +  EV+G+GL+IGLK  T  +   L        LLT  +
Sbjct: 299 VTKNGHYLYKRLEDLAKKFP-VIEEVKGKGLMIGLKINTNINNRELMHDLISCGLLTNTA 357

Query: 359 SDNVVRILPPLTITAEEIHEGLERIE 384
           S+N +RI+PPL IT +EI EGL  +E
Sbjct: 358 SNNTLRIVPPLIITQQEIDEGLAILE 383


>gi|190571150|ref|YP_001975508.1| acetylornithine aminotransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018554|ref|ZP_03334362.1| acetylornithine aminotransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357422|emb|CAQ54856.1| acetylornithine aminotransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995505|gb|EEB56145.1| acetylornithine aminotransferase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 392

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 162/375 (43%), Positives = 241/375 (64%), Gaps = 2/375 (0%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           D + N Y++S+    +G+G +LF ++G  +LDFA+GI+  SLGH HP +   LK Q + L
Sbjct: 2   DHVVNAYNRSEASIVRGEGVYLFDKDGKKYLDFAAGISTTSLGHCHPYITDKLKEQLDSL 61

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           WH SN++   QQE  A  L   TFAD+VFF +SG E+ E AIK  RRY Y+ G+  +  I
Sbjct: 62  WHCSNIFTIPQQERLAQRLTELTFADKVFFCSSGLEATEAAIKFIRRYFYLNGQEKRSHI 121

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           +T EG FHGR++A ISAGG  +  EGF P + GFD+    ++++L+ +I+++TAAI +EP
Sbjct: 122 ITIEGGFHGRSIAAISAGGNEKSREGFAPLLSGFDKVPRNNIEALEKKINSETAAIFLEP 181

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQ EGGV  +  E+L+++R+I      +L FDEVQ GYGR G LF Y+   V+PD++T A
Sbjct: 182 IQSEGGVHPLDVEYLKKVREITKAQGIILCFDEVQCGYGRIGSLFYYQNIGVEPDMLTCA 241

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K MG GFP+ ACL  + +A  +  G+HGSTYGGN LAM +G  VL+++  +GF ++V  +
Sbjct: 242 KAMGNGFPLAACLVKDYIAEAITPGTHGSTYGGNPLAMTVGNAVLDVMLKEGFFDHVKKV 301

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDNV 362
           +K L E L  +   FP +  EVRG+GLLIG  L+   +  ++        ++T   ++ V
Sbjct: 302 SKYLKEKLLPLTEEFPKIISEVRGEGLLIGIELRVPLADKIVKQSLDKGLIMTNILNNKV 361

Query: 363 VRILPPLTITAEEIH 377
           +RI PPL + +  ++
Sbjct: 362 IRITPPLVVESMHVN 376


>gi|261344427|ref|ZP_05972071.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Providencia rustigianii DSM 4541]
 gi|282567330|gb|EFB72865.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Providencia rustigianii DSM 4541]
          Length = 405

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 244/390 (62%), Gaps = 6/390 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +  +   Y  ++    KG+G+ ++ + G  ++DFA GIAV +LGH HP LVA ++ QSEK
Sbjct: 13  DQVMLPIYSPAEFIPVKGQGSRVWDQQGKEYIDFAGGIAVLALGHCHPSLVAAVRKQSEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWHVSN++ + +    A  LI++TFADRVFF NSGAE+ E A K AR Y        K +
Sbjct: 73  LWHVSNIFTNEEALTLAQKLINATFADRVFFVNSGAEANEAAFKLARHYAITKHSPYKTK 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+ +Y +GFGPK        F DL ++K  I  +T A+++E
Sbjct: 133 IIAFKQAFHGRTFFTVSVGGQAKYADGFGPKPADIIHVPFNDLDAVKAVIDENTCAVVLE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGGV     EF+Q LR++CD+  ALL+FDEVQ+G GRTGKLF+Y    + PD++T 
Sbjct: 193 PVQGEGGVTAATPEFMQGLRQLCDENKALLVFDEVQSGMGRTGKLFSYMHYGIAPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A + TNE+A  M  GSHG+TYGGN LA  +G    +II +D  L+ V  
Sbjct: 253 AKALGGGFPISAMITTNEIAQAMEVGSHGTTYGGNPLACAVGNAAFDIINTDEVLDGVAK 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL----KTVFSPALLAAKFRDECLLTAPSS 359
             ++    L  + +++  +F E+RG GLLIG     K +     +     DE L+   + 
Sbjct: 313 RRELFVSHLNKLNDKY-GIFAEIRGMGLLIGAELDGKLLNRAKDILQASADEGLMMLSAG 371

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIK 389
            NV+R  P L I+ EEI+ G+E++  TAI+
Sbjct: 372 SNVLRFTPSLIISEEEINSGMEKLA-TAIE 400


>gi|157363232|ref|YP_001469999.1| acetylornithine aminotransferase [Thermotoga lettingae TMO]
 gi|157313836|gb|ABV32935.1| acetylornithine and succinylornithine aminotransferase [Thermotoga
           lettingae TMO]
          Length = 396

 Score =  335 bits (860), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 180/383 (46%), Positives = 251/383 (65%), Gaps = 5/383 (1%)

Query: 3   KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSE 62
           KN++L NTY++  +  + GKG+ ++ ++G  FLDF+SGIAVN LGHSH +LV+ ++SQ  
Sbjct: 2   KNNYLMNTYNRFPVILDHGKGSVVWDKDGRSFLDFSSGIAVNILGHSHKKLVSAIESQVR 61

Query: 63  KLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKF 122
           KL H SNLY +  Q   A  LI +TF  +VFFTNSG E+ E AIK +R+Y       +KF
Sbjct: 62  KLVHCSNLYWTEPQVELAKLLIENTFEGKVFFTNSGTEANEAAIKLSRKYGKKK-SISKF 120

Query: 123 RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI 182
           RI++   +FHGRT  +++A G+ +Y E F P + GFD  +F   +SL+++++++  A+++
Sbjct: 121 RILSAVNSFHGRTFGSLTATGQEKYHEYFKPLVAGFDYFEFNSEESLRSKMNDEVCAVIL 180

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           EPIQGE G+    ++FL   R +CD   ALLIFDEVQ G GRTGKLFAY+   VKPDI+T
Sbjct: 181 EPIQGESGIVPASDDFLNAARVLCDHYGALLIFDEVQCGMGRTGKLFAYQKYGVKPDILT 240

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
           IAKG+GGG PIGA +A+N+ A     G HGST+GGN LA   G  V+  I  DGFL+ V 
Sbjct: 241 IAKGLGGGVPIGAVVASNK-ADVFEPGDHGSTFGGNPLACSAGIAVMREILKDGFLKRVE 299

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSD 360
           +  + L + L  IK  FP++  ++RG GL++G  LK + S   +   F D  LLT PS  
Sbjct: 300 DKGRYLMKKLEGIKKIFPSLIGDLRGTGLMVGVELKNISSRDFVNNCF-DHGLLTVPSGR 358

Query: 361 NVVRILPPLTITAEEIHEGLERI 383
           N VR+LPPLT+   EI   L+ I
Sbjct: 359 NTVRLLPPLTVKKVEIDSALKII 381


>gi|294139268|ref|YP_003555246.1| acetylornithine aminotransferase [Shewanella violacea DSS12]
 gi|293325737|dbj|BAJ00468.1| acetylornithine aminotransferase [Shewanella violacea DSS12]
          Length = 405

 Score =  335 bits (859), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 175/398 (43%), Positives = 248/398 (62%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +GKG+ ++ + G  F+DFA GIAVN LGH HP LV+ LK Q EK
Sbjct: 13  DEVMVPNYAPSAVIPVRGKGSRVWDQEGKEFIDFAGGIAVNCLGHCHPALVSALKEQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  L+++TFADRV+F NSGAE+ E A+K  RRY        K +
Sbjct: 73  IWHLSNVMTNEPALELATKLVNATFADRVYFANSGAEANEAALKLVRRYAMDKFGAEKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+  Y +GFGPK +G     F D+ +L+  IS+ T AI++E
Sbjct: 133 IIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQGITHVPFNDIAALEAVISDKTCAIMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL+ +R +CD  +ALL+FDEVQTG GR G+L+AY   +V PDI+T 
Sbjct: 193 PLQGEGGIVDADPEFLKAVRALCDKHNALLVFDEVQTGVGRLGELYAYMRGDVVPDILTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T E+AA +  G+HGSTYGGN LA  +   VL+++ +   L+ V  
Sbjct: 253 AKALGGGFPIAAMLTTKEIAAHLKIGTHGSTYGGNPLACAVANAVLDVVNTPEVLQGVKV 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-----------EC 352
             ++L +GL  I +++ ++F EVRGQGLL+G       A+L  K++            E 
Sbjct: 313 REQLLRDGLKKINDKY-DVFTEVRGQGLLLG-------AVLNDKYQGRAKDFLVAGTAEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           L++  +  NV+R  P L I   +I EGL R ER   K+
Sbjct: 365 LMSLIAGANVIRFTPSLVIPEADIAEGLARFERAVAKV 402


>gi|326796618|ref|YP_004314438.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Marinomonas mediterranea MMB-1]
 gi|326547382|gb|ADZ92602.1| Acetylornithine/succinyldiaminopimelate aminotransferase
           [Marinomonas mediterranea MMB-1]
          Length = 407

 Score =  335 bits (859), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 175/387 (45%), Positives = 244/387 (63%), Gaps = 5/387 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  SDI   +G+G+ ++ +NG  ++DFA GIAV +LGHSHP LV  ++ Q+++
Sbjct: 11  DEVMVPNYAPSDIIPVRGEGSRVWDKNGKEYIDFAGGIAVTALGHSHPTLVKAMRDQADQ 70

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   TFA+RVFF NSG E+ E A K ARRY Y      K  
Sbjct: 71  LWHLSNVMTNEPALRLAKKLTEKTFAERVFFANSGGEANEAAFKLARRYAYDHVGPEKHE 130

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++F  +FHGRTL T++ GG+ +Y EGF P   G     + D++ LK  IS+ T A+++E
Sbjct: 131 IISFYKSFHGRTLFTVTVGGQPKYTEGFEPAPGGIKHCDYNDIEQLKGLISDKTCAVVME 190

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV     EF +Q+R++CD  +ALL+FDEVQ+G GRTG  FAYE   V PDI+T 
Sbjct: 191 PIQGEGGVIPANLEFAKQVRELCDAHNALLVFDEVQSGVGRTGTFFAYEQLGVTPDILTS 250

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +G GFP+GA L T ++A+ +  G+HGSTYGGN +A V+ E V++II +D  L  V  
Sbjct: 251 AKALGNGFPVGAMLTTEKIASSLAFGTHGSTYGGNPMACVIAEAVIDIIGTDEVLSGVKK 310

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAPSS 359
             ++  EGL AI +++ N+F ++RG GLLIG + V   A     F  E     LL   + 
Sbjct: 311 RHELYVEGLKAINDKY-NVFKDIRGMGLLIGAELVDELAGHGKDFFAESANQGLLILVAG 369

Query: 360 DNVVRILPPLTITAEEIHEGLERIERT 386
            NV+R+ P L I  E+I  GLER E T
Sbjct: 370 PNVIRLAPSLIIPEEDIKAGLERFENT 396


>gi|225677105|ref|ZP_03788107.1| acetylornithine aminotransferase, putative [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
 gi|225590864|gb|EEH12089.1| acetylornithine aminotransferase, putative [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
          Length = 391

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 183/376 (48%), Positives = 246/376 (65%), Gaps = 3/376 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y   +I F  GKG +L+  +G  ++DF SGIAV+SLGH++  L++ LK Q EKLWH
Sbjct: 6   ILPVYSPVNINFSHGKGIYLYDVDGERYVDFHSGIAVSSLGHTNSRLISALKLQGEKLWH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           +SN Y       FA  LI+++FAD VFF+NSG+E+VEC +K AR Y    G  N+ RI+T
Sbjct: 66  ISNTYNIPAANNFAEKLINNSFADTVFFSNSGSEAVECGLKIARIYQNGKGNKNRHRILT 125

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F GAFHGRT  T +   K ++ E   P I+  D  +  +++S+K  IS+    ILIEPIQ
Sbjct: 126 FHGAFHGRTFLTCATNDKQKFSELLNPYIDWCDNIE-PNIESVKKAISSGIGIILIEPIQ 184

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           G+GG++ + E F+++LR++CD+ D LL FD VQ G GRTGKLFAYE   V+PDI  +AKG
Sbjct: 185 GQGGIKVMNEVFMKELRRLCDENDILLFFDCVQCGAGRTGKLFAYEHIGVEPDICALAKG 244

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFP+GACLAT + A  M  G HGST+GGN LA  +G  VL  + S GFL+NV    K
Sbjct: 245 IGGGFPLGACLATEKAAKYMAVGMHGSTFGGNPLATSVGNAVLEELLSPGFLKNVEIRGK 304

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLT-APSSDNVVRI 365
            L   L  + ++FP +  EVRG+GL++G+K        A +     LLT   +SDNVVRI
Sbjct: 305 YLKNKLEDLASKFP-IIEEVRGKGLMLGIKVKADNQKFAEELSHRGLLTVGVTSDNVVRI 363

Query: 366 LPPLTITAEEIHEGLE 381
           LPPL IT +EI EG+E
Sbjct: 364 LPPLIITEKEIDEGIE 379


>gi|163749359|ref|ZP_02156608.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella benthica KT99]
 gi|161331078|gb|EDQ02004.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella benthica KT99]
          Length = 405

 Score =  332 bits (851), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 174/398 (43%), Positives = 245/398 (61%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +G G+ ++ + G  F+DFA GIAVN LGH HP LV  LK QSEK
Sbjct: 13  DEVMVPNYAPSAVIPVRGAGSRVWDQEGKEFIDFAGGIAVNCLGHCHPALVGALKEQSEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  L+++TFA+RV+F NSGAE+ E A+K  RRY        K +
Sbjct: 73  IWHLSNVMTNEPALELATKLVNATFAERVYFANSGAEANEAALKLVRRYAMDKYGAEKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+  Y +GFGPK +G     F D+ +L+  IS+ T AI++E
Sbjct: 133 IIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQGITHVPFNDIAALEAVISDKTCAIMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL  +R +CD  +ALLIFDEVQTG GR G+L+AY   +V PD++T 
Sbjct: 193 PLQGEGGIVDADPEFLTAVRALCDKYNALLIFDEVQTGVGRLGELYAYMRGDVVPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T E+AA +  G+HGSTYGGN LA  +   VL+++ +   L+ V  
Sbjct: 253 AKALGGGFPIAAMLTTKEIAAHLKIGTHGSTYGGNPLACAVANAVLDVVNTPEVLQGVKM 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-----------EC 352
             ++L  GL  I +++ ++F EVRGQGLL+G       A+L  K++            E 
Sbjct: 313 REQLLRAGLKKINDKY-DVFTEVRGQGLLLG-------AVLNDKYQGRAKEFLLAGIAEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           L++  +  NV+R  P L I   +I EGL R ER   K+
Sbjct: 365 LMSLIAGANVIRFTPSLVIPEADIAEGLARFERAVAKV 402


>gi|56461418|ref|YP_156699.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Idiomarina loihiensis L2TR]
 gi|56180428|gb|AAV83150.1| Ornithine/acetylornithine aminotransferase [Idiomarina loihiensis
           L2TR]
          Length = 405

 Score =  332 bits (851), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 169/391 (43%), Positives = 247/391 (63%), Gaps = 5/391 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ND +   Y+ + +   KG+GA ++ + G  ++DFA GIAVN LGH HP +V+ L+ QS+K
Sbjct: 13  NDVMVPNYNPASMIPVKGEGARVWDQEGREYVDFAGGIAVNCLGHCHPAMVSALQEQSQK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN++ +      A  L  +TFADRV++ NSGAE+ E A+K ARR+       +K +
Sbjct: 73  LWHLSNVFTNEPAIRLAKKLTEATFADRVYYANSGAEANEAALKLARRWAIEKHGEHKQQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK    +   + ++ +LK  IS+ T A+++E
Sbjct: 133 IIAFTKGFHGRTFFTVTVGGQPAYSDGFGPKPGAIEHVDYNNIDALKELISDKTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGGV     EF++ +R++C++ DALLIFDEVQTG+GRTG L+AYE   V PDI+T 
Sbjct: 193 PLQGEGGVVSPDVEFVKAVRELCNENDALLIFDEVQTGFGRTGSLYAYEQLGVTPDILTS 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T E+A  +  G+HGSTYGGN LA  + E V +++ +   L+ V  
Sbjct: 253 AKALGGGFPIGAMLTTTEIAEHLKPGTHGSTYGGNPLACAVSEAVFDVVNTKETLDGVKQ 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
             +   E L AI  ++ N+F E+RGQGLL+G          A  F    ++  ++   + 
Sbjct: 313 REQWFKEQLAAINEKY-NVFSEIRGQGLLLGAAMNKEYEGRARDFLLAGQEHGVMVLIAG 371

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
            NVVR  P L I+ E+I EGL+R E+   ++
Sbjct: 372 ANVVRFTPSLVISEEDIKEGLQRFEKAVAQV 402


>gi|85859272|ref|YP_461474.1| acetylornithine aminotransferase [Syntrophus aciditrophicus SB]
 gi|85722363|gb|ABC77306.1| acetylornithine aminotransferase [Syntrophus aciditrophicus SB]
          Length = 396

 Score =  332 bits (851), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 170/379 (44%), Positives = 239/379 (63%), Gaps = 1/379 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY +  I   +G+G  ++  +G  +LDF +GIAV SLGHSHP +V  +K Q+E L H
Sbjct: 14  IMGTYRRFPIVLTRGEGVRVWDRDGKEYLDFVAGIAVCSLGHSHPAVVEAIKRQAETLMH 73

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY    Q  FA+ L+  +FAD+VFF NSGAE+ E AIK AR+Y +   +  +  ++T
Sbjct: 74  VSNLYHIEPQIHFADQLVKHSFADKVFFCNSGAEANEGAIKLARKYAFENMEPGRCELIT 133

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            + +FHGRTLATI+A G+ ++  GF P  EGF+   F DL +L+  ++  T  +L+EPIQ
Sbjct: 134 MKDSFHGRTLATITATGQKKFQVGFEPLPEGFNYVPFNDLAALEGAVTERTCGVLLEPIQ 193

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR     +L+++R++CDD   L+I DEVQ G GRTG LFAYE  +V PDIMT+AK 
Sbjct: 194 GEGGVRMPDRHYLRKVRELCDDRGILMILDEVQVGMGRTGHLFAYEHDSVTPDIMTLAKA 253

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G GFPIGA LAT+ VA+    GSH ST+GGN LAM  G  V+  +     LEN     +
Sbjct: 254 LGNGFPIGAVLATDRVASSFVPGSHASTFGGNPLAMAAGLTVMETLLEGDILENCRRSGR 313

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
              E L  +K ++P    EVRG+GL+IG++       +     ++ LL   +S NV+R +
Sbjct: 314 YFLESLENLKRKYP-FVKEVRGRGLIIGMELTAEGTDIVRSCMEKGLLINCTSGNVLRFI 372

Query: 367 PPLTITAEEIHEGLERIER 385
           PPL IT  E+   +E ++R
Sbjct: 373 PPLIITEAEVDRAVEILDR 391


>gi|126665662|ref|ZP_01736643.1| acetylornithine transaminase [Marinobacter sp. ELB17]
 gi|126629596|gb|EBA00213.1| acetylornithine transaminase [Marinobacter sp. ELB17]
          Length = 406

 Score =  332 bits (850), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 181/393 (46%), Positives = 244/393 (62%), Gaps = 6/393 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y    I   +GKG+ ++ + G  F+D   GIAVN LGHSHP L++ L+ QS+K
Sbjct: 12  DDVMVPNYAPGTIVPVRGKGSRIWDQEGREFIDLQGGIAVNCLGHSHPGLLSALQEQSQK 71

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  L   TFA+RVFF NSGAE+ E A K  RRY +      K  
Sbjct: 72  IWHLSNVMTNEPALRLAKTLCDHTFAERVFFANSGAEANEAAFKLVRRYAWEHTGAEKHE 131

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND-TAAILI 182
           I+ F+ AFHGRTL T+S GG+ +YLEGF P   G   A+F DL+S++  IS + T AI++
Sbjct: 132 IIAFKNAFHGRTLFTVSVGGQPKYLEGFEPAPGGIQHAEFNDLESVRKLISKEKTCAIVV 191

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           EPIQGEGGV    +EFLQ LR++CD+ DALL+FDEVQ+G GRTG +FAYE  +V PDI+T
Sbjct: 192 EPIQGEGGVMPATKEFLQGLRQLCDENDALLVFDEVQSGAGRTGYVFAYEMYDVVPDILT 251

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
            AKG+GGGFP+ A L T +VAA +  G+HGSTYGGN LA  + +KV++ I     L+ V 
Sbjct: 252 SAKGLGGGFPVAAMLTTAKVAASLPVGTHGSTYGGNALACAVAQKVMDTITQPEILKGVR 311

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPS 358
             +  L +G+  I  R+  +F EVRG GLL+G          A  F     DE ++   +
Sbjct: 312 LRSDHLRKGMMDIGERY-GVFSEVRGAGLLLGCVLTEKWQGRAKDFLNAGLDEGVMVLIA 370

Query: 359 SDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
             NVVR+ P L I   +I E L+R E    KL+
Sbjct: 371 GANVVRLAPSLIIPEADIDEALKRFEAAVQKLT 403


>gi|170725020|ref|YP_001759046.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella woodyi ATCC 51908]
 gi|169810367|gb|ACA84951.1| succinylornithine transaminase family [Shewanella woodyi ATCC
           51908]
          Length = 405

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 174/398 (43%), Positives = 244/398 (61%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y  S +   +G+G+ ++ + G  F+DFA GIAVN LGH HP LV+ LK Q EK
Sbjct: 13  DDVMVPNYAPSAVIPVRGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVSALKEQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+ +TFADRV+F NSGAE+ E A+K  RRY        K +
Sbjct: 73  LWHLSNVMTNEPALALATKLVDATFADRVYFANSGAEANEAALKLVRRYAMDKFGAEKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+  Y +GFGPK +      F D+ +L+  IS+ T A+++E
Sbjct: 133 IIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQSITHVPFNDIAALEAVISDTTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+  V  EFL+ +R +CD  +ALL+FDEVQTG GR G+L+AY   +V PD++T 
Sbjct: 193 PLQGEGGIIDVDPEFLKAVRALCDKHNALLVFDEVQTGVGRLGELYAYMRGDVVPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T E+A  +  G+HGSTYGGN LA  +G  VL+++ +   L  V  
Sbjct: 253 AKALGGGFPIAAMLTTKEIADHLKIGTHGSTYGGNPLACAIGNAVLDVVNTPEVLNGVKV 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DEC 352
             ++L +GL  I ++   +F EVRGQGLL+G       A+L  K++            E 
Sbjct: 313 REQLLRDGLNKINDKH-QVFAEVRGQGLLLG-------AVLNDKYQGRAKEFLVASVGEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           L++  +  NV+R  P L I   +I EGL R ER   K+
Sbjct: 365 LMSLVAGANVIRFTPSLVIPEADIAEGLVRFERAVAKV 402


>gi|327480270|gb|AEA83580.1| bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas stutzeri DSM 4166]
          Length = 406

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 176/379 (46%), Positives = 242/379 (63%), Gaps = 9/379 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G G+ ++ ++G   +DFA GIAVN+LGH+HP ++A L  Q+ KLWH+SN+Y +      
Sbjct: 30  RGLGSRVWDQSGRELVDFAGGIAVNALGHAHPAMIAALTEQAGKLWHISNIYTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ +TFADR FF NSGAE+ E A K ARRY + A    KF I++   +FHGRTL T+
Sbjct: 90  AKKLVAATFADRAFFCNSGAEANEAAFKLARRYAHDAYGPQKFEIISALNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPKIEG     + DL++LK  IS+ T A+++EPIQGE G+    + +L
Sbjct: 150 TVGGQSKYSDGFGPKIEGITHVPYNDLEALKAAISDKTCAVVLEPIQGESGILPGEQAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  R++C++ +ALLIFDEVQTG GRTG+LFAY    V PDI+T AK +GGGFPIGA L T
Sbjct: 210 EGARQLCNEHNALLIFDEVQTGLGRTGELFAYMHYGVTPDILTNAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           NE+AA  + G+HG+TYGGN LA  + E VL+I+ +   LE V    +     L  I  R+
Sbjct: 270 NEIAAHFSVGTHGTTYGGNPLACAVAETVLDIVNTPEVLEGVKARHERFKARLLQIGERY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPAL------LAAKFRDECLLTAPSSDNVVRILPPLTITA 373
             +F +VRG+GLLIG   V S A         A    E L+   +  +VVR+ P L I  
Sbjct: 330 -GVFSQVRGRGLLIG--CVLSDAWKGKAGAFWAAAEKEALMVLQAGPDVVRLAPSLIIDE 386

Query: 374 EEIHEGLERIERTAIKLSH 392
            +I EGL+R ER    L+ 
Sbjct: 387 ADIDEGLDRFERAIATLTQ 405


>gi|268592227|ref|ZP_06126448.1| acetylornithine delta-aminotransferase [Providencia rettgeri DSM
           1131]
 gi|291312275|gb|EFE52728.1| acetylornithine delta-aminotransferase [Providencia rettgeri DSM
           1131]
          Length = 409

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 174/376 (46%), Positives = 239/376 (63%), Gaps = 12/376 (3%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KG+G+ ++ + G  ++DFA GIAV +LGH HP LVA ++ QSEKLWHVSN++ + Q    
Sbjct: 34  KGEGSRVWDQQGKEYIDFAGGIAVLALGHCHPRLVAAVREQSEKLWHVSNIFTNEQALKL 93

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L  +TFADR FF NSG+E+ E A K ARRY        K +I+ F+ AFHGRTL T+
Sbjct: 94  AQKLTKATFADRAFFVNSGSEANEAAFKLARRYAITKYNPYKTKIIAFKQAFHGRTLFTV 153

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  I  +T A+++EP+QGEGGV     EFL
Sbjct: 154 SVGGQAKYADGFGPKPADIIHVPFNDLDAVKAVIDENTCAVVLEPVQGEGGVTAATAEFL 213

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +RK+CDD +ALLIFDEVQ+G GRTGKLF+Y   NV PDI+T AK +GGGFPI A + T
Sbjct: 214 QGVRKLCDDNNALLIFDEVQSGMGRTGKLFSYMHYNVVPDILTTAKALGGGFPISAMITT 273

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  M  GSHG+TYGGN LA  +G    +II ++  L+ V    ++    L  + +++
Sbjct: 274 EEIAKTMEVGSHGTTYGGNPLACAVGNAAFDIINTEEVLKGVEKRRELFVAHLNKLNDKY 333

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLLIG +       L  + +D       E L+   +  NV+R  P L I+
Sbjct: 334 -GIFSEIRGMGLLIGAEL---DGKLLNRSKDILQASAVEGLMMLNAGTNVLRFTPSLIIS 389

Query: 373 AEEIHEGLERIERTAI 388
            +EI+ G+ ++E TAI
Sbjct: 390 EDEINSGMAKLE-TAI 404


>gi|88857406|ref|ZP_01132049.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas tunicata D2]
 gi|88820603|gb|EAR30415.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas tunicata D2]
          Length = 401

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 175/393 (44%), Positives = 238/393 (60%), Gaps = 19/393 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   KG+G+ ++ +NG  F+DFA GIAVN LGH HP LV  L+ QSEK
Sbjct: 9   DEVMVPNYAPSSVIPVKGQGSRVWDQNGKEFIDFAGGIAVNCLGHCHPVLVKALQDQSEK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L  +TFA++V+F NSGAES E A+K ARRY        K  
Sbjct: 69  LWHLSNVMTNEPALRLAKKLTDATFAEKVYFANSGAESNEAALKLARRYALEVFGAEKTH 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK        + DL + +  IS+ T A+++E
Sbjct: 129 IIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPADIQHCNYNDLAAFEALISDKTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF+Q +R +CD  +ALLIFDEVQTG GRTG L+AY+   V PDI+T 
Sbjct: 189 PLQGEGGIISPTAEFVQAVRALCDKHNALLIFDEVQTGVGRTGHLYAYQGLGVTPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T  +AA +  G+HGSTYGGN LA  + E   +++ +   L  V  
Sbjct: 249 AKALGGGFPIGAMLTTTAIAAHLKVGTHGSTYGGNPLACAVAEAAFDVVNTPDVLNGVKE 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF-----------RDEC 352
             ++  EGLTAI  ++ N+F EVRG+GLL+G       A+L A F            D  
Sbjct: 309 REQLFREGLTAINEKY-NVFSEVRGEGLLLG-------AVLNADFAGRSRDFLLASADHG 360

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
           L++  +  +VVR  P L I  E+I EGL R E+
Sbjct: 361 LMSLVAGTDVVRFAPSLIIPKEDIVEGLARFEK 393


>gi|89893509|ref|YP_516996.1| hypothetical protein DSY0763 [Desulfitobacterium hafniense Y51]
 gi|89332957|dbj|BAE82552.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 399

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 239/379 (63%), Gaps = 1/379 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           + NTY +  +   KGKG  ++   G  +LDF +G+AV+SLGHSHP +V  ++ Q+E++ H
Sbjct: 16  VINTYGRLPMAIVKGKGTTVWDIEGKQYLDFVTGLAVSSLGHSHPAVVEAIQKQAEEILH 75

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY    Q   A  L+  +FAD+VFF NSGAE+ E AIK AR+Y       +K+ I+T
Sbjct: 76  TSNLYWIPNQIALAEKLVEHSFADQVFFCNSGAEANEAAIKIARKYAKEHYSEDKYEILT 135

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
              +FHGRTLAT++A G+ +Y +G+ P  EGF      DL  L+ ++S   AA+++EPIQ
Sbjct: 136 LVNSFHGRTLATLTATGQTKYQKGYAPLPEGFTYVPINDLAQLEEKMSPQVAAVMLEPIQ 195

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGV  +  EFL + R++CDD  ALLIFDE+Q G GRTGKLFAYEW+NV PDIMT+AK 
Sbjct: 196 GEGGVFPLEVEFLAKARQLCDDYGALLIFDEIQVGLGRTGKLFAYEWSNVAPDIMTLAKA 255

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGG PIG  LA   VAA    G H ST+GGN LA  +G  V++++  +GFLENV   A+
Sbjct: 256 LGGGVPIGVMLAKENVAATFKPGDHASTFGGNPLATAVGCAVMDVLTEEGFLENVQKRAQ 315

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
              + L  + +++     E+RGQG ++G       A +    R++ LL        +R L
Sbjct: 316 YFKQELQKLADKY-QTGTEIRGQGFILGWPLDRLGAEIVEGAREKGLLINFVGGKALRFL 374

Query: 367 PPLTITAEEIHEGLERIER 385
           PPL ++ +EI E +  +++
Sbjct: 375 PPLNVSYQEIDEAITILDQ 393


>gi|319789506|ref|YP_004151139.1| acetylornithine and succinylornithine aminotransferase
           [Thermovibrio ammonificans HB-1]
 gi|317114008|gb|ADU96498.1| acetylornithine and succinylornithine aminotransferase
           [Thermovibrio ammonificans HB-1]
          Length = 396

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 166/375 (44%), Positives = 239/375 (63%), Gaps = 1/375 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           F+  TY++  + F +G+G WL+ E+G  +LD  +GIAV +LGH HP +   +  Q++ L 
Sbjct: 10  FVMRTYNRYPVSFVRGEGCWLYDESGKKYLDMLAGIAVCNLGHCHPRVSEAICEQAKTLI 69

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNL+    Q   A  L  ++F ++VFF NSGAE+ E AIK ARRY        K+ IV
Sbjct: 70  HTSNLFHIGPQAELARLLCENSFGEKVFFCNSGAEANEGAIKLARRYGTEL-NPEKYEIV 128

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
            F+ +FHGRT+A++S  G+ +Y +GFGP +EG   A+F +L+S++  +S  TAAI++EP+
Sbjct: 129 AFKNSFHGRTVASVSVTGQGKYSQGFGPMLEGVKFAEFNNLESVEEVVSERTAAIIVEPV 188

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGGV     +FL+ LR+I D ++ALLIFDEVQTG GRTG+LFAY+   V+PD+MT+AK
Sbjct: 189 QGEGGVVPAEPDFLKGLREIADRVNALLIFDEVQTGIGRTGRLFAYQHYGVEPDVMTLAK 248

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
            +G G PIGA +A    A  +  G H ST+GGN L+   G +VL ++ + GF + V  +A
Sbjct: 249 ALGNGVPIGAVVAKGRAAGVLKPGLHASTFGGNFLSTRAGVEVLKVMTAPGFFDRVNAVA 308

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
             L +GL +I   FP  F  VRG G+++GL   F    L  K  +  ++   ++  V+R 
Sbjct: 309 AYLRKGLESIVEEFPGRFEAVRGLGMMLGLVCRFECGELVGKLLEAGVIVNCTAGRVLRF 368

Query: 366 LPPLTITAEEIHEGL 380
           LPPL IT EE+  GL
Sbjct: 369 LPPLVITEEEVDYGL 383


>gi|157373948|ref|YP_001472548.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella sediminis HAW-EB3]
 gi|157316322|gb|ABV35420.1| acetylornithine and succinylornithine aminotransferase [Shewanella
           sediminis HAW-EB3]
          Length = 405

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 173/398 (43%), Positives = 245/398 (61%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +G+G+ ++ + G  F+DFA GIAVN LGH HP LV  LK Q EK
Sbjct: 13  DEVMVPNYAPSAVIPVRGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVGALKEQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+++TFADRV+F NSGAE+ E A+K  RRY        K +
Sbjct: 73  LWHLSNVMTNEPALELATKLVNATFADRVYFANSGAEANEAALKLVRRYAMDKFGVEKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+  Y +GFGPK +      F D+ +L+  IS+ T AI++E
Sbjct: 133 IIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQSITHVPFNDIAALEAVISDKTCAIMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL+ +R +CD  +ALL+FDEVQTG GR G+L+AY  ++V PD++T 
Sbjct: 193 PLQGEGGIIDADPEFLKAVRALCDKHNALLVFDEVQTGVGRLGELYAYMRSDVVPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T E+A  +  G+HGSTYGGN LA  +   VL+++ +   LE V  
Sbjct: 253 AKALGGGFPIAAMLTTKEIAGHLKIGTHGSTYGGNPLACAVANAVLDVVNTPEVLEGVKV 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-----------EC 352
             ++L +GL  I +++  +F EVRGQGLL+G       A+L  K++            E 
Sbjct: 313 REQLLRDGLNKINDKY-GVFSEVRGQGLLLG-------AVLNDKYQGRAKEFLVAGTAEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           L++  +  NV+R  P L I   +I EGL R ER   K+
Sbjct: 365 LMSLIAGANVIRFTPSLVIPEADIAEGLARFERAVAKV 402


>gi|212633622|ref|YP_002310147.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella piezotolerans WP3]
 gi|212555106|gb|ACJ27560.1| Acetylornithine aminotransferase [Shewanella piezotolerans WP3]
          Length = 405

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 171/398 (42%), Positives = 244/398 (61%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +G+G+ ++ + G  F+DFA GIAVN LGH HP LV  LK Q EK
Sbjct: 13  DEVMVPNYAPSAVIPVRGEGSRVWDQEGKEFIDFAGGIAVNCLGHCHPALVGALKEQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+ +TFADRV+F NSGAE+ E A+K  RRY        K +
Sbjct: 73  LWHLSNVMTNEPALELATKLVEATFADRVYFANSGAEANEAALKLVRRYAMDKFGAEKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+  Y +GFGPK +      F D+ +L+   S+ T A+++E
Sbjct: 133 IIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQSITHVPFNDIAALEAVFSDKTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL+ +R +CD  +ALL+FDEVQTG GR G+L+AY   +V PD++T 
Sbjct: 193 PLQGEGGIIDADPEFLKAVRALCDKHNALLVFDEVQTGVGRLGELYAYMRGDVVPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T E+A  +  G+HGSTYGGN LA  +G  VL+++ +   L+ V  
Sbjct: 253 AKALGGGFPIAAMLTTKEIADHLKIGTHGSTYGGNPLACAIGNAVLDVVNTPEVLDGVKK 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DEC 352
             ++L +GL  I +++ ++F EVRGQGLLIG       A++  K++            E 
Sbjct: 313 REQLLRDGLNKINDKY-DVFSEVRGQGLLIG-------AVVNEKYQGRAKEFLVAGIQEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +++  +  NVVR  P L I   +I EGL R ER   K+
Sbjct: 365 VMSLVAGANVVRFTPSLVIPEADIAEGLARFERAVAKV 402


>gi|146282022|ref|YP_001172175.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas stutzeri A1501]
 gi|145570227|gb|ABP79333.1| acetylornithine aminotransferase [Pseudomonas stutzeri A1501]
          Length = 406

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 241/379 (63%), Gaps = 9/379 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G G+ ++ ++G   +DFA GIAVN+LGH+HP ++A L  Q+ KLWH+SN+Y +      
Sbjct: 30  RGLGSRVWDQSGRELVDFAGGIAVNALGHAHPAMIAALTEQAGKLWHISNIYTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ +TFADR FF NSGAE+ E A K ARRY +      KF I++   +FHGRTL T+
Sbjct: 90  AKKLVAATFADRAFFCNSGAEANESAFKLARRYAHDVYGPQKFEIISALNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPKIEG     + DL++LK  IS+ T A+++EPIQGE G+    + +L
Sbjct: 150 TVGGQSKYSDGFGPKIEGITHVPYNDLEALKAAISDKTCAVVLEPIQGESGILPGEQAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  R++C++ +ALLIFDEVQTG GRTG+LFAY    V PDI+T AK +GGGFPIGA L T
Sbjct: 210 EGARQLCNEHNALLIFDEVQTGLGRTGELFAYMHYGVTPDILTNAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           NE+AA  + G+HG+TYGGN LA  + E VL+I+ +   LE V    +     L  I  R+
Sbjct: 270 NEIAAHFSVGTHGTTYGGNPLACAVAETVLDIVNTPEVLEGVKARHERFKARLLQIGERY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPAL------LAAKFRDECLLTAPSSDNVVRILPPLTITA 373
             +F +VRG+GLLIG   V S A         A    E L+   +  +VVR+ P L I  
Sbjct: 330 -GVFSQVRGRGLLIG--CVLSDAWKGKAGAFWAAAEKEALMVLQAGPDVVRLAPSLIIDE 386

Query: 374 EEIHEGLERIERTAIKLSH 392
            +I EGL+R ER    L+ 
Sbjct: 387 ADIDEGLDRFERAIATLTQ 405


>gi|322832403|ref|YP_004212430.1| succinylornithine transaminase family [Rahnella sp. Y9602]
 gi|321167604|gb|ADW73303.1| succinylornithine transaminase family [Rahnella sp. Y9602]
          Length = 406

 Score =  329 bits (843), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 245/400 (61%), Gaps = 20/400 (5%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N +D++   Y  +     +G+G+WL+ + G  ++DFA GIAVN+LGH+HPE+   L  Q+
Sbjct: 14  NFDDWMVPVYAPAAFIPVRGEGSWLWDQTGKDYVDFAGGIAVNALGHAHPEIRKTLHEQA 73

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           +K+WH+ N Y +      A  LI +TFAD+VFF NSGAE+ E A+K AR Y   +G   K
Sbjct: 74  DKVWHLGNGYTNEPVLRLAKQLIDATFADKVFFCNSGAEANEAALKLARLYGNKSGG-EK 132

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             I+ F+ AFHGRTL T++ GG+ +Y E F P  +      F DL ++ +QIS+ T A++
Sbjct: 133 NEIIAFKNAFHGRTLFTVTTGGQPKYSEDFAPLPQAITHLPFNDLAAVASQISSRTCAVI 192

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD   A+LIFDEVQTG GRTG+L+AY+   V PDI+
Sbjct: 193 VEPIQGEGGVVPAEAGFLQGLRELCDKHQAVLIFDEVQTGVGRTGELYAYQHYGVVPDIL 252

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFPIGA L T+  AA    G+HG+TYGGN LA  +  KV  +I +   L  V
Sbjct: 253 TSAKALGGGFPIGAMLTTDRYAALFQPGTHGTTYGGNPLATAVAGKVFELINTPEVLSGV 312

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD----------- 350
               +   +GL  I +R+  +F EVRGQGLLIG       A+++ +++D           
Sbjct: 313 QKRHQWFADGLKRINDRY-KVFSEVRGQGLLIG-------AVMSERYKDQAKHLNTLAAE 364

Query: 351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           E L+   +  NV+R  P L I   +I EGL R+ER   +L
Sbjct: 365 EGLIALIAGPNVLRFAPSLIIPGADIEEGLNRLERAVARL 404


>gi|71278920|ref|YP_267386.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Colwellia psychrerythraea 34H]
 gi|71144660|gb|AAZ25133.1| acetylornithine/succinyldiaminopimelate aminotransferase [Colwellia
           psychrerythraea 34H]
          Length = 403

 Score =  328 bits (842), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 172/398 (43%), Positives = 248/398 (62%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y  S +   +G+G+ ++ +    ++DFA GIAV++LGH HP LV  LK Q EK
Sbjct: 13  DDVMVPNYAPSAVIPVRGQGSRVWDQQDKEYIDFAGGIAVSALGHCHPALVGALKEQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  L+ STFA++V+F NSGAES E A+K ARR+       +K +
Sbjct: 73  IWHLSNVQTNEPALRLAKKLVDSTFAEKVYFCNSGAESNEAALKLARRWALDVHGADKSQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+  FHGRT  T++ GG+  Y +GFGPK    D A++ +L SLK  IS+ T A++IE
Sbjct: 133 IIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDIDHAEYNNLDSLKALISDKTCAVMIE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+    +EF++ +R +CD  +ALLIFDEVQTG GR G+L+AY    V PDI+T 
Sbjct: 193 PLQGEGGIVSPTDEFIKGVRALCDQHNALLIFDEVQTGVGRLGELYAYMDLGVTPDILTS 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFPIGA L T E+A  +  G+HGSTYGGN LA  + E VL+ + +   L  +  
Sbjct: 253 AKGLGGGFPIGAMLTTTEIAKHLKIGTHGSTYGGNPLACAVSEAVLDTVNTTEVLAGIKA 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DEC 352
            AK+  +GL AI  ++ N+F E+RG+GLLIG       A+L  K++           DE 
Sbjct: 313 KAKLYVDGLNAINAKY-NVFSEIRGKGLLIG-------AVLTEKYQGQAKTFLNAAMDEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           ++   +  +++R  P L I  E+I  GL R E+  + L
Sbjct: 365 VMVLVAGASIIRFAPSLVIPDEDIALGLARFEKAIVSL 402


>gi|114564460|ref|YP_751974.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella frigidimarina NCIMB 400]
 gi|114335753|gb|ABI73135.1| acetylornithine aminotransferase [Shewanella frigidimarina NCIMB
           400]
          Length = 405

 Score =  328 bits (842), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 174/398 (43%), Positives = 251/398 (63%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  + +   +G G+ ++ + G  F+DFA GIAVN LGH HP LV+ LK Q EK
Sbjct: 13  DEVMVPNYAPAAVIPVRGAGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVSALKEQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+++TFA+RV+F NSGAE+ E A+K ARRY       +K +
Sbjct: 73  LWHLSNVMTNEPALELATKLVNATFAERVYFANSGAEANEAALKLARRYALDNHGADKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T++ GG+  Y +GFGPK +      F D+ +L+  IS+ T AI++E
Sbjct: 133 IIAFDKAFHGRTFFTVTVGGQAAYSDGFGPKPQSITHVPFNDIAALEAVISDKTCAIMLE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL+ +R++ D  DAL+IFDEVQTG GRTG+LFAY   ++ PDI+T 
Sbjct: 193 PLQGEGGIINGDPEFLKAVRRLADKHDALVIFDEVQTGVGRTGELFAYMGTDIVPDILTS 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L + ++AA +  G+HGSTYGGN LA  +G  V++++ +   L+ V +
Sbjct: 253 AKALGGGFPIAAMLTSAKIAAHLKIGTHGSTYGGNPLACAVGNAVMDVVNTKEVLDGVKH 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RD-------EC 352
             ++  +GL AI  ++ N+F EVRG+GLLIG       A+L  ++    RD       E 
Sbjct: 313 REQLFRDGLAAINAKY-NVFSEVRGKGLLIG-------AVLNEQYEGRSRDFLVASVAEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           L++  +  NVVR  P L I   +I EGL R ER   K+
Sbjct: 365 LMSLMAGANVVRFAPSLVIPEADIAEGLLRFERAVAKV 402


>gi|91792414|ref|YP_562065.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella denitrificans OS217]
 gi|91714416|gb|ABE54342.1| acetylornithine aminotransferase [Shewanella denitrificans OS217]
          Length = 405

 Score =  328 bits (842), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 243/386 (62%), Gaps = 5/386 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S I   KG+G+ ++ + G  F+DFA GIAVN LGH HP LV  L  Q+ K
Sbjct: 9   DEVMVPNYAPSAIIPVKGEGSRIWDQQGREFVDFAGGIAVNCLGHCHPVLVNALTEQANK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN   +    + A  L+ +TFA++V+F NSGAES E A+K  RR        +K +
Sbjct: 69  LWHLSNTMTNEPALMLAKALVDNTFAEKVYFANSGAESNEAALKLVRRVALNNYGPHKSQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRTL T+S GG+  Y +GFGPK    D A++ +L S+K  IS++T A+++E
Sbjct: 129 IIAFKQAFHGRTLFTVSVGGQAAYSDGFGPKPGDIDHAEYNNLDSVKALISDNTCAVVLE 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF+Q +R++CD  +ALL+FDEVQTG GRTG+L+AY    V PD++T 
Sbjct: 189 PLQGEGGIISPTPEFIQGVRELCDKHNALLVFDEVQTGVGRTGELYAYMGLGVVPDVLTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T E+A  +  G+HGSTYGGN LA  +G    N + +   L+ V  
Sbjct: 249 AKALGGGFPIGAMLTTTEIAKHLVVGTHGSTYGGNPLACAVGLAAFNTVNTSAVLDGVKE 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR----DECLLTAPSS 359
             +   EG+ AI +++  +F EVRG+GLL+G       A  A +F     DE LL   + 
Sbjct: 309 REQWFREGINAINDKY-KVFSEVRGKGLLLGAVLNADYAGKAREFMLAAADEGLLVLMAG 367

Query: 360 DNVVRILPPLTITAEEIHEGLERIER 385
            NVVR+ P L I  E++ +GL R ER
Sbjct: 368 ANVVRMAPSLVIPKEDVSQGLARFER 393


>gi|109896979|ref|YP_660234.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas atlantica T6c]
 gi|109699260|gb|ABG39180.1| acetylornithine aminotransferase apoenzyme [Pseudoalteromonas
           atlantica T6c]
          Length = 401

 Score =  328 bits (842), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 175/387 (45%), Positives = 241/387 (62%), Gaps = 5/387 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           N+ +   Y+ +DI   +G GA ++ + G  ++DFA GIAVN LGH HPELV +LK Q EK
Sbjct: 9   NEVMVPNYNPADIIPVRGLGARVWDQEGNEYIDFAGGIAVNVLGHCHPELVNVLKEQGEK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L  +TFA++V+F NSGAE+ E A+K ARR+        K +
Sbjct: 69  LWHLSNVLTNEPVLRLAKKLTDATFAEKVYFANSGAEANEAALKLARRFALDNFGPEKDQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++F+  FHGRT  T++ GG+  Y +GFGPK    D   + DL +L+  +S  T A+++E
Sbjct: 129 IISFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGAIDHVDYNDLSALEAVMSERTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+    + F+Q +R +CD  +ALLIFDEVQ+G GRTG+L+AY    V PDI+T 
Sbjct: 189 PLQGEGGIISPTQSFVQGVRDLCDKHNALLIFDEVQSGVGRTGELYAYMGLGVTPDILTS 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T  +AA +  G+HGSTYGGN LA  + EKVL+I+ +   L  V  
Sbjct: 249 AKALGGGFPIGAMLTTTAIAAHLKVGTHGSTYGGNPLACAVAEKVLDIVNTPEVLNGVKQ 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
             +   EGL AI +++ ++F EVRGQGLL+G          A  F      E L+   + 
Sbjct: 309 KEQQFREGLKAINDKY-HVFDEVRGQGLLLGCALNEKYQGRARDFLVASAKEKLMCLVAG 367

Query: 360 DNVVRILPPLTITAEEIHEGLERIERT 386
            NVVR  P L +T  +I EGL R ER 
Sbjct: 368 ANVVRFAPSLILTDADIQEGLARFERA 394


>gi|152978587|ref|YP_001344216.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Actinobacillus succinogenes 130Z]
 gi|150840310|gb|ABR74281.1| acetylornithine and succinylornithine aminotransferase
           [Actinobacillus succinogenes 130Z]
          Length = 399

 Score =  328 bits (841), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 171/386 (44%), Positives = 244/386 (63%), Gaps = 5/386 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y+ ++    KGKG+ ++ +NG  ++DF SGIAVN+LGH   E+VA+LK Q EK
Sbjct: 10  DEVMIPNYNPANFVPVKGKGSRVWDQNGREYIDFTSGIAVNALGHCADEVVAVLKEQGEK 69

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN + S       + L+ +TFA+RV F NSGAE+ E A+K ARRY        K+ 
Sbjct: 70  LWHSSNWFTSEPTLELGDKLVANTFAERVMFANSGAEANEAALKLARRYAVDRFGYQKYN 129

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++F+ +FHGRTL T+S GG+ +Y +GFGPK  G     F DL+++K  I + T AI++E
Sbjct: 130 IISFKQSFHGRTLFTVSVGGQPKYSDGFGPKPAGIIHVPFNDLEAVKAVIDDHTCAIIVE 189

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGE GV    +EFLQ LR++CD+ +ALLIFDEVQTG GRTG L+AY+   V PDI+T 
Sbjct: 190 PIQGESGVIPAKKEFLQGLRELCDEYNALLIFDEVQTGVGRTGALYAYQKFGVTPDILTS 249

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +  GFPI A + T ++A     G HG+T+GGN LA  +G KV++II    FL  V  
Sbjct: 250 AKALANGFPISAMMTTADIAKSFAPGVHGTTFGGNPLACAIGSKVVDIIAQPEFLAGVNR 309

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAPSS 359
            ++     L  +  RF ++F +VRG+GLLIG + +      AA+F   C    L+   + 
Sbjct: 310 TSEFFKAQLRRLNERF-DLFTDVRGEGLLIGAELIEKYHGRAAEFVKACADNGLMILVAG 368

Query: 360 DNVVRILPPLTITAEEIHEGLERIER 385
            NV+R  P L I+ EE+  G+E++ +
Sbjct: 369 PNVLRFAPALNISQEEVMTGIEKLAK 394


>gi|317049870|ref|YP_004117518.1| succinylornithine transaminase family [Pantoea sp. At-9b]
 gi|316951487|gb|ADU70962.1| succinylornithine transaminase family [Pantoea sp. At-9b]
          Length = 406

 Score =  328 bits (841), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 172/386 (44%), Positives = 239/386 (61%), Gaps = 11/386 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +     KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LK+Q E 
Sbjct: 14  DNVILPVYAPAQFVPVKGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVETLKTQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +      A+ LI +TFA+RVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVFTNEPALRLASKLIAATFAERVFFGNSGAEANEAAFKLARYYACKKHSPFKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLAAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV     EF+Q LR +CD+ +ALL+ DEVQ+G GR+GKLFAYE   + PDI+T 
Sbjct: 194 PIQGEGGVMPATPEFMQGLRALCDEHNALLVLDEVQSGMGRSGKLFAYEHYGITPDIITT 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L TNE+A+ M  G HG+TYGGN LA  + E  L+II +   LE V +
Sbjct: 254 AKALGGGFPVSAMLTTNEIASVMAPGVHGTTYGGNPLACAIAETALDIINTPDVLEGVES 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTA 356
             +     L A+ ++F ++F ++RG+GLLIG      P   A+K RD       E L+  
Sbjct: 314 RRQQFVAALQALDSKF-DLFTDIRGKGLLIG--AALKPQ-HASKARDILHAAAAEGLMIL 369

Query: 357 PSSDNVVRILPPLTITAEEIHEGLER 382
            + ++V+R +P L I   +I EG+ R
Sbjct: 370 TAGNDVIRFVPSLVIEPTDIEEGMAR 395


>gi|188025431|ref|ZP_02958579.2| hypothetical protein PROSTU_00326 [Providencia stuartii ATCC 25827]
 gi|188023748|gb|EDU61788.1| hypothetical protein PROSTU_00326 [Providencia stuartii ATCC 25827]
          Length = 419

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 170/388 (43%), Positives = 242/388 (62%), Gaps = 9/388 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +  +   Y  ++    +G+G+ ++ + G  ++DFA GIAV +LGH HP LVA ++ QSEK
Sbjct: 28  DQVILPIYSPAEFIPVRGEGSRVWDQQGKEYIDFAGGIAVLALGHCHPALVAAVREQSEK 87

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWHVSN++ +      A  LI++TFA+RVFF NSGAE+ E A K AR Y        K +
Sbjct: 88  LWHVSNIFTNEPTLRLAQKLINATFAERVFFANSGAEANEAAFKLARHYAITKHSPYKTK 147

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+ +Y +GFGPK        F DL ++K  I  +T A+++E
Sbjct: 148 IIAFKQAFHGRTFFTVSVGGQAKYADGFGPKPADIIHVPFNDLDAVKAVIDENTCAVVLE 207

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGGV    +EF+Q +RK+CDD +ALL+FDEVQ+G GRTG+LF+Y    V PDI+T 
Sbjct: 208 PVQGEGGVTAATQEFMQGVRKLCDDNNALLVFDEVQSGMGRTGQLFSYMHYGVTPDILTT 267

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T+E+A  M  G+HG+TYGGN LA  +G    +II +   L+ V  
Sbjct: 268 AKALGGGFPISAMLTTHEIAQAMGLGTHGTTYGGNPLACAVGNAAFDIINTKEVLDGVTK 327

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
             ++    L  +  ++ N+F E+RG GLLIG      LK      L A    +E L+   
Sbjct: 328 RRELFVAHLNKLNEKY-NIFAEIRGMGLLIGAELKGELKDRSKDILQACA--NEGLMMLN 384

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIER 385
           +  NV+R  P L I+ EEI+ G+ ++E+
Sbjct: 385 AGANVLRFTPSLIISEEEINSGMLKLEK 412


>gi|212711544|ref|ZP_03319672.1| hypothetical protein PROVALCAL_02617 [Providencia alcalifaciens DSM
           30120]
 gi|212685646|gb|EEB45174.1| hypothetical protein PROVALCAL_02617 [Providencia alcalifaciens DSM
           30120]
          Length = 405

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 173/376 (46%), Positives = 238/376 (63%), Gaps = 7/376 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KG+G+ ++ + G  ++DFA GIAV +LGH HP LVA ++ QSEKLWHVSN++ + Q    
Sbjct: 29  KGEGSRVWDQQGKEYIDFAGGIAVLALGHCHPSLVAAVRDQSEKLWHVSNVFTNEQALKL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L  +TFADR FF NSG+E+ E A K ARRY        K +I+ F+ AFHGRTL T+
Sbjct: 89  AQKLTKATFADRAFFVNSGSEANEAAFKLARRYAITKYSPYKTKIIAFKQAFHGRTLFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  I  +T A+++EP+QGEGGV     EFL
Sbjct: 149 SVGGQAKYADGFGPKPADIIHVPFNDLDAVKAVIDENTCAVVLEPVQGEGGVTPATLEFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R++CD+ +ALLIFDEVQ+G GRTGKLF+Y   +V PDI+T AK +GGGFPI A + T
Sbjct: 209 QGVRQLCDENNALLIFDEVQSGMGRTGKLFSYMHYDVTPDILTTAKALGGGFPISAMITT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            ++A  M  GSHG+TYGGN LA  +G    +II +D  L+ V    ++    L  + +++
Sbjct: 269 EDIAQTMEVGSHGTTYGGNPLACAVGNAAFDIINTDEVLDGVAKRRELFIAHLNKLNDQY 328

Query: 320 PNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRDECLLTAPSSDNVVRILPPLTITAE 374
             +F E+RG GLLIG  LK      S  +L A    E L+   +  NV+R  P L I+ E
Sbjct: 329 -GIFAEIRGMGLLIGAELKGKLLNRSKDVLQAS-AAEGLMMLSAGANVLRFTPSLIISEE 386

Query: 375 EIHEGLERIERTAIKL 390
           EI+ G+ ++     KL
Sbjct: 387 EINSGMAKLTAAIEKL 402


>gi|219666837|ref|YP_002457272.1| acetylornithine and succinylornithine aminotransferase
           [Desulfitobacterium hafniense DCB-2]
 gi|219537097|gb|ACL18836.1| acetylornithine and succinylornithine aminotransferase
           [Desulfitobacterium hafniense DCB-2]
          Length = 399

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 166/382 (43%), Positives = 241/382 (63%), Gaps = 1/382 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
            + + NTY +  +   KGKG  ++   G  +LDF +G+AV+SLGHSHP +V  ++ Q+E+
Sbjct: 13  QEVVMNTYGRLPMAIVKGKGTTVWDIEGKQYLDFVTGLAVSSLGHSHPAVVEAIQKQAEE 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           + H SNLY    Q   A  L+  +FAD+VFF NSGAE+ E AIK AR+Y       +K+ 
Sbjct: 73  ILHTSNLYWIPNQIALAEKLVEHSFADQVFFCNSGAEANEAAIKIARKYAKEHYSEDKYE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+T   +FHGRTLAT++A G+ +Y +G+ P  EGF      DL  L+ +++   AA+++E
Sbjct: 133 ILTLVNSFHGRTLATLTATGQTKYQKGYAPLPEGFTYVPINDLAQLEEKMNPKVAAVMLE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV  +  EFL + RK+CDD  ALLIFDE+Q G GRTGKLFAYEW+NV PDIMT+
Sbjct: 193 PIQGEGGVFPLEVEFLAKARKLCDDYGALLIFDEIQVGLGRTGKLFAYEWSNVVPDIMTL 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGG PIG  LA  +VA+    G H ST+GGN LA  +G  V++++  +GFLE+V  
Sbjct: 253 AKALGGGVPIGVMLAKEKVASTFKPGDHASTFGGNPLATAVGCAVMDVLTEEGFLEDVQK 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVV 363
            A+   + L  + +++     E+RGQG ++G       A +    R++ LL        +
Sbjct: 313 RAQYFKQELQKLADKY-QTGTEIRGQGFILGWPLDRLGAEIVEGAREKGLLINFVGGKAL 371

Query: 364 RILPPLTITAEEIHEGLERIER 385
           R LPPL ++ +EI E +  +++
Sbjct: 372 RFLPPLNVSYQEIDEAITILDQ 393


>gi|167625516|ref|YP_001675810.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella halifaxensis HAW-EB4]
 gi|167355538|gb|ABZ78151.1| acetylornithine and succinylornithine aminotransferase [Shewanella
           halifaxensis HAW-EB4]
          Length = 405

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/398 (41%), Positives = 248/398 (62%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +G+G+ ++ + G  ++DFA GIAVN LGH HP LV  LK+Q EK
Sbjct: 13  DEVMVPNYAPSAVIPVRGEGSRVWDQEGKEYIDFAGGIAVNCLGHCHPALVGALKTQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+ +TFA+RV+F NSGAE+ E A+K  RRY        K +
Sbjct: 73  LWHLSNVMTNEPALELATKLVEATFAERVYFANSGAEANEAALKLVRRYAMDKFGAEKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+  Y +GFGPK +      F D+++L+   S+ T A+++E
Sbjct: 133 IIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQSITHVPFNDIEALEAVFSDKTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL+ +R +CD  +ALL+FDEVQTG GR G+L+AY   +V PD++T 
Sbjct: 193 PLQGEGGIIDADPEFLKAVRALCDKHNALLVFDEVQTGVGRLGELYAYMRGDVVPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T E+AA +  G+HGSTYGGN LA  +G  V++++ +   L  V +
Sbjct: 253 AKALGGGFPIAAMLTTKEIAAHLKIGTHGSTYGGNPLACAVGNAVMDVVNTPEVLNGVKH 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DEC 352
             ++  +GL  I +++ ++F E+RGQGLLIG       A++ +K++           +E 
Sbjct: 313 REQLFRDGLNKINDKY-DVFSEIRGQGLLIG-------AVVNSKYQGRAKEFLVAGINEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +++  +  NVVR  P L I   +I EGL R ER   K+
Sbjct: 365 VMSLVAGANVVRFTPSLVIPETDIAEGLARFERAVAKV 402


>gi|281412452|ref|YP_003346531.1| acetylornithine and succinylornithine aminotransferase [Thermotoga
           naphthophila RKU-10]
 gi|281373555|gb|ADA67117.1| acetylornithine and succinylornithine aminotransferase [Thermotoga
           naphthophila RKU-10]
          Length = 385

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 171/383 (44%), Positives = 244/383 (63%), Gaps = 5/383 (1%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY++  + F  GKG+W++ E G  +LDF SGIAVN LGHSHP+LV  +K Q+EKL 
Sbjct: 2   YLMNTYNRFPVTFVYGKGSWIYDEEGNAYLDFTSGIAVNVLGHSHPKLVEAIKDQAEKLI 61

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNL+ +  Q   A  L  +TF  +VFF N+G E  E AIK AR+Y     +  K++I+
Sbjct: 62  HCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEVNEAAIKIARKYGKRRSE-KKYKIL 120

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           +   +FHGRTL +++A G+ +Y + F P + GF+  +F +++ L+ ++S D  A+ +EPI
Sbjct: 121 SAYNSFHGRTLGSLTATGQPKYQKLFEPLVPGFEYFEFNNIEDLRRKMSEDVCAVFLEPI 180

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGE G+    +EFL++ RK+CD+ DALL+FDEVQ G GRTGKLFAY+   V PDI+T AK
Sbjct: 181 QGESGIVPAAKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDILTTAK 240

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGG PIGA +  NE A  +  G HG+T+GGN LA   G  V+  +  +GFLE V    
Sbjct: 241 GLGGGVPIGAVI-VNERADVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKG 299

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGL--KTVFSPALLAAKFRDECLLTAPSSDNVV 363
             L E L  +K  F ++  +VRG GL+IG+  K   +   +A K  +  LL  P+ +N V
Sbjct: 300 NYLMEKLQEMKEEF-DLVADVRGMGLMIGIQFKEEVNNREIATKCFENKLLVVPAGNNTV 358

Query: 364 RILPPLTITAEEIHEGLERIERT 386
           R LPPLT+   EI   +E +++ 
Sbjct: 359 RFLPPLTVEYGEIDLAVETLKKV 381


>gi|260912973|ref|ZP_05919458.1| acetylornithine delta-aminotransferase [Pasteurella dagmatis ATCC
           43325]
 gi|260632963|gb|EEX51129.1| acetylornithine delta-aminotransferase [Pasteurella dagmatis ATCC
           43325]
          Length = 399

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 175/387 (45%), Positives = 239/387 (61%), Gaps = 5/387 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           N  +   Y  +D    KGKG+ ++ + G  ++DF SGIAVNSLGH   E+V +LK+QSEK
Sbjct: 10  NQVMIQNYAPADFIPVKGKGSRVWDQKGKEYIDFTSGIAVNSLGHCPDEIVEVLKTQSEK 69

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN + S Q    A  L+  TFADRV F NSGAE+ E A+K ARRY        K +
Sbjct: 70  LWHSSNWFTSEQTLALATKLVEKTFADRVMFVNSGAEANEAALKLARRYAVDNFGYQKSK 129

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ +FHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I  +T A+++E
Sbjct: 130 IIAFKQSFHGRTLFTVSVGGQAKYSDGFGPKPADIIHIPFNDLNAVKAVIDENTCAVIVE 189

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGE G+    ++FLQ LR+ CD  + LLIFDEVQTG GRTG L+AY    V PDI+T 
Sbjct: 190 PIQGESGILPAHQDFLQGLREQCDQHNVLLIFDEVQTGIGRTGYLYAYMKYGVVPDILTS 249

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +G GFPIGA L TN +A     G HG+T+GGN LA  + EKV++II S  FL+ +  
Sbjct: 250 AKALGNGFPIGAMLTTNHIAKSFVPGVHGTTFGGNPLACAVAEKVIDIISSPQFLQKIHR 309

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
            ++   + L  I N+   +F E+RG+GLLIG + +      A++F     D  L+   + 
Sbjct: 310 TSEKFMQKLQEI-NQQCGLFKEIRGEGLLIGAELIEKYQGKASEFVKKAADNGLMILVAG 368

Query: 360 DNVVRILPPLTITAEEIHEGLERIERT 386
            NV+R  P L I+ +E+  G  R+E+T
Sbjct: 369 PNVLRFAPALNISDDELEAGFVRLEQT 395


>gi|91794541|ref|YP_564192.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella denitrificans OS217]
 gi|91716543|gb|ABE56469.1| acetylornithine aminotransferase [Shewanella denitrificans OS217]
          Length = 405

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 173/392 (44%), Positives = 246/392 (62%), Gaps = 7/392 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +G+G+ ++ + G  F+DFA GIAVN LGH HP LV  LK+Q EK
Sbjct: 13  DEVMVPNYAPSTVIPVRGEGSRVWDQEGTEFVDFAGGIAVNCLGHCHPALVGALKTQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+++TFA+RV+F NSGAE+ E A+K ARRY       +K +
Sbjct: 73  LWHLSNVMTNEPALELATKLVNATFAERVYFANSGAEANEAALKLARRYALENHGADKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T++ GG+  Y +GFGPK +      F D+++L+  IS+ T AI++E
Sbjct: 133 IIAFDKAFHGRTFFTVTVGGQAAYSDGFGPKPQSITHVPFNDIKALEAVISDKTCAIMLE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL+ +R + D  DAL+IFDEVQTG GRTG LFAY   ++ PDI+T 
Sbjct: 193 PLQGEGGIINGDPEFLKAVRALADKHDALVIFDEVQTGVGRTGDLFAYMATDIVPDILTS 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T +VAA +  G+HGSTYGGN LA  +G  VL+++ +   L  V +
Sbjct: 253 AKALGGGFPIAAMLTTAKVAAHLKVGTHGSTYGGNPLACAIGNAVLDVVNTKEVLAGVKH 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRDECLLTAPS 358
             ++  +GL  I  ++  +F EVRG+GLL+G  L   +   S   L A    E L++  +
Sbjct: 313 REQLFRDGLATINAKY-QVFSEVRGKGLLLGAVLNDTYKGRSRDFLMASVA-EGLMSLVA 370

Query: 359 SDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
             +VVR  P L I   +I EGL R ER   ++
Sbjct: 371 GADVVRFTPSLVIPEADIAEGLARFERAVARV 402


>gi|332305097|ref|YP_004432948.1| succinylornithine transaminase family [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172426|gb|AEE21680.1| succinylornithine transaminase family [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 401

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 174/393 (44%), Positives = 245/393 (62%), Gaps = 19/393 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           N+ +   Y+ ++I   +G GA ++ + G  ++DFA GIAVN LGH HP+LVA+LK Q EK
Sbjct: 9   NEVMVPNYNPAEIIPVRGLGARVWDQAGNEYIDFAGGIAVNVLGHCHPDLVAVLKEQGEK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L  +TFA++V+F NSGAE+ E A+K ARR+        K +
Sbjct: 69  LWHLSNVLTNEPVLRLAKKLTDATFAEKVYFANSGAEANEAALKLARRFALDNYGPEKDQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++F+  FHGRT  T++ GG+  Y +GFGPK    +   + DL +L+  +S  T A+++E
Sbjct: 129 IISFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGAIEHVDYNDLSALEAVMSERTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+    + F+Q +R +CD  +ALLIFDEVQ+G GRTG+L+AY    V PDI+T 
Sbjct: 189 PLQGEGGIISPTQSFVQGVRDLCDKHNALLIFDEVQSGVGRTGELYAYMGLGVTPDILTS 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T  +AA +  G+HGSTYGGN LA  + EKVL+I+ +   L +V  
Sbjct: 249 AKALGGGFPIGAMLTTTAIAAHLKVGTHGSTYGGNPLACAVAEKVLDIVNTPEVLNSVKQ 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DEC 352
             +   EGL AI  ++ N+F E+RGQGLL+G         L  KF+           +E 
Sbjct: 309 KEQQFREGLNAINAKY-NVFDEIRGQGLLLGCA-------LNEKFQGRARDFLVASANEK 360

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
           L+   +  NVVR  P L +T  +I EGL R ER
Sbjct: 361 LMCLVAGANVVRFAPSLILTDTDIQEGLARFER 393


>gi|89091835|ref|ZP_01164790.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Oceanospirillum sp. MED92]
 gi|89083570|gb|EAR62787.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Oceanospirillum sp. MED92]
          Length = 404

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 172/375 (45%), Positives = 235/375 (62%), Gaps = 11/375 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G G+ ++ + G  ++DFA GIAVN+LGHSHPELV  LK Q+EKLWH+SN++ +      
Sbjct: 27  RGLGSRVWDQQGREYIDFAGGIAVNALGHSHPELVQALKEQAEKLWHLSNVWTNEPAIQL 86

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L   TFA RV+F NSGAE+ E A K AR+Y Y     +K  I++   +FHGRTL T+
Sbjct: 87  AQSLCTKTFAGRVYFANSGAEANEAAFKLARKYAYDHFSADKHEIISCVNSFHGRTLFTV 146

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y EGF P   G     F DL +L+  IS+ T A++IEPIQGEGG+    + +L
Sbjct: 147 SVGGQDKYREGFEPVPAGISHVPFNDLDALEAAISDKTCAVVIEPIQGEGGIMPASKAYL 206

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
            + R++CD  +ALLIFDE+QTG GRTG+L+AY+   V PDI+T AK +GGGFP+GA L T
Sbjct: 207 MKARELCDKHNALLIFDEIQTGVGRTGQLYAYQAYGVTPDILTTAKALGGGFPVGAMLTT 266

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
             +A  +N GSHGSTYGGN LA  +  KVL++I S+  L  V    +I  E L  +    
Sbjct: 267 EPIATALNIGSHGSTYGGNPLACAVANKVLSLIDSEEVLNGVEKRHQIFIEQLRQLNKTA 326

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
           P +F E RG GLL+G +    PA    K RD         L+   +  +V+R+ P L I 
Sbjct: 327 P-VFSEFRGMGLLLGCE--LQPA-FKGKARDLLQLALEHGLMLLIAGPDVIRMTPSLIIP 382

Query: 373 AEEIHEGLERIERTA 387
            E+IH+G++R  + A
Sbjct: 383 EEDIHQGMQRFTQAA 397


>gi|302035862|ref|YP_003796184.1| acetylornithine aminotransferase [Candidatus Nitrospira defluvii]
 gi|300603926|emb|CBK40258.1| Acetylornithine aminotransferase [Candidatus Nitrospira defluvii]
          Length = 402

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 230/376 (61%), Gaps = 1/376 (0%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           +N   +L NTY +  I   +G+G+ ++   G  ++DF +GIAVN LGH HP+LV  ++ Q
Sbjct: 8   LNAEQYLMNTYTRQPISIVRGRGSKVYDLEGREYIDFVAGIAVNLLGHGHPDLVLAVQKQ 67

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
            + L H SNLY +  Q   A  L+  +FA +VFF NSGAE+ E AIK AR+Y Y     +
Sbjct: 68  VQHLIHTSNLYYTEPQVRLAQALVEHSFAQKVFFCNSGAEANEAAIKLARKYSYDKYGAD 127

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           ++ IVT   +FHGRT+AT++A G+ +  +GF P + GF    F DL  ++  I++ TAAI
Sbjct: 128 RYEIVTMTNSFHGRTMATLTATGQEKVQKGFAPLMPGFSHVAFNDLSEVERAITSKTAAI 187

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           ++EPIQ EGGV      ++Q LR +C + D LLIFDEVQTG GRTG LF YE   ++PDI
Sbjct: 188 MLEPIQAEGGVHVADRGYMQGLRDLCRERDVLLIFDEVQTGMGRTGTLFCYEQFGMQPDI 247

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           MT+AKG+GGG PIGACLAT  VA   + G+H ST+GGN LA   G  VL ++     L+ 
Sbjct: 248 MTLAKGLGGGVPIGACLATEAVAKAFSPGTHASTFGGNPLACAAGLAVLRVLLDGKILDQ 307

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
              + + L +GL  +K+R      EVRG GLL G++       + A      LL   + D
Sbjct: 308 GRRMGETLAKGLAVLKDR-QRCVKEVRGLGLLQGVELDIDGKAVVADCLARGLLINCTGD 366

Query: 361 NVVRILPPLTITAEEI 376
            V+R +PPL IT  EI
Sbjct: 367 RVLRFVPPLIITEREI 382


>gi|119776143|ref|YP_928883.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella amazonensis SB2B]
 gi|119768643|gb|ABM01214.1| acetylornithine aminotransferase [Shewanella amazonensis SB2B]
          Length = 404

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 170/397 (42%), Positives = 245/397 (61%), Gaps = 15/397 (3%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  + +   +G+G+ ++ + G  ++DFA GIAVN LGH HP LV  LK Q EK
Sbjct: 13  DEVMVPNYAPAAVIPVRGEGSRVWDQQGTEYVDFAGGIAVNCLGHCHPALVGALKEQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN   +      A  L+ +TFADRV+F NSGAE+ E A+K ARRY       +K  
Sbjct: 73  LWHLSNTMTNEPALALATKLVEATFADRVYFANSGAEANEAALKLARRYAIEKFGEHKVE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           ++ F+ AFHGRT  T+S GG+  Y +GFGPK        F D+ +L+  +S++T AI++E
Sbjct: 133 VIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPAAITHLPFNDIAALEAAVSDNTCAIMLE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL+ +R++ D  +AL+IFDEVQTG GRTG L+AY    + PDI+T 
Sbjct: 193 PLQGEGGIINGDPEFLRAVRRLADKHNALVIFDEVQTGVGRTGDLYAYMGTEIVPDILTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T ++A+ +  G+HGSTYGGN LA  +G  V++++ +   L+ V +
Sbjct: 253 AKALGGGFPIAAMLTTADIASHLKVGTHGSTYGGNPLACAIGNAVMDVVNTPEVLDGVKH 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------ECLL 354
             ++  +GL  I  ++ ++F E+RG+GLL+G  L   F     A + RD       E LL
Sbjct: 313 REQLFRDGLAQINEKY-HVFSEIRGKGLLLGAVLNEQF-----AGRSRDFLNASVAEGLL 366

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           T  +  NVVR  P L I   +I EGL R ER   K++
Sbjct: 367 TLMAGANVVRFTPSLVIPEADIVEGLARFERAVAKVA 403


>gi|303243573|ref|ZP_07329915.1| acetylornithine and succinylornithine aminotransferase
           [Methanothermococcus okinawensis IH1]
 gi|302486134|gb|EFL49056.1| acetylornithine and succinylornithine aminotransferase
           [Methanothermococcus okinawensis IH1]
          Length = 408

 Score =  325 bits (833), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 238/376 (63%), Gaps = 10/376 (2%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           ++  TY +  +   KG G ++   NG  +LDF +GI+VN++GH HP++V  +K Q+E L 
Sbjct: 24  YIMKTYGRLPVVLIKGNGMYVEDINGKKYLDFLAGISVNNVGHCHPDVVETIKKQAETLI 83

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKF--- 122
           H SN+Y    Q   A  L+  +  DR FF+NSGAE+ E AIK ARRY    GK N     
Sbjct: 84  HTSNIYYIVPQVKLAKKLVELSGLDRAFFSNSGAEANEAAIKLARRY----GKNNNIGEG 139

Query: 123 RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI 182
            I+T E  FHGRTL T++A  K +Y EG+GP  +GF    F DL++LK  I+N T AI++
Sbjct: 140 EIITMEHGFHGRTLTTVTATAKPKYQEGYGPLPKGFKYVPFNDLEALKENITNKTTAIML 199

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           EP+QGEGG+    +++L+ +R++CDD + +LIFDEVQ G GRTGK+FA E  N+KPDIMT
Sbjct: 200 EPVQGEGGIHVADKDYLKGVRELCDDTNIVLIFDEVQCGMGRTGKMFACENYNIKPDIMT 259

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
           +AK +GGGFPIGA LA  ++A     G+HG+T+GGN LA       ++II++   LEN  
Sbjct: 260 LAKALGGGFPIGATLAKEKIADAFTPGAHGTTFGGNPLACASAYASVSIIEN--LLENAQ 317

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNV 362
            + +     L A+K+++P    EVRG GL++G++  F+   +  K  ++  L   +SD V
Sbjct: 318 KMGEYFTNKLKALKDKYP-FIKEVRGLGLMVGMELSFNGGDIVKKMLEKGYLINCTSDTV 376

Query: 363 VRILPPLTITAEEIHE 378
           +R LPPL +  E I E
Sbjct: 377 LRFLPPLIVKKEHIDE 392


>gi|157963330|ref|YP_001503364.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella pealeana ATCC 700345]
 gi|157848330|gb|ABV88829.1| acetylornithine and succinylornithine aminotransferase [Shewanella
           pealeana ATCC 700345]
          Length = 405

 Score =  325 bits (833), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 168/398 (42%), Positives = 245/398 (61%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +G+G+ ++ + G  ++DFA GIAVN LGH HP LV  LK+Q EK
Sbjct: 13  DEVMVPNYAPSAVIPVRGEGSRVWDQEGKEYIDFAGGIAVNCLGHCHPALVGALKTQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH++N+  +      A  L+ +TFADRV+F NSGAE+ E A+K  RRY        K +
Sbjct: 73  LWHLANVMTNEPALELATKLVDATFADRVYFANSGAEANEAALKLVRRYAMDKFGVEKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+  Y +GFGPK +      F D+ +L+   S+ T A+++E
Sbjct: 133 IIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQSITHVPFNDIAALEAVFSDKTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL+ +R +CD  +ALL+FDEVQTG GR G+L+AY   +V PD++T 
Sbjct: 193 PLQGEGGIIDADPEFLKAVRALCDKHNALLVFDEVQTGVGRLGELYAYMRGDVVPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T E+A  +  G+HGSTYGGN LA  +G  VL+++ +   L  V  
Sbjct: 253 AKALGGGFPIAAMLTTKEIADHLKIGTHGSTYGGNPLACAVGNAVLDVVNTPEVLNGVKL 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DEC 352
             ++L +GL AI  ++ ++F E+RGQGLL+G       A++  +F+           +E 
Sbjct: 313 REQLLRDGLIAINAKY-DVFSEIRGQGLLLG-------AVMNERFQGRAKEFLVAAINEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +++  +  NVVR  P L I   +I EGL R ER   K+
Sbjct: 365 VMSLVAGANVVRFTPSLVIPEADIAEGLARFERAVAKV 402


>gi|332994700|gb|AEF04755.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Alteromonas sp. SN2]
          Length = 402

 Score =  325 bits (832), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 167/386 (43%), Positives = 245/386 (63%), Gaps = 5/386 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y+ + +   +G+G+ ++ ++GI ++DFA GIAVN LGH HPELV  L  Q  K
Sbjct: 9   DEVMVPNYNPAGMVPVRGEGSRVWDQDGIEYIDFAGGIAVNVLGHCHPELVKTLNEQGSK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN++ +      A+ L+++TFA++V+F NSGAE+ E A+K ARR+       +K +
Sbjct: 69  LWHLSNVFTNEPALRLASKLVNATFAEKVYFANSGAEANEAALKLARRFALDNYGEDKNQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK    +   + DL + +  IS++T A+++E
Sbjct: 129 IIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGAVEHCDYNDLAAFEALISDNTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF++ +R++CD  +ALLIFDEVQ+G GRTG L+AY   +V PDI+T 
Sbjct: 189 PLQGEGGIISPDIEFIKGVRELCDKHNALLIFDEVQSGVGRTGHLYAYMGLDVTPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++AA +  G+HGSTYGGN LA  + EK  +I+     LE V++
Sbjct: 249 AKSLGGGFPIGAMLTTTDIAAHLKAGTHGSTYGGNPLACAVAEKAFDIVNQPEVLEGVLH 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
              +  E LTAI +++  +F EVRGQG+L+G          A  F      E L+   + 
Sbjct: 309 KEALYRELLTAINDKY-EVFSEVRGQGMLLGCALNEKYQGRARDFMMAATKEHLMCLIAG 367

Query: 360 DNVVRILPPLTITAEEIHEGLERIER 385
            NV+R  P L I  E+I EGL R ER
Sbjct: 368 ANVIRFAPSLVIPDEDIKEGLARFER 393


>gi|120556226|ref|YP_960577.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Marinobacter aquaeolei VT8]
 gi|120326075|gb|ABM20390.1| acetylornithine aminotransferase apoenzyme [Marinobacter aquaeolei
           VT8]
          Length = 404

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 176/393 (44%), Positives = 243/393 (61%), Gaps = 6/393 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y   +I   +G+G+ ++ ++G  ++D   GIAV SLGH+HP LV  L+ Q+EK
Sbjct: 12  DEVMVPNYAPGNIIPVRGEGSRVWDQDGREYVDLQGGIAVTSLGHAHPGLVGALQEQAEK 71

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  L   TFA+RVFF NSGAE+ E A K ARRY +      K  
Sbjct: 72  IWHLSNVMTNEPALRLAKTLCDHTFAERVFFANSGAEANEAAFKLARRYAWEHYGPEKHE 131

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND-TAAILI 182
           I++F+ AFHGRTL T+S GG+ +YLEGF P   G   A F DL S+K  IS + T A+++
Sbjct: 132 IISFKNAFHGRTLFTVSVGGQHKYLEGFEPAPGGIHHADFNDLDSVKALISKEKTCAVVV 191

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           EPIQGE GV     EFL+ LR++CD+ +ALL+FDEVQTG GRTG L+AYE  +V PDI++
Sbjct: 192 EPIQGESGVLPADPEFLKGLRQLCDENNALLVFDEVQTGVGRTGYLYAYEMYDVTPDILS 251

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
            AKG+GGGFP+ A L T +VAA +  G+HGSTYGGN LA  + +KV++ +     L+ V 
Sbjct: 252 SAKGLGGGFPVAAMLTTAKVAASLGVGTHGSTYGGNALACAVAQKVIDTVSQPEILKGVK 311

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPS 358
             +  L +G+  I  R+  +F EVRG GLL+G          A  F     DE ++   +
Sbjct: 312 ARSDKLRKGMMDIGERY-GVFSEVRGAGLLLGCVLTDQWQGKAKDFLSAGLDEGVMVLVA 370

Query: 359 SDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
             NVVR+ P L I   +I E LER E    KL+
Sbjct: 371 GANVVRLAPSLIIPETDIEEALERFEAAVKKLT 403


>gi|262273411|ref|ZP_06051225.1| acetylornithine aminotransferase/N-succinyl-L,L-diaminopimelate
           aminotransferase/succinylornithine transaminase
           [Grimontia hollisae CIP 101886]
 gi|262222389|gb|EEY73700.1| acetylornithine aminotransferase/N-succinyl-L,L-diaminopimelate
           aminotransferase/succinylornithine transaminase
           [Grimontia hollisae CIP 101886]
          Length = 405

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 174/394 (44%), Positives = 240/394 (60%), Gaps = 9/394 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y    +  ++GKG+ ++ ++G  ++DFA GIAV+ LGH HP +V  LK+Q++K
Sbjct: 13  DEVMVPCYAPMAMIPDRGKGSRIWDQDGREYIDFAGGIAVSCLGHCHPVMVNALKAQADK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   +FA+RVFF NSGAE+ E A+K ARR+        K  
Sbjct: 73  LWHLSNVMTNAPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRWAVDVHGPEKSE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK  G     + DL +L   +S+ T AI++E
Sbjct: 133 IIAFTQGFHGRTFFTVTVGGQAAYSDGFGPKPGGVTHLPYNDLDALAAAMSDQTCAIMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+      FLQ +R++C+  +ALLIFDEVQTG GRTG  +AYE   V PDI++ 
Sbjct: 193 PLQGEGGIVSPDPAFLQGVRELCNKHNALLIFDEVQTGNGRTGTFYAYEQTGVTPDILST 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++AA M  G+HGSTYGGN LA  + E V+N +     L  V  
Sbjct: 253 AKSLGGGFPIGAMLTTEKLAAHMKVGTHGSTYGGNPLACAVAEAVVNEVSKPEVLAGVKT 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
                 EGL A+  ++  MF E+RG+GLL+G       K      LLAA   DE LL   
Sbjct: 313 REGWFREGLQALNAKY-KMFSEIRGKGLLMGAVLNDDWKGRARDVLLAAG--DEGLLLLV 369

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           +  NVVR+ P L IT EE+ EGL R++R    L+
Sbjct: 370 AGTNVVRMTPSLVITKEEVDEGLARLDRALATLT 403


>gi|332139911|ref|YP_004425649.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327549933|gb|AEA96651.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 402

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 169/387 (43%), Positives = 238/387 (61%), Gaps = 5/387 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y+ + +   +G+G+ ++ + G  ++DFA GIAVN LGH HPELV  L  Q  K
Sbjct: 9   DDVMVPNYNPAGMVPVRGEGSRVWDQEGAEYIDFAGGIAVNVLGHCHPELVKALNEQGSK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN++ +      A  L  +TF+D+V+F NSGAE+ E A+K ARR+       +K +
Sbjct: 69  LWHLSNVFTNEPALRLAKKLNDATFSDKVYFANSGAEANEAALKLARRWALDKHGEDKNQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK    D   + DL + +  IS+ T A+++E
Sbjct: 129 IIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGAVDHCDYNDLAAFEALISDKTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     +F++ +R++CD  +ALLIFDEVQ+G GRTG L+AY    V PDI+T 
Sbjct: 189 PLQGEGGIIPPDADFVKGVRELCDKHNALLIFDEVQSGVGRTGHLYAYMGLGVTPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L TN++AA +  G+HGSTYGGN LA  + EK L+I+     LE V+ 
Sbjct: 249 AKSLGGGFPIGAMLTTNDIAAHLKPGTHGSTYGGNPLACAVAEKALDIVNQPEVLEGVLK 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
              +  E L AI  ++ N+F EVRGQG+L+G          A  F      E L+   + 
Sbjct: 309 KEALFRELLGAINEKY-NVFEEVRGQGMLLGCALNEKYQGRARDFMMAATKENLMCLVAG 367

Query: 360 DNVVRILPPLTITAEEIHEGLERIERT 386
            NV+R  P L I  E+I EGL R ER 
Sbjct: 368 MNVIRFAPSLVIPDEDIKEGLARFERA 394


>gi|51598021|ref|YP_072212.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pseudotuberculosis IP 32953]
 gi|186897218|ref|YP_001874330.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pseudotuberculosis PB1/+]
 gi|51591303|emb|CAH22969.1| acetylornithine delta-aminotransferase [Yersinia pseudotuberculosis
           IP 32953]
 gi|186700244|gb|ACC90873.1| succinylornithine transaminase family [Yersinia pseudotuberculosis
           PB1/+]
          Length = 405

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 169/399 (42%), Positives = 240/399 (60%), Gaps = 22/399 (5%)

Query: 1   MNKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAIL 57
           +N+N F   +   Y  +     KGKG+ ++ + G  ++DFA GIAV +LGH HP LV+ L
Sbjct: 7   VNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVSAL 66

Query: 58  KSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG 117
             Q E LWH SN++ +      A  LI +TFADRVFF NSGAE+ E A K AR Y     
Sbjct: 67  HQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFANSGAEANEAAFKLARHYAIERH 126

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  + + T
Sbjct: 127 SPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHT 186

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGG+     EFLQ +R +CD  +ALL+FDEVQ+G GR+GKLF+Y    V 
Sbjct: 187 CAVVLEPIQGEGGITSATPEFLQGVRALCDQHNALLVFDEVQSGMGRSGKLFSYMHHGVT 246

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PDI+T AK +GGGFPI A L T E+A+ M  G+HG+TYGGN LA  + E  L++I +   
Sbjct: 247 PDILTTAKALGGGFPISAMLTTEEIASVMTVGTHGTTYGGNPLACAVAEAALDVINTPEV 306

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----- 352
           L  +     +  + L +I +++ ++F ++RG GLLIG       A L AK+R +      
Sbjct: 307 LNGIEQRHGLFVQALQSINSKY-DVFSDIRGMGLLIG-------AELTAKYRGQAREFLA 358

Query: 353 ------LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
                 L+   +  +V+R+ P L I  E+I +G+ R+E+
Sbjct: 359 AAAANGLMILNAGPDVLRLAPSLVIELEDIQQGMARLEK 397


>gi|127511512|ref|YP_001092709.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella loihica PV-4]
 gi|126636807|gb|ABO22450.1| acetylornithine aminotransferase [Shewanella loihica PV-4]
          Length = 405

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 244/394 (61%), Gaps = 11/394 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +G+G+ ++ + G  F+DFA GIAVN LGH HP LV  LK Q EK
Sbjct: 13  DEVMVPNYAPSAVIPVRGEGSRVWDQEGNEFVDFAGGIAVNCLGHCHPALVGALKEQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH++N+  +      A  L+ +TFA++V+F NSGAE+ E A+K ARRY        K +
Sbjct: 73  IWHLANVMTNEPALALATKLVEATFAEKVYFANSGAEANEAALKLARRYALDKFGAEKDQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRT  T+S GG+  Y +GFGPK +      F D+ +L+ ++S+ T AI++E
Sbjct: 133 IIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQSITHLPFNDIAALEAEVSDKTCAIMLE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EFL+ +R + D  +AL+IFDEVQTG GR G+L+AY    V PDI+T 
Sbjct: 193 PLQGEGGIIDADPEFLRAVRALADKHNALVIFDEVQTGVGRLGELYAYMRTEVTPDILTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPI A L T E+A+ +  G+HGSTYGGN LA  +G  VL+++ +   L+ V  
Sbjct: 253 AKALGGGFPIAAMLTTTEIASHLKIGTHGSTYGGNPLACAIGNAVLDVVNTPEVLDGVKR 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRD--ECLLTA 356
             ++L +GL  I  ++ ++F EVRGQGLL+G  L   +   S   L A   +   CL+  
Sbjct: 313 REQLLRDGLNQINEKY-HVFTEVRGQGLLLGAVLNEQYQGRSKDFLVAGTSEGLMCLIAG 371

Query: 357 PSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           P   NV+R  P L I   +I EGL R ER   K+
Sbjct: 372 P---NVIRFTPSLVIPEADIAEGLARFERAVAKV 402


>gi|108809290|ref|YP_653206.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pestis Antiqua]
 gi|108814054|ref|YP_649821.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pestis Nepal516]
 gi|145597419|ref|YP_001161494.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pestis Pestoides F]
 gi|150260776|ref|ZP_01917504.1| acetylornithine aminotransferase [Yersinia pestis CA88-4125]
 gi|162419307|ref|YP_001608023.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pestis Angola]
 gi|165927902|ref|ZP_02223734.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165940017|ref|ZP_02228553.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|166010592|ref|ZP_02231490.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166213236|ref|ZP_02239271.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167399051|ref|ZP_02304575.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167418989|ref|ZP_02310742.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167425731|ref|ZP_02317484.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|170022506|ref|YP_001719011.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pseudotuberculosis YPIII]
 gi|229840029|ref|ZP_04460188.1| Acetylornithine aminotransferase /N-succinyl-L,L-diaminopimelate
           aminotransferase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842111|ref|ZP_04462266.1| Acetylornithine aminotransferase /N-succinyl-L,L-diaminopimelate
           aminotransferase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229904589|ref|ZP_04519700.1| Acetylornithine aminotransferase /N-succinyl-L,L-diaminopimelate
           aminotransferase [Yersinia pestis Nepal516]
 gi|270488198|ref|ZP_06205272.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pestis KIM D27]
 gi|294502259|ref|YP_003566321.1| hypothetical protein YPZ3_0149 [Yersinia pestis Z176003]
 gi|229462843|sp|P59324|ARGD_YERPE RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase; Short=ACOAT; Short=DapATase;
           Short=Succinyldiaminopimelate transferase
 gi|108777702|gb|ABG20221.1| aminotransferase [Yersinia pestis Nepal516]
 gi|108781203|gb|ABG15261.1| aminotransferase [Yersinia pestis Antiqua]
 gi|145209115|gb|ABP38522.1| acetylornithine aminotransferase [Yersinia pestis Pestoides F]
 gi|149290184|gb|EDM40261.1| acetylornithine aminotransferase [Yersinia pestis CA88-4125]
 gi|162352122|gb|ABX86070.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis Angola]
 gi|165912057|gb|EDR30698.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|165920178|gb|EDR37479.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165990682|gb|EDR42983.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166205534|gb|EDR50014.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|166962983|gb|EDR59004.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167051555|gb|EDR62963.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167055421|gb|EDR65215.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|169749040|gb|ACA66558.1| succinylornithine transaminase family [Yersinia pseudotuberculosis
           YPIII]
 gi|229678707|gb|EEO74812.1| Acetylornithine aminotransferase /N-succinyl-L,L-diaminopimelate
           aminotransferase [Yersinia pestis Nepal516]
 gi|229690421|gb|EEO82475.1| Acetylornithine aminotransferase /N-succinyl-L,L-diaminopimelate
           aminotransferase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229696395|gb|EEO86442.1| Acetylornithine aminotransferase /N-succinyl-L,L-diaminopimelate
           aminotransferase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|262360339|gb|ACY57060.1| hypothetical protein YPD4_0151 [Yersinia pestis D106004]
 gi|262364290|gb|ACY60847.1| hypothetical protein YPD8_0157 [Yersinia pestis D182038]
 gi|270336702|gb|EFA47479.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pestis KIM D27]
 gi|294352718|gb|ADE63059.1| hypothetical protein YPZ3_0149 [Yersinia pestis Z176003]
 gi|320013306|gb|ADV96877.1| Acetylornithine aminotransferase /N-succinyl-L,L-diaminopimelate
           aminotransferase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 405

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 169/399 (42%), Positives = 240/399 (60%), Gaps = 22/399 (5%)

Query: 1   MNKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAIL 57
           +N+N F   +   Y  +     KGKG+ ++ + G  ++DFA GIAV +LGH HP LV+ L
Sbjct: 7   VNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVSAL 66

Query: 58  KSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG 117
             Q E LWH SN++ +      A  LI +TFADRVFF NSGAE+ E A K AR Y     
Sbjct: 67  HQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFANSGAEANEAAFKLARHYAIERH 126

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  + + T
Sbjct: 127 SPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHT 186

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGG+     EFLQ +R +CD  +ALL+FDEVQ+G GR+GKLF+Y    V 
Sbjct: 187 CAVVLEPIQGEGGITSATPEFLQGVRALCDQHNALLVFDEVQSGMGRSGKLFSYMHYGVT 246

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PDI+T AK +GGGFPI A L T E+A+ M  G+HG+TYGGN LA  + E  L++I +   
Sbjct: 247 PDILTTAKALGGGFPISAMLTTEEIASVMTVGTHGTTYGGNPLACAVAEAALDVINTPEV 306

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----- 352
           L  +     +  + L +I +++ ++F ++RG GLLIG       A L AK+R +      
Sbjct: 307 LNGIEQRHGLFVQALQSINSKY-DVFSDIRGMGLLIG-------AELTAKYRGQAREFLA 358

Query: 353 ------LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
                 L+   +  +V+R+ P L I  E+I +G+ R+E+
Sbjct: 359 AAAANGLMILNAGPDVLRLAPSLVIELEDIQQGMARLEK 397


>gi|317494374|ref|ZP_07952788.1| succinylornithine transaminase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917624|gb|EFV38969.1| succinylornithine transaminase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 407

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 170/387 (43%), Positives = 235/387 (60%), Gaps = 11/387 (2%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y  +D    +G G+ ++ + G  ++DFA GIAV +LGH HP LVA L  Q EKLWH
Sbjct: 16  MLPIYAPADFVPVRGMGSRVWDQQGREYVDFAGGIAVTALGHCHPALVAALHEQGEKLWH 75

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN++ +      A  LI +TFA+RVFF NSGAE+ E A K AR Y        K +I+ 
Sbjct: 76  VSNVFTNEPALRLAQKLIDATFAERVFFANSGAEANEAAFKLARYYASSKISPYKSKIIA 135

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T A+++EP+Q
Sbjct: 136 FHHAFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLDAVKAVIDDHTCAVVLEPVQ 195

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGV    E FL+ +R++CD   ALL+FDEVQ+G GRTGKLF Y    V PDI+T AK 
Sbjct: 196 GEGGVMPATESFLKGVRELCDRHQALLVFDEVQSGMGRTGKLFTYMHYGVTPDILTTAKA 255

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGGFPI A L TNE+A+ M+ G+HG+TYGGN LA  + E  L++I +   +  +     
Sbjct: 256 LGGGFPISAMLTTNEIASAMHVGTHGTTYGGNPLACAVAEAALDVINTPEVMAGIEERHS 315

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSS 359
           +  E L  I  ++ N+F +VRG GLL+G +   SP     K RD       E L+   + 
Sbjct: 316 LFVEALANINAKY-NVFTQVRGMGLLLGAE--LSPE-YHGKARDILHAAAAEGLMLLNAG 371

Query: 360 DNVVRILPPLTITAEEIHEGLERIERT 386
            +++R  P L +   +IHEG+ R+E+ 
Sbjct: 372 PDILRFAPSLVVEFADIHEGMMRLEKA 398


>gi|94501358|ref|ZP_01307878.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Oceanobacter sp. RED65]
 gi|94426471|gb|EAT11459.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Oceanobacter sp. RED65]
          Length = 401

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 238/388 (61%), Gaps = 11/388 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +  TY+  +I    GKG+ ++ + G  ++DFA GIAVN LGH HP++V  L+ QS+K
Sbjct: 9   DEVMVPTYNPPEIIPVSGKGSRVWDQEGREYIDFAGGIAVNCLGHCHPDVVEALQEQSQK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   TFADRV+F NSGAE+ E A K  RRY       +K +
Sbjct: 69  LWHLSNVMTNEPALNLAKSLTEKTFADRVYFANSGAEANEAAFKLVRRYAIEQHGEDKTK 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++F  AFHGRT   ++ GG+  Y  GFGP+        F D++  K  I +DT A+++E
Sbjct: 129 IISFTRAFHGRTFFAVTVGGQEAYSAGFGPRPGNIVHCDFNDIEQFKALIDDDTCAVIME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGG+ +    F  ++RK+CD   ALL+FDEVQTG GRTG L+AYE   V+PD++T 
Sbjct: 189 PIQGEGGIIEADPHFAHEVRKLCDQHKALLVFDEVQTGVGRTGSLYAYESLGVEPDVLTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +G GFPI A L    +AAC   G HGSTYGGN LA  +G KVL+I+     LE V  
Sbjct: 249 AKALGAGFPIAAMLTKEHIAACFKAGVHGSTYGGNPLACAVGLKVLDIVSDPKLLEQVTV 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRD--ECLLTA 356
            ++ L EGL  I  R+ ++F +VRG+GLLIG  LK  F   +  LL    +    CL+  
Sbjct: 309 KSERLKEGLKTIGERY-DVFSDVRGKGLLIGAELKPEFHGKARELLNHGLQQGVMCLVAG 367

Query: 357 PSSDNVVRILPPLTITAEEIHEGLERIE 384
           P   N++R+ P L I  ++I EGL R++
Sbjct: 368 P---NILRLTPSLIIPDKDIDEGLTRLD 392


>gi|22127824|ref|NP_671247.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pestis KIM 10]
 gi|21960957|gb|AAM87498.1|AE014000_2 acetylornithine delta-aminotransferase [Yersinia pestis KIM 10]
          Length = 409

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 169/399 (42%), Positives = 240/399 (60%), Gaps = 22/399 (5%)

Query: 1   MNKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAIL 57
           +N+N F   +   Y  +     KGKG+ ++ + G  ++DFA GIAV +LGH HP LV+ L
Sbjct: 11  VNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVSAL 70

Query: 58  KSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG 117
             Q E LWH SN++ +      A  LI +TFADRVFF NSGAE+ E A K AR Y     
Sbjct: 71  HQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFANSGAEANEAAFKLARHYAIERH 130

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  + + T
Sbjct: 131 SPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHT 190

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGG+     EFLQ +R +CD  +ALL+FDEVQ+G GR+GKLF+Y    V 
Sbjct: 191 CAVVLEPIQGEGGITSATPEFLQGVRALCDQHNALLVFDEVQSGMGRSGKLFSYMHYGVT 250

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PDI+T AK +GGGFPI A L T E+A+ M  G+HG+TYGGN LA  + E  L++I +   
Sbjct: 251 PDILTTAKALGGGFPISAMLTTEEIASVMTVGTHGTTYGGNPLACAVAEAALDVINTPEV 310

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----- 352
           L  +     +  + L +I +++ ++F ++RG GLLIG       A L AK+R +      
Sbjct: 311 LNGIEQRHGLFVQALQSINSKY-DVFSDIRGMGLLIG-------AELTAKYRGQAREFLA 362

Query: 353 ------LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
                 L+   +  +V+R+ P L I  E+I +G+ R+E+
Sbjct: 363 AAAANGLMILNAGPDVLRLAPSLVIELEDIQQGMARLEK 401


>gi|159905948|ref|YP_001549610.1| acetylornithine aminotransferase [Methanococcus maripaludis C6]
 gi|159887441|gb|ABX02378.1| acetylornithine and succinylornithine aminotransferase
           [Methanococcus maripaludis C6]
          Length = 395

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 165/376 (43%), Positives = 239/376 (63%), Gaps = 5/376 (1%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           +++  ++ NTY +  +   KGKG  +F   G  +LDF +GI VN++GH HP++V  +K+Q
Sbjct: 11  LDEKKYVINTYGRVPVVLVKGKGMSVFDTEGKEYLDFLAGIGVNNVGHCHPKVVETIKNQ 70

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           +E L H+SN+Y +  Q   A  L++ +  D+ FF NSGAE+ E AIK ARRY    GK  
Sbjct: 71  AETLIHISNIYYNVPQIELAKKLVNLSGLDKAFFCNSGAEANEAAIKLARRYGKTKGKEG 130

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +  I+T E AFHGRTL TI+A  K +Y EGF P  +GF    F D+++LK  IS  TAAI
Sbjct: 131 E--IITMEHAFHGRTLTTITATPKAKYQEGFEPLPKGFTYIPFNDIEALKAGISEKTAAI 188

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           +IEP+QGEGG+    +E+L+ +RK+CD+   +LIFDEVQ G GRTG +FAYE   V PDI
Sbjct: 189 MIEPVQGEGGIHPAEKEYLKAVRKLCDENSIVLIFDEVQCGMGRTGTIFAYEQYGVIPDI 248

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           +T+AKG+GGGFPIGA +A  E+A     GSHG+T+GGN LA       +++I   G LEN
Sbjct: 249 VTLAKGLGGGFPIGAMIAKTEIADAFTPGSHGTTFGGNPLACASSSAAIDVIS--GLLEN 306

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
            + + +     L  ++ ++     EVR  GL++G++  F+ + + +K  ++  L   +SD
Sbjct: 307 TLEMGEYFRTELKKLEEKY-EFIKEVRSLGLMVGIELTFNGSDIVSKMFEKGFLINCTSD 365

Query: 361 NVVRILPPLTITAEEI 376
            V+R LPPL +  E I
Sbjct: 366 TVLRFLPPLIVEKEHI 381


>gi|312174061|emb|CBX82314.1| bifunctional acetylornithine delta-aminotransferase /
           N-succinyldiaminopimelate aminotransferase [Erwinia
           amylovora ATCC BAA-2158]
          Length = 405

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 237/388 (61%), Gaps = 15/388 (3%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +     KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LK+Q E 
Sbjct: 14  DEVILPVYAPAQFVPVKGKGSRIWDQQGKEYIDFSGGIAVTALGHCHPALVEALKTQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +      A  LI +TFA+RVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVFTNEPALRLARKLIDATFAERVFFANSGAEANEAAFKLARYYASQRHSPYKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLAAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV    EEF+Q LR++CD+  ALL+ DEVQ+G GR+GKLFAYE   V+PDI+T 
Sbjct: 194 PIQGEGGVVPATEEFMQGLRQLCDEHHALLVMDEVQSGMGRSGKLFAYEHYGVQPDIVTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L TN +A+ M  G HG+TYGGN LA  + E  L+II +   L+ V  
Sbjct: 254 AKALGGGFPVSAMLTTNAIASVMAPGVHGTTYGGNPLACAVAEAALDIINTPEVLDGVAA 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------ECLL 354
             ++  + L ++  R  ++F ++RG+GLLIG  LK  +     A K RD       E ++
Sbjct: 314 RRQLFVDALQSLNTRR-DLFSDIRGKGLLIGAALKPQY-----ADKARDILNAAAAEGVM 367

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLER 382
              +   V+R  P L I   +I EG+ER
Sbjct: 368 VLVAGSGVMRFAPSLLIEPADIAEGMER 395


>gi|226940837|ref|YP_002795911.1| ArgD [Laribacter hongkongensis HLHK9]
 gi|226715764|gb|ACO74902.1| ArgD [Laribacter hongkongensis HLHK9]
          Length = 403

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 177/380 (46%), Positives = 235/380 (61%), Gaps = 11/380 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KG GA L+ ++G  +LDFA GIAVNSLGH HP+LV  L  Q+ KLWHVSN   +      
Sbjct: 27  KGLGARLWDQDGREYLDFAGGIAVNSLGHCHPQLVEALTEQAGKLWHVSNAMTNEPVLRL 86

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L  +TFA+RVFF NSGAE+ E + K AR+Y        K  IV    +FHGRTL T+
Sbjct: 87  ARKLTAATFAERVFFCNSGAEANEASFKLARKYAMDNHGAGKNVIVATRNSFHGRTLFTV 146

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y+EGF P   G     + D+ SL+  +  D AAI++EPIQGEGGV     EFL
Sbjct: 147 SVGGQPKYVEGFAPAPAGIRHCDYNDIASLEAAMGEDVAAIVLEPIQGEGGVLPADPEFL 206

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  R++ D   ALLIFDEVQTG GRTG L+AY    V PDI++ AK +GGGFPIGA L T
Sbjct: 207 RAARELADRYHALLIFDEVQTGAGRTGSLYAYMHYGVVPDILSSAKSLGGGFPIGAMLTT 266

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            +VAA  + G+HGSTYGGN LA  + E+V++I+ +   L+ V    + L  GL AI   F
Sbjct: 267 AKVAASFSVGTHGSTYGGNPLATAVAERVIDIVNTPAVLDGVKAKGERLSAGLRAIGEEF 326

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
             +F EVRG GLL+G   V +PA  + + +D       + L+   +  NVVR+ P L I 
Sbjct: 327 -GLFSEVRGMGLLLG--AVMAPA-YSGRAKDVVKAAEQQGLMVLVAGANVVRLAPSLVID 382

Query: 373 AEEIHEGLERIERTAIKLSH 392
             +I EGL R+ + A++++ 
Sbjct: 383 DADIDEGLARLRQAAVRMAQ 402


>gi|85711882|ref|ZP_01042937.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Idiomarina baltica OS145]
 gi|85694279|gb|EAQ32222.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Idiomarina baltica OS145]
          Length = 407

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 171/393 (43%), Positives = 244/393 (62%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y+ + +   KG+G+ ++ + G  ++DFA GIAVN LGH HP +V  L  QS+K
Sbjct: 16  SDVMVPNYNPAQMVPVKGEGSRVWDQAGKEYIDFAGGIAVNCLGHCHPAMVNALHEQSQK 75

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN++ +      A  L  +TFADRV++ NSGAE+ E A+K ARR+        K +
Sbjct: 76  LWHLSNVFTNEPAIRLAKKLTDATFADRVYYANSGAEANEAALKLARRWAIDVHGEQKQK 135

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK    +   + D  +L   I ++T A+++E
Sbjct: 136 IIAFNKGFHGRTFFTVTVGGQPAYSDGFGPKPGAIEHVPYNDADALAKLIDDETCAVMME 195

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGGV    ++F++Q+R++CD  +ALLIFDEVQTG+GRTG L+AYE   V PDI+T 
Sbjct: 196 PLQGEGGVVPPEQDFVKQVRELCDKHNALLIFDEVQTGFGRTGTLYAYEQLGVTPDILTS 255

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T  +A  +  G+HGSTYGGN LA  + E VL ++ ++  LE V  
Sbjct: 256 AKSLGGGFPIGAMLTTAAIAEHLKPGTHGSTYGGNPLACAVSEAVLEVVNTETVLEGVKQ 315

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPA----LLAAKFRDECLLTAP 357
              ++ E L AI +++ N+F EVRG G LIG  L   F       LLA +     +L A 
Sbjct: 316 RETMIKEHLAAINDKY-NVFKEVRGMGCLIGAELTEQFEGRARDFLLAGQEHGVMVLVAG 374

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +S  V+R  P L I  E+I EGL+R E    ++
Sbjct: 375 AS--VIRFTPSLIIPEEDIKEGLKRFEHAVAQV 405


>gi|188535307|ref|YP_001909104.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Erwinia tasmaniensis Et1/99]
 gi|188030349|emb|CAO98238.1| Acetylornithine aminotransferase [Erwinia tasmaniensis Et1/99]
          Length = 405

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 237/388 (61%), Gaps = 15/388 (3%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +     KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LK+Q E 
Sbjct: 14  DEVILPVYAPAQFVPVKGKGSRIWDQQGKEYIDFSGGIAVTALGHCHPALVEALKTQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN+  +      A+ LI++TFADRVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVLTNEPALRLASKLINATFADRVFFANSGAEANEAAFKLARYYASQRHSPYKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLAAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV     EF+Q LR++CD+ DALL+ DEVQ+G GR+GKLFAYE   V+PDI+T 
Sbjct: 194 PIQGEGGVVPATREFMQGLRQLCDEHDALLVLDEVQSGMGRSGKLFAYEHYGVQPDILTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L TNE+A+ M  G HG+TYGGN LA  + E  L+II +   L+ V  
Sbjct: 254 AKALGGGFPVSAMLTTNEIASVMAPGVHGTTYGGNPLACAVAEAALDIINTPEVLDGVAA 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------ECLL 354
             ++  + L  + N   ++F ++RG+GLLIG  LK  +     A + RD       E ++
Sbjct: 314 RRQLFVDALQGL-NAQRDLFSDIRGKGLLIGAALKPQY-----ADRARDILNAAAAEGVM 367

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLER 382
              +   V+R  P L I   +I EG+ R
Sbjct: 368 VLVAGHGVMRFAPSLVIEPADIAEGMAR 395


>gi|262368970|ref|ZP_06062299.1| succinylornithine transaminase [Acinetobacter johnsonii SH046]
 gi|262316648|gb|EEY97686.1| succinylornithine transaminase [Acinetobacter johnsonii SH046]
          Length = 405

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 174/392 (44%), Positives = 237/392 (60%), Gaps = 15/392 (3%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           N ++   +  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HP  V  L  Q +K
Sbjct: 13  NQYMVPVFAPAQFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPVAVKALVEQCQK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+ N Y +      A  L+ +TFAD+VFF NSGAE+ E A+K AR+   ++G   K +
Sbjct: 73  LWHIGNGYTNEPVLALAKQLVDNTFADKVFFCNSGAEANEAALKLARKVGLLSGSARKNK 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+ AFHGRTL T++AGG+ +Y + F P  EG     F DL +++  I  DT A+++E
Sbjct: 133 IIAFKNAFHGRTLFTVTAGGQPKYSQDFAPLPEGIHHLPFNDLDAVREAIDADTCAVIVE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV     EFL+ LR++CD   A+LIFDEVQTG GRTG L+AY   +V PDI+T 
Sbjct: 193 PIQGEGGVITASPEFLKGLRELCDQHGAVLIFDEVQTGVGRTGALYAYMNTDVTPDILTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA + T++ A     G HG+TYGGN LA  +   V  +I +   L  V  
Sbjct: 253 AKALGGGFPIGAMITTDKFANMFVVGDHGTTYGGNPLASAVANAVFGLINTPEVLNGVRT 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------ECLL 354
            A+I  +GL  +  R+  +F EVRGQGLLIG  LK  +     A K +D       E LL
Sbjct: 313 RAQIFADGLNQLNARY-GLFEEVRGQGLLIGCVLKAEY-----AGKAKDIVTLAGEEGLL 366

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
              +  NVVR  P L I   +I  GL+R ER 
Sbjct: 367 ALVAGPNVVRFTPSLIIPEADIEAGLQRFERA 398


>gi|292489878|ref|YP_003532768.1| bifunctional acetylornithine
           delta-aminotransferase/N-succinyldiaminopimelate
           aminotransferase [Erwinia amylovora CFBP1430]
 gi|292900920|ref|YP_003540289.1| acetylornithine/succinyldiaminopimelate aminotransferase [Erwinia
           amylovora ATCC 49946]
 gi|291200768|emb|CBJ47901.1| acetylornithine/succinyldiaminopimelate aminotransferase [Erwinia
           amylovora ATCC 49946]
 gi|291555315|emb|CBA23647.1| bifunctional acetylornithine delta-aminotransferase /
           N-succinyldiaminopimelate aminotransferase [Erwinia
           amylovora CFBP1430]
          Length = 405

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 237/388 (61%), Gaps = 15/388 (3%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +     KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LK+Q E 
Sbjct: 14  DEVILPVYAPAQFVPVKGKGSRIWDQQGKEYIDFSGGIAVTALGHCHPALVEALKTQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +      A  LI +TFA+RVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVFTNEPALRLARKLIDATFAERVFFANSGAEANEAAFKLARYYASQRHSPYKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLAAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV    EEF+Q LR++CD+  ALL+ DEVQ+G GR+GKLFAYE   V+PDI+T 
Sbjct: 194 PIQGEGGVVPATEEFMQGLRQLCDEHHALLVMDEVQSGMGRSGKLFAYEHYGVQPDIVTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L TN +A+ M  G HG+TYGGN LA  + E  L+II +   L+ V  
Sbjct: 254 AKALGGGFPVSAMLTTNAIASVMAPGVHGTTYGGNPLACAVAEAALDIINTPEVLDGVAA 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------ECLL 354
             ++  + L ++  R  ++F ++RG+GLLIG  LK  +     A K RD       E ++
Sbjct: 314 RRQLFVDALQSLNTRR-DLFSDIRGKGLLIGAALKPQY-----ADKARDILNAAAAEGVM 367

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLER 382
              +   V+R  P L I   +I EG+ER
Sbjct: 368 VLVAGSGVMRFAPSLLIEPVDIAEGMER 395


>gi|83644770|ref|YP_433205.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Hahella chejuensis KCTC 2396]
 gi|83632813|gb|ABC28780.1| acetylornithine transaminase [Hahella chejuensis KCTC 2396]
          Length = 405

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 172/393 (43%), Positives = 235/393 (59%), Gaps = 5/393 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +  +   Y    I    G G+ ++ + G  ++D A GIAV  LGH+HPELVA L  Q++K
Sbjct: 12  DQVMVPNYAPGPIIPTHGIGSRVWDQAGKEYIDLAGGIAVTGLGHAHPELVAALTEQAQK 71

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +    + A  L   TFADRVFF+NSG E+ E A K ARRY +     +K  
Sbjct: 72  LWHLSNVLANEPAILLAKKLTEMTFADRVFFSNSGGEANEAAFKLARRYSWEKHGPHKHD 131

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           IV    +FHGRTL T+S GG+ +Y EGF P   G   A F D+ +L+  I  +T A ++E
Sbjct: 132 IVACNNSFHGRTLFTVSVGGQAKYREGFEPVPGGIKHAPFNDIAALEAAIDENTCAFVVE 191

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGGV    E +L++ R++CD  +ALLIFDEVQTG GRTG L+AY    V PDI+T 
Sbjct: 192 PVQGEGGVTPADEAYLKRARELCDQHNALLIFDEVQTGVGRTGALYAYMKYGVTPDILTT 251

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK MGGGFPIGA L T EVA  +  G+HGSTYGGN L   +  KV++I+ +   L+ V  
Sbjct: 252 AKAMGGGFPIGAMLTTTEVAQSLTVGTHGSTYGGNPLGCAVANKVMDIVNTPEVLQGVER 311

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR----DECLLTAPSS 359
             +++  GL AI  ++  +F  VRG GLLIG          A +F     +E +L   + 
Sbjct: 312 KHELMVSGLQAINEKY-GVFSAVRGMGLLIGAALTDEWQGKAKQFMTAALEEGVLALIAG 370

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKLSH 392
            NV+R+ P L I  ++I EGL R ER   +++ 
Sbjct: 371 PNVLRLAPSLIIGDDDIKEGLARFERAVARVAQ 403


>gi|124516705|gb|EAY58213.1| Acetylornithine and succinylornithine aminotransferase
           [Leptospirillum rubarum]
          Length = 390

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 162/390 (41%), Positives = 249/390 (63%), Gaps = 8/390 (2%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
            L   Y++  + FEKG+G++LF  +G+ +LDF  GIA++ LGH HP +   ++ Q++++ 
Sbjct: 1   MLLGNYNREPLVFEKGRGSYLFDPSGVAYLDFLGGIAIHVLGHCHPGITHAIQKQAQRMV 60

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           HVSNLY +      A  L+  TFADRVFF+NSG E++E AIK ARRY   +G+   F ++
Sbjct: 61  HVSNLYYNPAVVDLAELLVEKTFADRVFFSNSGTEAIEAAIKLARRYGASSGR---FEMI 117

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           + EG+FHGRTL  ++  G+ +  EGFGP   GF  A F D   ++   + +T A+++EP+
Sbjct: 118 SMEGSFHGRTLGAMTLTGQAKVREGFGPLPTGFLYAPFNDFDKIRASRTKNTVAVIVEPV 177

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGE GV     +FLQ+LR+   + D LLI DE+QTG GRTG LFAYE   + PDI+  +K
Sbjct: 178 QGEIGVIPAETDFLQKLRRWTREEDILLILDEIQTGLGRTGSLFAYEQYEIIPDILVSSK 237

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFL-ENVINI 304
            +GGG P+GA L +  ++  +  G+HGST+GGN +A   G  ++  + ++ FL E V ++
Sbjct: 238 ALGGGLPLGAVLTSERLSKFLPPGTHGSTFGGNPVACAAGAALVRALFAEDFLPERVRSM 297

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLL---TAPSSDN 361
           +  L++GL A+KNR+P++  E+RG+G +IG     S   +   FR+E +L   T P +D+
Sbjct: 298 SSYLWDGLMALKNRYPSLIREIRGKGFMIGCVVSVSAKKIKDLFREERVLVNATGP-ADD 356

Query: 362 VVRILPPLTITAEEIHEGLERIERTAIKLS 391
           V+RILPPL+I+ +E  + L   ++    LS
Sbjct: 357 VIRILPPLSISYDETDDFLSVADKIFSSLS 386


>gi|304397796|ref|ZP_07379672.1| succinylornithine transaminase family [Pantoea sp. aB]
 gi|304354507|gb|EFM18878.1| succinylornithine transaminase family [Pantoea sp. aB]
          Length = 406

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 172/386 (44%), Positives = 234/386 (60%), Gaps = 11/386 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +     KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LKSQ E 
Sbjct: 14  DNVILPVYAPAQFVPVKGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVETLKSQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +      A+ LI +TFADRVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVFTNEPALRLASKLIQATFADRVFFANSGAEANEAAFKLARYYACKRHSPFKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRTL T++ GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNAFHGRTLFTVTVGGQPKYSDGFGPKPADIVHVPFNDLDAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV    +EF+Q LR++CD   ALL+ DEVQ+G GR+GKLFAYE   V+PDI+T 
Sbjct: 194 PIQGEGGVVPATQEFMQGLRELCDQHQALLVLDEVQSGMGRSGKLFAYEHYGVQPDILTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L TNE+A+ M  G HG+TYGGN LA  + E  L+II +   L  V  
Sbjct: 254 AKALGGGFPVSAMLTTNEIASTMAPGVHGTTYGGNPLACAIAETALDIINTPDVLAGVDM 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTA 356
             +     L AI  ++ ++F ++RG+GLLIG      P   A K RD       E ++  
Sbjct: 314 RREHFVTALQAIDAKY-DLFSDIRGKGLLIG--AALKPQ-HAGKSRDILNAAAAEGVMVL 369

Query: 357 PSSDNVVRILPPLTITAEEIHEGLER 382
            +  +V+R  P L I   +I EG+ R
Sbjct: 370 VAGTDVMRFAPSLIIEPADIEEGMRR 395


>gi|239995400|ref|ZP_04715924.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Alteromonas macleodii ATCC 27126]
          Length = 402

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 169/387 (43%), Positives = 238/387 (61%), Gaps = 5/387 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y+ + +   +G+G+ ++ ++G  ++DFA GIAVN LGH HPELV  L  Q  K
Sbjct: 9   DDVMVPNYNPAGMVPVRGEGSRVWDQDGAEYIDFAGGIAVNVLGHCHPELVKALNEQGSK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN++ +      A  L  +TF+D+V+F NSGAE+ E A+K ARR+       +K +
Sbjct: 69  LWHLSNVFTNEPALRLAKKLNDATFSDKVYFANSGAEANEAALKLARRWALDKHGEDKNQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK    D   + DL + +  IS+ T A+++E
Sbjct: 129 IIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGAVDHCDYNDLAAFEALISDKTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     +F++ +R++CD  +ALLIFDEVQ+G GRTG L+AY    V PDI+T 
Sbjct: 189 PLQGEGGIIPPDADFVKGVRELCDKHNALLIFDEVQSGVGRTGHLYAYMGLGVTPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T +VAA +  G+HGSTYGGN LA  + EK L+I+     LE V+ 
Sbjct: 249 AKSLGGGFPIGAMLTTADVAAHLKPGTHGSTYGGNPLACAVAEKALDIVNQPEVLEGVLK 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
              +  E L AI  ++ N+F EVRGQG+L+G          A  F      E L+   + 
Sbjct: 309 KEALFRELLGAINEKY-NVFEEVRGQGMLLGCALNEKYQGRARDFMMAATKENLMCLVAG 367

Query: 360 DNVVRILPPLTITAEEIHEGLERIERT 386
            NV+R  P L I  E+I EGL R ER 
Sbjct: 368 MNVIRFAPSLVIPDEDIKEGLARFERA 394


>gi|119774765|ref|YP_927505.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella amazonensis SB2B]
 gi|119767265|gb|ABL99835.1| acetylornithine aminotransferase [Shewanella amazonensis SB2B]
          Length = 405

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 173/394 (43%), Positives = 241/394 (61%), Gaps = 11/394 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S I   KG G+ L+ + G  F+DFA GIAVN LGH HP LV+ L  Q++K
Sbjct: 9   DEVMVPNYAPSPIIPVKGLGSRLWDQQGREFIDFAGGIAVNCLGHCHPALVSALTEQAQK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN   +    + A HL+ +TFA++V+F NSGAE+ E A+K  RR        +K +
Sbjct: 69  LWHLSNTMTNEPALMLAKHLVDNTFAEKVYFANSGAEANEAALKLVRRVALNKFGADKSQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+  FHGRTL T+S GG+  Y +GFGPK    D A++ +L SLK  IS+ T A+++E
Sbjct: 129 IIAFKQGFHGRTLFTVSVGGQPAYSDGFGPKPADIDHAEYNNLDSLKALISDRTCAVVLE 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF++ +R++CD  +ALL+FDEVQTG GRTG+L+AY    V PD++T 
Sbjct: 189 PLQGEGGIINPTPEFIKGVRELCDQHNALLVFDEVQTGVGRTGELYAYMGLGVTPDVLTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T E+A  +  G+HGSTYGGN LA  +G      + +   L  V  
Sbjct: 249 AKALGGGFPIGAMLTTTELAKHLVVGTHGSTYGGNPLACAVGLAAFTTVNTPEVLNGVKE 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTA 356
             ++  +GL AI +++  +F EVRG+GLL+G       A  A K RD       E +L  
Sbjct: 309 REQLFRDGLNAINDKY-QVFTEVRGKGLLLGAAL---NADYAGKARDFMLAAAEEGVLLL 364

Query: 357 PSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
            +  NVVR  P L I   ++ EGL R +    KL
Sbjct: 365 MAGQNVVRFAPSLIIPEADVREGLARFDAAIAKL 398


>gi|160903133|ref|YP_001568714.1| acetylornithine and succinylornithine aminotransferase [Petrotoga
           mobilis SJ95]
 gi|160360777|gb|ABX32391.1| acetylornithine and succinylornithine aminotransferase [Petrotoga
           mobilis SJ95]
          Length = 394

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 167/388 (43%), Positives = 245/388 (63%), Gaps = 3/388 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           ++ NTY +  I   +GKG  ++ ENG  +LDF +GIAVN LGHSHP +V  +KSQ +KL 
Sbjct: 9   YVMNTYSRFPITLVQGKGTKVWDENGKEYLDFVAGIAVNVLGHSHPVIVEAVKSQVDKLV 68

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           HVSNLY +  Q   A  +   +F    FF NSG E+ E AIK AR+Y        +++I+
Sbjct: 69  HVSNLYWNGNQVQLAKMICEKSFGKSAFFCNSGTEANEAAIKLARKYGNTKYNGRRYKII 128

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           T + +FHGRT   ++A  + +Y + F P +EGF+  ++ D+ SLK+ +  +T A+++E I
Sbjct: 129 TAKNSFHGRTYGALTATAQPKYHKNFEPLLEGFESVEYNDINSLKSAVDKNTCAVMLEVI 188

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+ +   E+LQQ+RK+CD+ D LLIFDEVQTG GRTGKLFAYE + V PD+MT+AK
Sbjct: 189 QGEGGINEAKNEYLQQVRKLCDENDLLLIFDEVQTGIGRTGKLFAYEHSGVVPDVMTLAK 248

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
            +GGGFPIG  L  NE A     G HGST+GGN LA  +G  V+  +  + FL  V    
Sbjct: 249 ALGGGFPIGV-LVVNEKADVFTPGDHGSTFGGNPLACAVGMAVMKNVAQESFLNMVKENG 307

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLK-TVFSPALLAAKFRDECLLTAPSSDNVVR 364
           +     L A+K +  ++  +V+G+GL+IG+K  +   + +  K  ++ LL    + NV+R
Sbjct: 308 EFFKNQLLAMKEKH-SIIDKVKGKGLMIGVKLDIEDGSDIVKKAMEKGLLINLLNHNVLR 366

Query: 365 ILPPLTITAEEIHEGLERIERTAIKLSH 392
            +PPL IT EEI +G+  +E   +++ +
Sbjct: 367 FVPPLIITKEEIAKGMNILEEVFLEMGY 394


>gi|315123442|ref|YP_004065448.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas sp. SM9913]
 gi|315017202|gb|ADT70539.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas sp. SM9913]
          Length = 401

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 169/393 (43%), Positives = 241/393 (61%), Gaps = 19/393 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ND +   Y+ S +   +G+G+ ++ +N   F+DFA GIAVN LGH HP LV  LK Q EK
Sbjct: 9   NDVMVPNYNPSAVVPVRGEGSRVWDQNNNEFIDFAGGIAVNCLGHCHPALVGALKEQGEK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  ++ +TFA++V+F NSGAE+ E A+K ARR+        K +
Sbjct: 69  IWHLSNVMTNEPALRLAKKMVDATFAEKVYFANSGAEANEAALKLARRFALDKFGAEKTK 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK        + D+ + +  I +DT A+++E
Sbjct: 129 IIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPADIVHCDYNDIAAFEALIGDDTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF Q++R++C   +ALLIFDEVQTG GRTG L+AYE  +V PDI+T 
Sbjct: 189 PLQGEGGIVPPTNEFAQKVRELCTKHNALLIFDEVQTGVGRTGHLYAYEGLDVIPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA + T E+AA +  G+HGSTYGGN LA  + E   + + +   L+ V  
Sbjct: 249 AKALGGGFPIGAMITTTEIAAHLKVGTHGSTYGGNPLACAVAEAAFDTVNTPAVLDGVKE 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF--RDECLLTAPSSD- 360
             ++  +GL AI  ++ ++F EVRG+GLLIG       A+L  KF  R    L A +++ 
Sbjct: 309 REQMFRDGLNAINEKY-HVFSEVRGKGLLIG-------AVLNEKFEGRARDFLVASANNG 360

Query: 361 --------NVVRILPPLTITAEEIHEGLERIER 385
                   NV+R  P L I  E+I EGL R E+
Sbjct: 361 LMNLVAGMNVIRFTPSLVIPFEDIKEGLARFEK 393


>gi|308188390|ref|YP_003932521.1| acetylornithine delta-aminotransferase / N- succinyldiaminopimelate
           aminotransferase [Pantoea vagans C9-1]
 gi|308058900|gb|ADO11072.1| acetylornithine delta-aminotransferase / N- succinyldiaminopimelate
           aminotransferase [Pantoea vagans C9-1]
          Length = 406

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 171/386 (44%), Positives = 233/386 (60%), Gaps = 11/386 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +     KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LKSQ E 
Sbjct: 14  DNVILPVYAPAQFVPVKGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVETLKSQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +      A+ LI +TFADRVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVFTNEPALRLASKLIQATFADRVFFANSGAEANEAAFKLARYYACKRHSPFKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRTL T++ GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNAFHGRTLFTVTVGGQPKYSDGFGPKPADIVHVPFNDLDAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV    +EF+Q LR +CD   ALL+ DEVQ+G GR+GKLFAYE   V+PDI+T 
Sbjct: 194 PIQGEGGVMPATQEFMQGLRALCDQHQALLVLDEVQSGMGRSGKLFAYEHYGVQPDILTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L TNE+A+ M  G HG+TYGGN LA  + E  L+II +   L  V  
Sbjct: 254 AKALGGGFPVSAMLTTNEIASTMAPGVHGTTYGGNPLACAIAETALDIINTPDVLAGVEM 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTA 356
             +     L AI  ++ ++F ++RG+GLLIG      P   A + RD       E ++  
Sbjct: 314 RRQHFVTALQAIDAKY-DLFSDIRGKGLLIG--AALKPQ-HAGRSRDILNAAAAEGVMVL 369

Query: 357 PSSDNVVRILPPLTITAEEIHEGLER 382
            +  +V+R  P L I   +I EG+ R
Sbjct: 370 VAGTDVMRFAPSLIIEPADIEEGMRR 395


>gi|225848504|ref|YP_002728667.1| acetylornithine aminotransferase (acoat) [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644472|gb|ACN99522.1| acetylornithine aminotransferase (acoat) [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 386

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 245/380 (64%), Gaps = 10/380 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           + +LF  Y +    FEKG+G +L+ + G  +LD  SGIAVN+LG++HP+L   +  Q+ K
Sbjct: 6   SKYLFQNYGRLPYFFEKGEGCYLYDDKGKKYLDMLSGIAVNALGYNHPKLTKAICEQASK 65

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           + H+SNL+    Q   A  L  ++F  +VFF NSGAES E  IK  RRY Y   K  ++ 
Sbjct: 66  IIHISNLFYIKPQIEVAKILSENSFGGKVFFCNSGAESNEALIKLVRRYFY-DKKQERYE 124

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+TFEG+FHGRTLAT++A  + +Y EGF P +EGF  AKF D+ S+KN I++ TAAILIE
Sbjct: 125 IITFEGSFHGRTLATVTATAQPKYHEGFYPLVEGFKYAKFNDIDSVKNLITDKTAAILIE 184

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
            +QGEGGV    +EF+++L K+C + D L   DEVQTG GRTGKLFAY+  +++PDI+++
Sbjct: 185 LVQGEGGVNPANKEFIKELYKLCKENDILFTVDEVQTGIGRTGKLFAYQHFDIQPDIISL 244

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGG PIGA +A +++A     G+H ST+GGN L+ V  + VL  + S+GFL+ V  
Sbjct: 245 AKGLGGGVPIGAIIAKDDIAKSFVPGTHASTFGGNYLSTVAAKVVLEEVLSEGFLDRVQK 304

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDN 361
           + + L E L      +P     V+G GL++G  L    S   +  K  ++ L+   + +N
Sbjct: 305 VGEYLKEALKIFG--YP-----VKGLGLMVGMDLPQSISAKEVMKKTLEKGLIVGTAGEN 357

Query: 362 VVRILPPLTITAEEIHEGLE 381
            +R +PPL IT +E+ E ++
Sbjct: 358 TLRFVPPLIITEKEVDEAVD 377


>gi|300718748|ref|YP_003743551.1| acetylornithine aminotransferase [Erwinia billingiae Eb661]
 gi|299064584|emb|CAX61704.1| Acetylornithine aminotransferase [Erwinia billingiae Eb661]
          Length = 405

 Score =  322 bits (824), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 170/394 (43%), Positives = 236/394 (59%), Gaps = 11/394 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +     KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LK+Q E 
Sbjct: 14  DEVILPVYAPAQFVPVKGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPVLVEALKTQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +      A+ LI +TFA+RVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVFTNEPALRLASKLIAATFAERVFFANSGAEANEAAFKLARYYASKRHSPYKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNGFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLDAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV     EF+Q LRK+CD+  ALL+ DEVQ+G GR+GKLFAYE   V PDI++ 
Sbjct: 194 PIQGEGGVMPATVEFMQGLRKLCDEHQALLVLDEVQSGMGRSGKLFAYEHYGVTPDILST 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L TNE+A+ M+ G HG+TYGGN LA  + E  L+II ++  L  V  
Sbjct: 254 AKALGGGFPVSAMLTTNEIASTMSPGVHGTTYGGNPLACAIAEAALDIINTEAVLSGVET 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTA 356
             +     L A+  +  ++F ++RG+GLLIG      P   A K RD       E ++  
Sbjct: 314 RREQFVTALKALDAKL-DLFSDIRGKGLLIG--AALKPQ-HAGKARDILNAAAAEGVMIL 369

Query: 357 PSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
            +  +V+R  P L I   +I EG+ R  +   K+
Sbjct: 370 NAGTDVIRFAPSLVIEPTDIEEGMARFAKAVEKV 403


>gi|20808850|ref|NP_624021.1| PLP-dependent aminotransferase [Thermoanaerobacter tengcongensis
           MB4]
 gi|28376909|sp|Q8R7C1|ARGD_THETN RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|20517504|gb|AAM25625.1| PLP-dependent aminotransferases [Thermoanaerobacter tengcongensis
           MB4]
          Length = 393

 Score =  322 bits (824), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 238/380 (62%), Gaps = 3/380 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L +TY++  I   KG+G  ++   G  +LDF +GIAVNSLGH HP LV  +K Q+E L 
Sbjct: 8   YLMDTYNRYPIMLVKGEGTRVWDSEGNAYLDFVAGIAVNSLGHCHPALVEAIKKQAETLI 67

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY + +Q   A  +  ++F  +VFF NSGAE+ E AIK AR+Y  +     +++I+
Sbjct: 68  HCSNLYWNEKQIELARMISENSFGGKVFFANSGAEANEGAIKLARKYASLKYGGKRYKII 127

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           T + +FHGRT   ++A G+ +Y +GFGP + GF      D+++L   + ++  AI++E I
Sbjct: 128 TAKNSFHGRTFGALTATGQEKYHKGFGPLLAGFKYVPLNDIEALYEAVDDEVCAIMLEVI 187

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+ +   E+++ +RKICD+ D L I DEVQTG GRTGKLF YE   V PDIMT+AK
Sbjct: 188 QGEGGIHEATPEYVKAVRKICDENDLLFILDEVQTGIGRTGKLFGYEHYGVVPDIMTLAK 247

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFPIGA +A  E  A    G H ST+GGN LA   G  VLN +  DGFLE V    
Sbjct: 248 GLGGGFPIGAIVA-KEDKAVFKPGDHASTFGGNPLACAAGIAVLNEVTKDGFLEGVDKKG 306

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL-LAAKFRDECLLTAPSSDNVVR 364
           K   EGL  ++ +   +  E+RG+GL++G +     A  +  K  ++ LL    S NV+R
Sbjct: 307 KYFREGLETLQKKH-KVVKEIRGKGLMVGCEVDLEDASEIVLKALEKGLLINSVSHNVLR 365

Query: 365 ILPPLTITAEEIHEGLERIE 384
            +PPL +T EEI E L+ ++
Sbjct: 366 FVPPLIVTEEEIDEALQILD 385


>gi|330828679|ref|YP_004391631.1| bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Aeromonas veronii B565]
 gi|328803815|gb|AEB49014.1| Bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Aeromonas veronii B565]
          Length = 405

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 166/398 (41%), Positives = 246/398 (61%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  + I   +G+G+ ++ + G  ++DFA GIAVN LGH HP+LV  LK+Q EK
Sbjct: 13  DEVMVPNYAPAKIIPVRGEGSRVWDQEGREYVDFAGGIAVNGLGHCHPKLVEALKTQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+ +TFAD+V+F NSGAE+ E A+K ARRY        K +
Sbjct: 73  LWHLSNVMTNEPALRLARKLVAATFADKVYFCNSGAEANEAALKLARRYAIEKFGEQKTQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T+S GG+  Y +GFGPK        + DL +L   IS++T A+++E
Sbjct: 133 IIAFNQGFHGRTFFTVSVGGQAVYSDGFGPKPGDITHVPYNDLAALAEVISDNTCAVVME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+ +  +EF + +R++CD  +ALL++DEVQ+G GRTG L+AY    V PDI+T 
Sbjct: 193 PLQGEGGIIRPTDEFAKGVRELCDKHNALLVYDEVQSGVGRTGDLYAYMGLGVTPDILTS 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L TNE+A+ +  G+HGSTYGGN LA  + E V+++I +   L  +  
Sbjct: 253 AKALGGGFPIGAMLTTNEIASYLKVGTHGSTYGGNPLACAVAEAVIDVINTPEVLAGIKQ 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DEC 352
             ++  +GL AI  ++ + F E+RG+GLL+G       A L+ +++           D+ 
Sbjct: 313 REQLFRDGLEAINAKY-HCFSEIRGKGLLLG-------AALSEEYKGRSRDFLLASIDQG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           L+   +  NVVR  P L I   +I EGL R E+   ++
Sbjct: 365 LMALVAGTNVVRFAPSLVIPEADIKEGLARFEKAVAQV 402


>gi|254478143|ref|ZP_05091525.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Carboxydibrachium pacificum DSM 12653]
 gi|214035872|gb|EEB76564.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Carboxydibrachium pacificum DSM 12653]
          Length = 394

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 238/380 (62%), Gaps = 3/380 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L +TY++  I   KG+G  ++   G  +LDF +GIAVNSLGH HP LV  +K Q+E L 
Sbjct: 9   YLMDTYNRYPIMLVKGEGTRVWDSEGNAYLDFVAGIAVNSLGHCHPALVEAIKKQAETLI 68

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY + +Q   A  +  ++F  +VFF NSGAE+ E AIK AR+Y  +     +++I+
Sbjct: 69  HCSNLYWNEKQIELARMISENSFGGKVFFANSGAEANEGAIKLARKYASLKYGGKRYKII 128

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           T + +FHGRT   ++A G+ +Y +GFGP + GF      D+++L   + ++  AI++E I
Sbjct: 129 TAKNSFHGRTFGALTATGQEKYHKGFGPLLAGFKYVPLNDIEALYEAVDDEVCAIMLEVI 188

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+ +   E+++ +RKICD+ D L I DEVQTG GRTGKLF YE   V PDIMT+AK
Sbjct: 189 QGEGGIHEATPEYVKAVRKICDENDLLFILDEVQTGIGRTGKLFGYEHYGVVPDIMTLAK 248

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFPIGA +A  E  A    G H ST+GGN LA   G  VLN +  DGFLE V    
Sbjct: 249 GLGGGFPIGAIVA-KEDKAVFKPGDHASTFGGNPLACAAGIAVLNEVTKDGFLEGVDKKG 307

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL-LAAKFRDECLLTAPSSDNVVR 364
           K   EGL  ++ +   +  E+RG+GL++G +     A  +  K  ++ LL    S NV+R
Sbjct: 308 KYFREGLETLQKKH-KVVKEIRGKGLMVGCEVDLEDASEIVLKALEKGLLINSVSHNVLR 366

Query: 365 ILPPLTITAEEIHEGLERIE 384
            +PPL +T EEI E L+ ++
Sbjct: 367 FVPPLIVTEEEIDEALQILD 386


>gi|311086831|gb|ADP66912.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. TLW03 (Acyrthosiphon pisum)]
          Length = 408

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 171/373 (45%), Positives = 233/373 (62%), Gaps = 11/373 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV SLGH HP L   LK+QS+ LWH+SN++ +      
Sbjct: 30  KGKGSRIWDQKGKEYIDFSGGIAVTSLGHCHPILNKTLKNQSKMLWHLSNIFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ S+FA R+FF NSGAE+ E A K AR Y        K +I++F  +FHGRT  T+
Sbjct: 90  AKKLLSSSFASRIFFANSGAEANEAAFKLARYYSSKIYNFKKNKIISFYNSFHGRTFFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y   FGPK  G   A F D+ S+KN I +DT A+++E IQGEGGV      F+
Sbjct: 150 SVGGQSKYSNNFGPKPAGIVHASFNDINSVKNLIDHDTCAVVVELIQGEGGVIPANLTFV 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q L+++C   + LLIFDE+QTG GRTGKLF YE+  + PDI+TIAK +GGGFPI A L T
Sbjct: 210 QALKELCKQYNVLLIFDEIQTGIGRTGKLFYYEYYAITPDILTIAKSLGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           NEVA+ M  G HG+TYGGN LA  + E V++II +   L  V   +K +   L  I  RF
Sbjct: 270 NEVASVMAPGIHGTTYGGNPLACAVAESVIDIINTKKVLSGVEKKSKKIISELNIINKRF 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSP-------ALLAAKFRDECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG+GLLIG+  V  P        +L   F  E ++   + +NV+R+ P L I 
Sbjct: 330 -KLFTEIRGRGLLIGI--VLKPNVSCNIHKILNFSF-SEGVIFLTAGNNVIRLAPSLIIK 385

Query: 373 AEEIHEGLERIER 385
             +I EG++R  R
Sbjct: 386 ELDIIEGMKRFYR 398


>gi|161594055|ref|NP_901166.2| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Chromobacterium violaceum ATCC 12472]
          Length = 404

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 174/369 (47%), Positives = 239/369 (64%), Gaps = 5/369 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G  F+D A GIAVNSLGH HPELVA L  Q+ KLWHVSN++ +      
Sbjct: 27  RGEGSRIWDQDGREFVDLAGGIAVNSLGHCHPELVAALTEQANKLWHVSNVFTNEPALKL 86

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ L+  TFA+RVFF NSGAE+ E A K AR+Y +     +K +I++   +FHGRTL T+
Sbjct: 87  ASLLVEKTFAERVFFCNSGAEANEAAFKLARKYAHDNFGADKNQILSCVNSFHGRTLFTV 146

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y EGFGP   G D  +F +++SLK  IS+ T A++IEPIQGE GV      FL
Sbjct: 147 SVGGQPKYTEGFGPVPGGIDHFEFNNIESLKAAISDRTCAVVIEPIQGESGVLPADPAFL 206

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  R++CD  +ALLIFDEVQ+G GRTG L+AY+   V PDI++ AKG+GGGFPIGA L T
Sbjct: 207 KAARELCDQHNALLIFDEVQSGMGRTGALYAYQQYGVTPDILSSAKGIGGGFPIGAMLTT 266

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            +VA     GSHGSTYGGN LA  +  KV++I+ S   L  V    K L  GL AI  ++
Sbjct: 267 EKVAKSFGIGSHGSTYGGNPLACAVAHKVVSIVSSPEVLAGVEARHKRLVAGLEAINAKY 326

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNVVRILPPLTITAEE 375
             +F +VRG+GLLIG          A +F      + L+   +  +V+R+ P L I+  +
Sbjct: 327 -KVFKQVRGKGLLIGCVLTDEYNGRAREFLKAAEKQQLMILVAGLSVLRLAPSLVISDAD 385

Query: 376 IHEGLERIE 384
           I EGL+R++
Sbjct: 386 IAEGLKRLD 394


>gi|327395538|dbj|BAK12960.1| acetylornithine/succinyldiaminopimelate aminotransferase ArgD
           [Pantoea ananatis AJ13355]
          Length = 410

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 174/380 (45%), Positives = 231/380 (60%), Gaps = 15/380 (3%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LK Q E LWH SN++ +      
Sbjct: 34  KGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVETLKKQGETLWHTSNVFTNEPALRL 93

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI++TFA+RVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 94  ASKLINATFAERVFFANSGAEANEAAFKLARYYACKRHSPFKSKIIAFHNAFHGRTLFTV 153

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPK        F DL ++K  I + T AI++EPIQGEGGV      F+
Sbjct: 154 TVGGQPKYSDGFGPKPADIVHVPFNDLDAVKAVIDDHTCAIVVEPIQGEGGVMPATPAFM 213

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q LR++CD   ALL+ DEVQ+G GR+GKLFAYE   V PDI+T AK +GGGFP+ A L T
Sbjct: 214 QGLRELCDKHQALLVLDEVQSGMGRSGKLFAYEHYGVTPDILTSAKALGGGFPVSAMLTT 273

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           NEVA+ M  G HG+TYGGN LA  + E  L+II +   L  V    +   E L AI  R 
Sbjct: 274 NEVASTMAPGVHGTTYGGNPLACAIAETALDIINTPAVLNGVEIRRQQFVEALKAIDARH 333

Query: 320 PNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLT 370
            ++F ++RG+GLLIG  LK  +     A K RD       E ++   +  +V+R  P L 
Sbjct: 334 -DLFSDIRGKGLLIGAALKPQY-----AGKARDILNASAAEGVMVLVAGTDVMRFAPSLI 387

Query: 371 ITAEEIHEGLERIERTAIKL 390
           I   +I EG+ R  R   K+
Sbjct: 388 IEPADIEEGMARFARAVEKV 407


>gi|322831015|ref|YP_004211042.1| succinylornithine transaminase family [Rahnella sp. Y9602]
 gi|321166216|gb|ADW71915.1| succinylornithine transaminase family [Rahnella sp. Y9602]
          Length = 405

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 171/375 (45%), Positives = 227/375 (60%), Gaps = 5/375 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DFA GIAV +LGH HP LV  L  Q E LWHVSN++ +      
Sbjct: 29  KGKGSRVWDQQGNEYVDFAGGIAVTALGHCHPALVKALHEQGETLWHVSNVFTNEPALRL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 89  AQKLIDATFADRVFFANSGAEANEAAFKLARYYASHRHSPYKSKIIAFHNAFHGRTLFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  I + T AI++EP+QGEGGV    + FL
Sbjct: 149 SVGGQPKYSDGFGPKPADIVHVPFNDLDAVKAVIDDHTCAIVVEPVQGEGGVTPATKAFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q LR++CD   ALL+ DEVQ+G GR+GKLF+Y    V PDI+T AK +GGGFP+ A LAT
Sbjct: 209 QGLRELCDKHQALLVLDEVQSGMGRSGKLFSYMHYGVTPDILTTAKALGGGFPVSAMLAT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            +VA+ M  G HG+TYGGN LA  + E  L+II +   L  +    +     L AI  ++
Sbjct: 269 EDVASVMEPGKHGTTYGGNPLACAVAEAALDIINTPDVLAGINERREKFISALEAINQKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAPSSDNVVRILPPLTITAEE 375
            ++F E RGQGLLIG +   +    A +F        L+   +  NV+R  P L I   +
Sbjct: 329 -HIFSEFRGQGLLIGAELSDAYKNRAGEFHAAAAEFGLMMLVAGPNVMRFAPSLVIDFAD 387

Query: 376 IHEGLERIERTAIKL 390
           I EG+ER E+   K+
Sbjct: 388 IEEGMERFEKAVGKV 402


>gi|226952409|ref|ZP_03822873.1| succinylornithine transaminase [Acinetobacter sp. ATCC 27244]
 gi|294649697|ref|ZP_06727106.1| succinylornithine transaminase [Acinetobacter haemolyticus ATCC
           19194]
 gi|226836861|gb|EEH69244.1| succinylornithine transaminase [Acinetobacter sp. ATCC 27244]
 gi|292824411|gb|EFF83205.1| succinylornithine transaminase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 401

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 172/393 (43%), Positives = 241/393 (61%), Gaps = 5/393 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ND++   +  ++    +G+G+ L+ +N   ++DFA GIAVN+LGH+HP  V  L  Q+
Sbjct: 10  NFNDWMVPVFAPANFILVRGEGSRLWDQNDKEYVDFAGGIAVNALGHAHPVAVNALTEQA 69

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           +KLWH+ N Y +      A  L+ STFAD+VFF NSGAE+ E A+K AR+   ++G  NK
Sbjct: 70  QKLWHIGNGYTNEPVLRLAKQLVDSTFADKVFFCNSGAEANEAALKLARKIGLLSGNPNK 129

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T++AGG+ +Y + F P  EG +   F DL++ K  I+ +T A++
Sbjct: 130 KNIVAFKNAFHGRTLFTVTAGGQPKYSQDFAPLPEGIEHTAFNDLEAAKAVINENTCAVI 189

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV     EFL+ LR +CD+  A+LIFDEVQTG GRTG L+AY    V PDI+
Sbjct: 190 VEPIQGEGGVVPADLEFLKGLRTLCDEKGAVLIFDEVQTGVGRTGSLYAYMNTGVTPDIL 249

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFPIGA + T++ A     G HG+TYGGN LA  +   V   I +   LE V
Sbjct: 250 TTAKALGGGFPIGAMITTDKYANMYAVGDHGTTYGGNPLACAVAGAVFEFINTPEVLEGV 309

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPAL--LAAKFRDECLLTAP 357
               +   + L  +   + ++F E+RGQGLLIG  LK  ++     +     +E LL   
Sbjct: 310 KQRHQYFVDALNKLNAEY-DLFKEIRGQGLLIGCVLKDEYAGKAKNIVTLAGEEGLLALV 368

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  +VVR  P L I+ ++I EGL R  R   +L
Sbjct: 369 AGADVVRFTPSLIISQQDIDEGLSRFARALARL 401


>gi|153947780|ref|YP_001402895.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pseudotuberculosis IP 31758]
 gi|152959275|gb|ABS46736.1| acetylornithine/succinyldiaminopimelate aminotransferase [Yersinia
           pseudotuberculosis IP 31758]
          Length = 405

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 232/377 (61%), Gaps = 19/377 (5%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DFA GIAV +LGH HP LV+ L  Q E LWH SN++ +      
Sbjct: 29  KGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVSALHQQGETLWHTSNVFTNEPALRL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 89  AQKLIAATFADRVFFANSGAEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 149 SVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSATPEFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD  +ALL+FDEVQ+G GR+GKLF+Y    V PDI+T AK +GGGFPI A L T
Sbjct: 209 QGVRALCDQHNALLVFDEVQSGMGRSGKLFSYMHYGVTPDILTTAKALGGGFPISAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  +     +  + L +I +++
Sbjct: 269 EEIASVMTVGAHGTTYGGNPLACAVAEAALDVINTPEVLNGIEQRHGLFVQALQSINSKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC-----------LLTAPSSDNVVRILPP 368
            ++F ++RG GLLIG       A L AK+R +            L+   +  +V+R+ P 
Sbjct: 329 -DVFSDIRGMGLLIG-------AELTAKYRGQAREFLAAAAANGLMILNAGPDVLRLAPS 380

Query: 369 LTITAEEIHEGLERIER 385
           L I  E+I +G+ R+E+
Sbjct: 381 LVIELEDIQQGMGRLEK 397


>gi|24372208|ref|NP_716250.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella oneidensis MR-1]
 gi|28376895|sp|P59320|ARGD_SHEON RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|24346120|gb|AAN53695.1|AE015508_11 acetylornithine aminotransferase [Shewanella oneidensis MR-1]
          Length = 405

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 169/383 (44%), Positives = 241/383 (62%), Gaps = 19/383 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ + G  F+DFA GIAVN LGH HP LV  LK+Q EKLWH+SN+  +      
Sbjct: 29  RGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEKLWHLSNVMTNEPALEL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L++STFA+RV+F NSGAE+ E A+K ARRY        K  I+ F+ AFHGRT  T+
Sbjct: 89  ATKLVNSTFAERVYFANSGAEANEAALKLARRYALEKHGVEKDEIIAFDKAFHGRTFFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+  Y +GFGPK +      F D+ +L+  +S+ T AI++EP+QGEGG+      FL
Sbjct: 149 SVGGQAAYSDGFGPKPQSITHLPFNDVAALEAAVSDKTCAIMLEPLQGEGGIIDADPAFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           + +R++ +  +AL+IFDEVQTG GRTG+L+AY   ++ PDI+T AK +GGGFPI A L T
Sbjct: 209 KAVRELANKHNALVIFDEVQTGVGRTGELYAYMGTDIVPDILTTAKALGGGFPIAAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HGSTYGGN LA  +G  VL+++ +   L  V +  ++L +GL  I  ++
Sbjct: 269 TEIAEHLKVGTHGSTYGGNPLACAIGNAVLDVVNTPEVLNGVKHREQLLRDGLNKINEKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RD-------ECLLTAPSSDNVVRILPP 368
            ++F EVRG+GLL+G       A+L  ++    RD       E L++  +  NVVR  P 
Sbjct: 329 -HVFSEVRGKGLLLG-------AVLNEQYQGRSRDFLVASVAEGLMSLMAGANVVRFAPS 380

Query: 369 LTITAEEIHEGLERIERTAIKLS 391
           L I   +I EGL R ER    ++
Sbjct: 381 LVIPEADIAEGLARFERAVASIA 403


>gi|120600321|ref|YP_964895.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella sp. W3-18-1]
 gi|146291750|ref|YP_001182174.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella putrefaciens CN-32]
 gi|120560414|gb|ABM26341.1| acetylornithine aminotransferase [Shewanella sp. W3-18-1]
 gi|145563440|gb|ABP74375.1| acetylornithine aminotransferase [Shewanella putrefaciens CN-32]
 gi|319424986|gb|ADV53060.1| succinylornithine transaminase family [Shewanella putrefaciens 200]
          Length = 405

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 242/383 (63%), Gaps = 19/383 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ + G  F+DFA GIAVN LGH HP LV  LK+Q EKLWH+SN+  +      
Sbjct: 29  RGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEKLWHLSNVMTNEPALAL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L++STFAD+V+F NSGAE+ E A+K ARRY        K  I+ F+ AFHGRT  T+
Sbjct: 89  ATKLVNSTFADKVYFANSGAEANEAALKLARRYALEKYGVEKDEIIAFDKAFHGRTFFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+  Y +GFGPK +      + D+ +L+  +S+ T AI++EP+QGEGG+      FL
Sbjct: 149 SVGGQAAYSDGFGPKPQSITHLPYNDIAALEAAVSDKTCAIMLEPLQGEGGIISGEPAFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           + +R++ +  +AL+IFDEVQTG GRTG+L+AY   ++ PDI+T AK +GGGFPI A L T
Sbjct: 209 KAVRELANKHNALVIFDEVQTGVGRTGELYAYMGTDIVPDILTTAKALGGGFPIAAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HGSTYGGN LA  +G  VL+++ +   L+ V +  ++L +GL  I  ++
Sbjct: 269 AEIAEHLKVGTHGSTYGGNPLACAIGNAVLDVVNTQEVLDGVKHREQLLRDGLNKINEKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RD-------ECLLTAPSSDNVVRILPP 368
            ++F EVRG+GLL+G       A+L  ++    RD       E L++  +  NVVR  P 
Sbjct: 329 -HVFSEVRGKGLLLG-------AVLNEQYQGRSRDFLVASVAEGLMSLMAGANVVRFAPS 380

Query: 369 LTITAEEIHEGLERIERTAIKLS 391
           L I   +I EGL R ER    ++
Sbjct: 381 LVIPEADIAEGLARFERAVASIA 403


>gi|329297321|ref|ZP_08254657.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Plautia stali symbiont]
          Length = 405

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 173/394 (43%), Positives = 238/394 (60%), Gaps = 11/394 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +     KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LKSQ E 
Sbjct: 14  DNVILPVYAPAQFVPVKGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVETLKSQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +      A+ LI +TFA+ VFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVFTNEPALRLASKLIAATFAELVFFGNSGAEANEAAFKLARHYACKKHSPFKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLAAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV     EF+Q LR +CD  +ALL+ DEVQ+G GR+GKLFAYE   ++PDI+T 
Sbjct: 194 PIQGEGGVMPATPEFMQGLRALCDQHNALLVLDEVQSGMGRSGKLFAYEHYAIQPDIITT 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L T+E+A+ M  G HG+TYGGN LA  + E  L+II +   L  V  
Sbjct: 254 AKALGGGFPVSAMLTTHEIASVMAPGVHGTTYGGNPLACAIAETALDIINTPEVLNGVDA 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTA 356
             +     L  I  +F ++F E+RG+GLL+G   V + A  A+K RD       E L+  
Sbjct: 314 RREQFVSALQDINQQF-DIFSEIRGKGLLLG--AVLN-AQHASKARDILNASAAEGLMVL 369

Query: 357 PSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
            +  +V+R +P L I   +I EG+ R  R   K+
Sbjct: 370 TAGSDVIRFVPSLVIEPTDIAEGMARFARAIAKV 403


>gi|238755269|ref|ZP_04616613.1| Succinylornithine transaminase [Yersinia ruckeri ATCC 29473]
 gi|238706503|gb|EEP98876.1| Succinylornithine transaminase [Yersinia ruckeri ATCC 29473]
          Length = 410

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 184/395 (46%), Positives = 242/395 (61%), Gaps = 17/395 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D+L  TY  +D    +G+G+ L+ + G  ++DFA GIAVN+LGH HP L A L  Q+EK
Sbjct: 13  DDWLVPTYAPADFIPVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPALKATLHEQAEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY--HYMAGKTN- 120
           LWH+ N Y +      A  LI +TFA+RVFF NSGAE+ E A+K AR+Y     A K   
Sbjct: 73  LWHLGNGYTNEPVLRLAKQLIDATFAERVFFCNSGAEANEAALKLARKYALETYANKPGQ 132

Query: 121 ---KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +IV+F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S +  I+  T
Sbjct: 133 SGEKNQIVSFRNAFHGRTLFTVSAGGQPKYSQDFAPLPAGISHGIFNDLASAEALINAQT 192

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV     +FL+ LR +CD  +ALLIFDEVQTG GRTG L+AY    V 
Sbjct: 193 CAVIVEPIQGEGGVIPADADFLRGLRVLCDRFNALLIFDEVQTGVGRTGALYAYMNYGVT 252

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPI A L TN  A  +N GSHG+TYGGN LA  +   V+ +I +   
Sbjct: 253 PDVLTSAKALGGGFPIAAMLTTNRFAGALNVGSHGTTYGGNPLACAVAGTVITLINTPEV 312

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVF---SPALL--AAKFRD 350
           L  V    +   +GLT I  R+P +F E+RG GLLIG  LK  +   S A++  AA+   
Sbjct: 313 LAGVKQRHEWFKQGLTKINERYP-VFSEIRGSGLLIGCVLKREYAGQSKAIIQAAAQHGV 371

Query: 351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
             L+  P   +VVR  P L I+  +I EGL R+ R
Sbjct: 372 IALIAGP---DVVRFAPSLIISPADIEEGLARLAR 403


>gi|34102807|gb|AAQ59171.1| acetylornithine transaminase [Chromobacterium violaceum ATCC 12472]
          Length = 391

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 174/369 (47%), Positives = 239/369 (64%), Gaps = 5/369 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G  F+D A GIAVNSLGH HPELVA L  Q+ KLWHVSN++ +      
Sbjct: 14  RGEGSRIWDQDGREFVDLAGGIAVNSLGHCHPELVAALTEQANKLWHVSNVFTNEPALKL 73

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ L+  TFA+RVFF NSGAE+ E A K AR+Y +     +K +I++   +FHGRTL T+
Sbjct: 74  ASLLVEKTFAERVFFCNSGAEANEAAFKLARKYAHDNFGADKNQILSCVNSFHGRTLFTV 133

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y EGFGP   G D  +F +++SLK  IS+ T A++IEPIQGE GV      FL
Sbjct: 134 SVGGQPKYTEGFGPVPGGIDHFEFNNIESLKAAISDRTCAVVIEPIQGESGVLPADPAFL 193

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  R++CD  +ALLIFDEVQ+G GRTG L+AY+   V PDI++ AKG+GGGFPIGA L T
Sbjct: 194 KAARELCDQHNALLIFDEVQSGMGRTGALYAYQQYGVTPDILSSAKGIGGGFPIGAMLTT 253

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            +VA     GSHGSTYGGN LA  +  KV++I+ S   L  V    K L  GL AI  ++
Sbjct: 254 EKVAKSFGIGSHGSTYGGNPLACAVAHKVVSIVSSPEVLAGVEARHKRLVAGLEAINAKY 313

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNVVRILPPLTITAEE 375
             +F +VRG+GLLIG          A +F      + L+   +  +V+R+ P L I+  +
Sbjct: 314 -KVFKQVRGKGLLIGCVLTDEYNGRAREFLKAAEKQQLMILVAGLSVLRLAPSLVISDAD 372

Query: 376 IHEGLERIE 384
           I EGL+R++
Sbjct: 373 IAEGLKRLD 381


>gi|150391118|ref|YP_001321167.1| acetylornithine and succinylornithine aminotransferase
           [Alkaliphilus metalliredigens QYMF]
 gi|149950980|gb|ABR49508.1| acetylornithine and succinylornithine aminotransferase
           [Alkaliphilus metalliredigens QYMF]
          Length = 399

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/384 (43%), Positives = 239/384 (62%), Gaps = 1/384 (0%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N N +L +TY ++ I F  GKG+ L    G  +LD  +G+AVNSLGHSHP +V  +K+Q+
Sbjct: 9   NGNQYLMSTYGRTPIAFLDGKGSTLTDTEGNEYLDMVAGLAVNSLGHSHPAVVEAIKNQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           EKL H SNLY    Q   A  L+ ++F D+VFF NSGAE+ E AIK AR+Y Y    ++K
Sbjct: 69  EKLLHTSNLYWIEGQVALAQKLVQNSFGDKVFFCNSGAEANEAAIKLARKYAYKKYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             I+   G+FHGRTL T+S     +Y EG+GP  EGF  ++F +L++LK  I+ +T  I+
Sbjct: 129 NEIIAMTGSFHGRTLGTLSITNNPKYQEGYGPLPEGFKFSEFNNLEALKGVITENTCGII 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           IEPIQGEGGV  V   FL+ +++IC   D LLIFDE+Q G GRTGKLFAYE   ++PDIM
Sbjct: 189 IEPIQGEGGVTPVEATFLKAVKEICVKNDILLIFDEIQCGLGRTGKLFAYENYEIEPDIM 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T+AK + GG PIGA +AT+EVA     G HG+T+GGN L   +G  V++ I  +   +  
Sbjct: 249 TLAKALAGGVPIGAVIATDEVAKAWCPGDHGTTFGGNPLVCAVGLAVIDTILQEKLSDQA 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDN 361
             I     E L    N++ +   +V+G GL++GL+       + A+   + +L   ++  
Sbjct: 309 KQIGMYFAEKLQGFVNQY-SWVKKVKGMGLILGLELEIEGTPIVAEAFKQGVLINCTAGK 367

Query: 362 VVRILPPLTITAEEIHEGLERIER 385
           ++R LPPL IT +E+ + +  + +
Sbjct: 368 ILRFLPPLIITEKEVDQTINTLAK 391


>gi|45440033|ref|NP_991572.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia pestis biovar Microtus str. 91001]
 gi|229836348|ref|ZP_04456515.1| Ornithine aminotransferase; Acetylornithineaminotransferase;
           N-succinyl-L,L-diaminopimelateaminotransferase [Yersinia
           pestis Pestoides A]
 gi|45434888|gb|AAS60449.1| acetylornithine delta-aminotransferase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|229706416|gb|EEO92423.1| Ornithine aminotransferase; Acetylornithineaminotransferase;
           N-succinyl-L,L-diaminopimelateaminotransferase [Yersinia
           pestis Pestoides A]
          Length = 409

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/399 (42%), Positives = 239/399 (59%), Gaps = 22/399 (5%)

Query: 1   MNKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAIL 57
           +N+N F   +   Y  +     KGKG+ ++ + G  ++DFA GIAV +LGH HP LV+ L
Sbjct: 11  VNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVSAL 70

Query: 58  KSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG 117
             Q E LWH SN++ +      A  LI +TFADRVFF NSGAE+ E A K AR Y     
Sbjct: 71  HQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFANSGAEANEAAFKLARHYAIERH 130

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +I+ F  AFHG TL T+S GG+ +Y +GFGPK        F DL ++K  + + T
Sbjct: 131 SPYKTKIIAFHNAFHGCTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHT 190

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGG+     EFLQ +R +CD  +ALL+FDEVQ+G GR+GKLF+Y    V 
Sbjct: 191 CAVVLEPIQGEGGITSATPEFLQGVRALCDQHNALLVFDEVQSGMGRSGKLFSYMHYGVT 250

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PDI+T AK +GGGFPI A L T E+A+ M  G+HG+TYGGN LA  + E  L++I +   
Sbjct: 251 PDILTTAKALGGGFPISAMLTTEEIASVMTVGTHGTTYGGNPLACAVAEAALDVINTPEV 310

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----- 352
           L  +     +  + L +I +++ ++F ++RG GLLIG       A L AK+R +      
Sbjct: 311 LNGIEQRHGLFVQALQSINSKY-DVFSDIRGMGLLIG-------AELTAKYRGQAREFLA 362

Query: 353 ------LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
                 L+   +  +V+R+ P L I  E+I +G+ R+E+
Sbjct: 363 AAAANGLMILNAGPDVLRLAPSLVIELEDIQQGMARLEK 401


>gi|291619208|ref|YP_003521950.1| ArgD [Pantoea ananatis LMG 20103]
 gi|291154238|gb|ADD78822.1| ArgD [Pantoea ananatis LMG 20103]
          Length = 406

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 173/378 (45%), Positives = 229/378 (60%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LK Q E LWH SN++ +      
Sbjct: 30  KGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVETLKKQGETLWHTSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI++TFA+RVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 90  ASKLINATFAERVFFANSGAEANEAAFKLARYYACKRHSPFKSKIIAFHNAFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPK        F DL ++K  I + T AI++EPIQGEGGV      F+
Sbjct: 150 TVGGQPKYSDGFGPKPADIVHVPFNDLDAVKAVIDDHTCAIVVEPIQGEGGVMPATPAFM 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q LR++CD   ALL+ DEVQ+G GR+GKLFAYE   V PDI+T AK +GGGFP+ A L T
Sbjct: 210 QGLRELCDKHQALLVLDEVQSGMGRSGKLFAYEHYGVTPDILTSAKALGGGFPVSAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           NEVA+ M  G HG+TYGGN LA  + E  L+II +   L  V    +   E L AI  R 
Sbjct: 270 NEVASTMAPGVHGTTYGGNPLACAIAETALDIINTPAVLNGVEIRRQQFVEALKAIDARH 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
            ++F ++RG+GLLIG      P   A K RD       E ++   +  +V+R  P L I 
Sbjct: 330 -DLFSDIRGKGLLIG--AALKPQ-HAGKARDILNASAAEGVMVLVAGTDVMRFAPSLIIE 385

Query: 373 AEEIHEGLERIERTAIKL 390
             +I EG+ R  R   K+
Sbjct: 386 PADIEEGMARFARAVEKV 403


>gi|148270205|ref|YP_001244665.1| acetylornithine aminotransferase [Thermotoga petrophila RKU-1]
 gi|147735749|gb|ABQ47089.1| acetylornithine aminotransferase [Thermotoga petrophila RKU-1]
          Length = 385

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 171/383 (44%), Positives = 240/383 (62%), Gaps = 5/383 (1%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +    F  GKG+W++ E G  +LDF SGIAVN LGHSHP LV  +K Q+EKL 
Sbjct: 2   YLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLI 61

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNL+ +  Q   A  L  +TF  +VFF N+G E+ E AIK AR+Y        K+RI+
Sbjct: 62  HCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKK-SEKKYRIL 120

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           +   +FHGRTL +++A G+ +Y + F P + GF+  +F +++ L+ ++S D  A+ +EPI
Sbjct: 121 SAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNIEDLRKKMSEDVCAVFLEPI 180

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGE G+    +EFL+  RK+CD+ DALL+FDEVQ G GRTGKLFAY+   V PD++T AK
Sbjct: 181 QGESGIVPATKEFLEGARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAK 240

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGG PIGA +  NE A  +  G HG+T+GGN LA   G  V+  +  +GFLE V    
Sbjct: 241 GLGGGVPIGAVI-VNERADVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKG 299

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGL--KTVFSPALLAAKFRDECLLTAPSSDNVV 363
             L E L  +K  F ++  +VRG GL+IG+  K   +   +A K  +  LL  P+ +N V
Sbjct: 300 NYLMEKLQEMKEEF-DLVADVRGMGLMIGIQFKEEVNNREIATKCFENKLLVVPAGNNTV 358

Query: 364 RILPPLTITAEEIHEGLERIERT 386
           R LPPLT+   EI   +E +++ 
Sbjct: 359 RFLPPLTVEYGEIDLAVETLKKV 381


>gi|160876984|ref|YP_001556300.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella baltica OS195]
 gi|160862506|gb|ABX51040.1| succinylornithine transaminase family [Shewanella baltica OS195]
 gi|315269187|gb|ADT96040.1| acetylornithine and succinylornithine aminotransferase [Shewanella
           baltica OS678]
          Length = 405

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 241/383 (62%), Gaps = 19/383 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ + G  F+DFA GIAVN LGH HP LV  LK+Q EKLWH+SN+  +      
Sbjct: 29  RGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEKLWHLSNVMTNEPALEL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L++STFAD+V+F NSGAE+ E A+K ARRY        K  I+ F+ AFHGRT  T+
Sbjct: 89  ATKLVNSTFADKVYFANSGAEANEAALKLARRYALEKHGVEKDEIIAFDKAFHGRTFFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+  Y +GFGPK +      F D+ +L+  +++ T AI++EP+QGEGG+      FL
Sbjct: 149 SVGGQAAYSDGFGPKPQSITHLPFNDVAALEAAVTDKTCAIMLEPLQGEGGIIDADPAFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           + +R++ +  +AL+IFDEVQTG GRTG+L+AY    + PDI+T AK +GGGFPI A L T
Sbjct: 209 KAVRELANKHNALVIFDEVQTGVGRTGELYAYMGTEIVPDILTTAKALGGGFPIAAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HGSTYGGN LA  +G  VL+++ +   L+ V +  ++L +GL  I  ++
Sbjct: 269 AEIAEHLKVGTHGSTYGGNPLACAIGNAVLDVVNTPEVLDGVKHREQLLRDGLNKINEKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RD-------ECLLTAPSSDNVVRILPP 368
            ++F EVRG+GLL+G       A+L  ++    RD       E L++  +  NVVR  P 
Sbjct: 329 -HVFSEVRGKGLLLG-------AVLNEQYQGRSRDFLVASVAEGLMSLMAGANVVRFAPS 380

Query: 369 LTITAEEIHEGLERIERTAIKLS 391
           L I   +I EGL R ER    ++
Sbjct: 381 LVIPEADIAEGLARFERAVASIA 403


>gi|238763758|ref|ZP_04624717.1| Succinylornithine transaminase [Yersinia kristensenii ATCC 33638]
 gi|238698060|gb|EEP90818.1| Succinylornithine transaminase [Yersinia kristensenii ATCC 33638]
          Length = 409

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 168/382 (43%), Positives = 230/382 (60%), Gaps = 19/382 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DFA GIAV +LGH HP LVA L  Q E LWH SN++ +      
Sbjct: 33  KGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVAALHQQGEMLWHTSNVFTNEPALRL 92

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSG E+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 93  AQKLIAATFADRVFFANSGGEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTV 152

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 153 SVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSATPEFL 212

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD   ALL+FDEVQ+G GR+GKLF Y    V PDI+T AK +GGGFP+ A L T
Sbjct: 213 QGVRALCDQHKALLVFDEVQSGMGRSGKLFTYMHYGVTPDILTTAKALGGGFPVSAMLTT 272

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L+ +     +  + L  I N++
Sbjct: 273 EEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEVLDGIEQRHGLFVQALQEINNKY 332

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF--RDECLLTAPSSD---------NVVRILPP 368
             +F ++RG GLLIG       A LA  +  R    LTA +++         +V+R+ P 
Sbjct: 333 -QVFDDIRGMGLLIG-------AELAPHYHGRAREFLTAAAANGVMILNAGPDVLRLAPS 384

Query: 369 LTITAEEIHEGLERIERTAIKL 390
           L I  E+I +G+ R+ER    L
Sbjct: 385 LVIEPEDIQQGMARLERAVASL 406


>gi|126172820|ref|YP_001048969.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella baltica OS155]
 gi|153002260|ref|YP_001367941.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella baltica OS185]
 gi|217974847|ref|YP_002359598.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella baltica OS223]
 gi|304410928|ref|ZP_07392545.1| succinylornithine transaminase family [Shewanella baltica OS183]
 gi|307304901|ref|ZP_07584651.1| succinylornithine transaminase family [Shewanella baltica BA175]
 gi|125996025|gb|ABN60100.1| acetylornithine aminotransferase [Shewanella baltica OS155]
 gi|151366878|gb|ABS09878.1| acetylornithine and succinylornithine aminotransferase [Shewanella
           baltica OS185]
 gi|217499982|gb|ACK48175.1| succinylornithine transaminase family [Shewanella baltica OS223]
 gi|304350825|gb|EFM15226.1| succinylornithine transaminase family [Shewanella baltica OS183]
 gi|306912303|gb|EFN42727.1| succinylornithine transaminase family [Shewanella baltica BA175]
          Length = 405

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 241/383 (62%), Gaps = 19/383 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ + G  F+DFA GIAVN LGH HP LV  LK+Q EKLWH+SN+  +      
Sbjct: 29  RGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEKLWHLSNVMTNEPALEL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L++STFAD+V+F NSGAE+ E A+K ARRY        K  I+ F+ AFHGRT  T+
Sbjct: 89  ATKLVNSTFADKVYFANSGAEANEAALKLARRYALEKHGVEKDEIIAFDKAFHGRTFFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+  Y +GFGPK +      F D+ +L+  +++ T AI++EP+QGEGG+      FL
Sbjct: 149 SVGGQAAYSDGFGPKPQSITHLPFNDVAALEAAVTDRTCAIMLEPLQGEGGIIDADPAFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           + +R++ +  +AL+IFDEVQTG GRTG+L+AY    + PDI+T AK +GGGFPI A L T
Sbjct: 209 KAVRELANKHNALVIFDEVQTGVGRTGELYAYMGTEIVPDILTTAKALGGGFPIAAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HGSTYGGN LA  +G  VL+++ +   L+ V +  ++L +GL  I  ++
Sbjct: 269 AEIAEHLKVGTHGSTYGGNPLACAIGNAVLDVVNTPEVLDGVKHREQLLRDGLNKINEKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RD-------ECLLTAPSSDNVVRILPP 368
            ++F EVRG+GLL+G       A+L  ++    RD       E L++  +  NVVR  P 
Sbjct: 329 -HVFSEVRGKGLLLG-------AVLNEQYQGRSRDFLVASVAEGLMSLMAGANVVRFAPS 380

Query: 369 LTITAEEIHEGLERIERTAIKLS 391
           L I   +I EGL R ER    ++
Sbjct: 381 LVIPEADIAEGLARFERAVASIA 403


>gi|308271349|emb|CBX27957.1| Acetylornithine aminotransferase [uncultured Desulfobacterium sp.]
          Length = 392

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 160/372 (43%), Positives = 242/372 (65%), Gaps = 1/372 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           + NTY +  I  EKG+G  ++  +G  ++DF +G+AV SLGHSHP +V  L SQ++ L+H
Sbjct: 13  IVNTYKRPSIVIEKGRGCKVWDTDGKSYIDFVAGVAVCSLGHSHPRVVKALCSQADILFH 72

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY +  Q   A  L+ ++FAD+VFF NSGAE+ E AIK AR+Y     +  +++I++
Sbjct: 73  VSNLYYTVPQVELALWLVENSFADKVFFCNSGAEANEAAIKLARKYFSTNNEKERYKIIS 132

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
            E +FHGRT+AT+SA G+ +  +G+ P +EGFD   F D+ +L N+I++ T A+L+EP+Q
Sbjct: 133 MERSFHGRTMATLSATGQDKVKKGYDPILEGFDFVPFNDIDALANKINSSTCAVLLEPVQ 192

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+ +    +L+++RK+CD+  ALLIFDE+QTG GRTGKLFAY+   V+PDIMT+AK 
Sbjct: 193 GEGGLWRPAPGYLKEVRKLCDETGALLIFDEIQTGIGRTGKLFAYQHFGVEPDIMTLAKA 252

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G G PIGA LA   VA+    GSH ST+GG  +      +VL ++  +  +E+   I  
Sbjct: 253 LGNGLPIGAMLAKEHVASAFVHGSHASTFGGTPVVTAAALEVLKVLSEEKVIEHCGRIGA 312

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
              E L  +K+R  ++  +VRG GL++G++       +  K  ++  L      NV+R +
Sbjct: 313 YFMERLMWLKSRHSSI-RDVRGIGLMLGIELDTEGEPVVNKCLEKGFLVNCIQGNVIRFI 371

Query: 367 PPLTITAEEIHE 378
           PPL I+ +EI +
Sbjct: 372 PPLIISKQEIDD 383


>gi|87122522|ref|ZP_01078401.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Marinomonas sp. MED121]
 gi|86162164|gb|EAQ63450.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Marinomonas sp. MED121]
          Length = 392

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 169/384 (44%), Positives = 235/384 (61%), Gaps = 5/384 (1%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +   Y  S +   +G+G+ ++      ++DFA GIAV +LGHSHP+LV +++ Q+ ++WH
Sbjct: 1   MVPNYAPSAVIPVRGEGSRVWDTENNEYIDFAGGIAVTALGHSHPKLVDVMRQQAGQIWH 60

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           ++N+  +      A  L   TFAD+VFF NSG E+ E A K  RRY +      K  I+ 
Sbjct: 61  LANVMTNEPALRLAKKLTEKTFADKVFFCNSGGEANEAAFKLVRRYAFDHYGPQKHEIIA 120

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F  +FHGRTL T+S GG+ +Y EGF P   G     + +++ LK  IS+ T A+++EPIQ
Sbjct: 121 FNKSFHGRTLFTVSVGGQAKYKEGFEPTPGGISHCDYNNIEQLKALISDRTCAVVMEPIQ 180

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+     EF +Q+R++CD+ +ALL+FDEVQ+G GRTG  FAYE   VKPD++T AK 
Sbjct: 181 GEGGIIPADVEFAKQVRELCDEHNALLVFDEVQSGVGRTGTFFAYEQLGVKPDVLTSAKA 240

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G GFP+GA LAT + A  +  G+HGSTYGGN +A  + E V++II +   LE V    +
Sbjct: 241 LGNGFPVGAMLATEKAAKSLAFGTHGSTYGGNPMACAIAEAVIDIIDTPEVLEGVAKRRQ 300

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNV 362
           I  EGL AI  +  N+F EVRG GLLIG + V + A  AA F      E L    +  NV
Sbjct: 301 IFVEGLNAINEKH-NIFKEVRGMGLLIGAEVVDAFAGKAALFIKAAAKEGLFILVAGPNV 359

Query: 363 VRILPPLTITAEEIHEGLERIERT 386
           VR  P L I   +I  GLER E+ 
Sbjct: 360 VRFAPSLIIPEGDIQAGLERFEKA 383


>gi|219681880|ref|YP_002468266.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|219682435|ref|YP_002468819.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|257471585|ref|ZP_05635584.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum)]
 gi|219622168|gb|ACL30324.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|219624723|gb|ACL30878.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|311087420|gb|ADP67500.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. JF99 (Acyrthosiphon pisum)]
          Length = 408

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 170/373 (45%), Positives = 233/373 (62%), Gaps = 11/373 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV SLGH HP L   LK+QS+ LWH+SN++ +      
Sbjct: 30  KGKGSRIWDQKGKEYIDFSGGIAVTSLGHCHPILNKTLKNQSKMLWHLSNIFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ S+FA R+FF NSGAE+ E A K AR Y        K +I++F  +FHGRT  T+
Sbjct: 90  AKKLLSSSFASRIFFANSGAEANEAAFKLARYYSSKIYNFKKNKIISFYNSFHGRTFFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y   FGPK  G   A F D+ S+KN I +DT A+++E IQGEGGV      F+
Sbjct: 150 SVGGQSKYSNNFGPKPAGIVHASFNDINSVKNLIDHDTCAVVVELIQGEGGVIPANLTFV 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q L+++C   + LLIFDE+QTG GRTGKLF YE+  + PDI+TIAK +GGGFPI A L T
Sbjct: 210 QALKELCKQYNVLLIFDEIQTGIGRTGKLFYYEYYAITPDILTIAKSLGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           NEVA+ +  G HG+TYGGN LA  + E V++II +   L  V   +K +   L  I  RF
Sbjct: 270 NEVASVIAPGIHGTTYGGNPLACAVAESVIDIINTKKVLSGVEKKSKKIISELNIINKRF 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSP-------ALLAAKFRDECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG+GLLIG+  V  P        +L   F  E ++   + +NV+R+ P L I 
Sbjct: 330 -KLFTEIRGRGLLIGI--VLKPNVSRNIHKILNFSF-SEGVIFLTAGNNVIRLAPSLIIK 385

Query: 373 AEEIHEGLERIER 385
             +I EG++R  R
Sbjct: 386 ELDIIEGMKRFYR 398


>gi|291280008|ref|YP_003496843.1| acetylornithine transaminase [Deferribacter desulfuricans SSM1]
 gi|290754710|dbj|BAI81087.1| acetylornithine transaminase [Deferribacter desulfuricans SSM1]
          Length = 386

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 173/391 (44%), Positives = 255/391 (65%), Gaps = 15/391 (3%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           F+ NTY + D+ F KG G++LF ++G  +LDFASGIAV +LGH++ E+  ++ +Q++ L 
Sbjct: 3   FVMNTYSRFDLEFVKGDGSYLFDKDGNRYLDFASGIAVTNLGHANKEIAEVICNQAKTLL 62

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY+ + QE  A  L    F  +VFF NSGAE+ E AIK A+ Y        +++IV
Sbjct: 63  HTSNLYKISSQEELAEKLSKRGFGGKVFFCNSGAEANEAAIKLAKIYGNKKYDGVRYKIV 122

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN-DTAAILIEP 184
           T EG+FHGRT AT+SA G+ +  +GF P ++ F    + D  SL N + + D  AI++E 
Sbjct: 123 TMEGSFHGRTYATLSATGQEKVKKGFEPPMDFFVHVPYNDYDSLYNVVKDGDVIAIMLEV 182

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQGEGG++K    +L+ +R++C+ +D LLIFDEVQTG GRTGKLFAY+  +V PD++T+A
Sbjct: 183 IQGEGGLKKADIAYLKNVRELCNRLDILLIFDEVQTGIGRTGKLFAYQHYDVIPDVITLA 242

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           KG+G G PIGA +A  + A  ++ G+H ST+GGN LA  +  KVL++I  D  L++V   
Sbjct: 243 KGLGNGVPIGAMMAKEQFAEYLSPGTHASTFGGNYLACAVANKVLDLI-DDELLQSVQE- 300

Query: 305 AKILFEGLTAIKNRFPNMFL---EVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSS 359
                +GL  +K++   +F    EVRG+GL++G  L  V +   +  +   E +L  P+ 
Sbjct: 301 -----KGLY-LKSKLKEIFSGKGEVRGEGLMLGVALNDVNNMDFI-NELHKEFMLAVPAG 353

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           DNVVR+ PPLT+T EEI EG+ ++E+   KL
Sbjct: 354 DNVVRLYPPLTVTKEEIDEGITKLEKVINKL 384


>gi|15596092|ref|NP_249586.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas aeruginosa PAO1]
 gi|218893136|ref|YP_002442005.1| bifunctional succinylornithine transaminase/acetylornithine
           aminotransferase [Pseudomonas aeruginosa LESB58]
 gi|254245182|ref|ZP_04938504.1| N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa 2192]
 gi|28376964|sp|O30508|ARUC_PSEAE RecName: Full=Succinylornithine transaminase/acetylornithine
           aminotransferase; Short=ACOAT; Short=SOAT;
           Short=Succinylornithine aminotransferase
 gi|9946796|gb|AAG04284.1|AE004524_1 N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa PAO1]
 gi|2654609|gb|AAC46009.1| succinylornithine aminotransferase [Pseudomonas aeruginosa PAO1]
 gi|126198560|gb|EAZ62623.1| N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa 2192]
 gi|218773364|emb|CAW29176.1| N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa LESB58]
          Length = 406

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 233/378 (61%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAV SLGH+HP LV  L  Q++++WHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ +TFA+RVF  NSGAE+ E A K ARRY        K+ I+    +FHGRTL T+
Sbjct: 90  ARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYEIIAASNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPK EG     + DL++LK  IS+ T A+++EPIQGEGGV    + +L
Sbjct: 150 NVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVVLEPIQGEGGVLPAQQAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALL+FDEVQ+G GR G+LFAY    V PDI++ AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  ++ G+HG+TYGGN LA  + E  L++I +   L+ V    +     L  I   +
Sbjct: 270 GEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKHERFKSRLQKIGQEY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLLIG            K RD       E ++   +S +VVR  P L I 
Sbjct: 330 -GIFDEIRGMGLLIGAALTDE---WKGKARDVLNAAEKEAVMVLQASPDVVRFAPSLVID 385

Query: 373 AEEIHEGLERIERTAIKL 390
             EI EGLER ER   KL
Sbjct: 386 DAEIDEGLERFERAVAKL 403


>gi|296390751|ref|ZP_06880226.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas aeruginosa PAb1]
 gi|313105778|ref|ZP_07792041.1| N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa 39016]
 gi|310878543|gb|EFQ37137.1| N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa 39016]
          Length = 406

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 233/378 (61%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAV SLGH+HP LV  L  Q++++WHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ +TFA+RVF  NSGAE+ E A K ARRY        K+ I+    +FHGRTL T+
Sbjct: 90  ARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYEIIAASNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPK EG     + DL++LK  IS+ T A+++EPIQGEGGV    + +L
Sbjct: 150 NVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVVLEPIQGEGGVLPAQQAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALL+FDEVQ+G GR G+LFAY    V PDI++ AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  ++ G+HG+TYGGN LA  + E  L++I +   L+ V    +     L  I   +
Sbjct: 270 GEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKHERFKSRLQKIGQEY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLLIG            K RD       E ++   +S +VVR  P L I 
Sbjct: 330 -GIFGEIRGMGLLIGAALTDE---WKGKARDVLNAAEKEAVMVLQASPDVVRFAPSLVID 385

Query: 373 AEEIHEGLERIERTAIKL 390
             EI EGLER ER   KL
Sbjct: 386 DAEIDEGLERFERAVAKL 403


>gi|311086256|gb|ADP66338.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)]
          Length = 408

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 170/373 (45%), Positives = 233/373 (62%), Gaps = 11/373 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV SLGH HP L   LK+QS+ LWH+SN++ +      
Sbjct: 30  KGKGSRIWDQKGKEYIDFSGGIAVTSLGHCHPILNKTLKNQSKMLWHLSNIFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ S+FA R+FF NSGAE+ E A K AR Y        K +I++F  +FHGRT  T+
Sbjct: 90  AKKLLSSSFASRIFFANSGAEANEAAFKLARYYSSKIYNFKKNKIISFYNSFHGRTFFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y   FGPK  G   A F D+ S+KN I +DT A+++E IQGEGGV      F+
Sbjct: 150 SVGGQSKYSNNFGPKPAGIVHASFNDINSVKNLIDHDTCAVVVELIQGEGGVIPANLTFV 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q L+++C   + LLIFDE+QTG GRTGKLF YE+  + PDI+TIAK +GGGFPI A L T
Sbjct: 210 QALKELCKQYNVLLIFDEIQTGIGRTGKLFYYEYYAITPDILTIAKSLGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           NEVA+ +  G HG+TYGGN LA  + E V++II +   L  V   +K +   L  I  RF
Sbjct: 270 NEVASVIAPGIHGTTYGGNPLACAVAESVIDIINTKKVLSGVEKKSKKIISELNIINKRF 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSP-------ALLAAKFRDECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG+GLLIG+  V  P        +L   F  E ++   + +NV+R+ P L I 
Sbjct: 330 -KLFTEIRGRGLLIGI--VLKPNVSHNIHKILNFSF-SEGVVFLTAGNNVIRLAPSLIIK 385

Query: 373 AEEIHEGLERIER 385
             +I EG++R  R
Sbjct: 386 ELDIIEGMKRFYR 398


>gi|117617515|ref|YP_857671.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117558922|gb|ABK35870.1| acetylornithine/succinyldiaminopimelate aminotransferase [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 405

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 168/393 (42%), Positives = 244/393 (62%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  + I   +G+G+ ++ + G  ++DFA GIAVN LGH HP+LV  LK+Q EK
Sbjct: 13  DEVMVPNYAPAKIIPVRGEGSRVWDQEGREYVDFAGGIAVNGLGHCHPKLVEALKTQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+ +TFAD+V+F NSGAE+ E A+K ARRY       +K +
Sbjct: 73  LWHLSNVMTNEPALRLAKKLVAATFADKVYFCNSGAEANEAALKLARRYAIEKFGAHKTQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T+S GG+  Y +GFGPK        + DL  L   IS++T A+++E
Sbjct: 133 IIAFHQGFHGRTFFTVSVGGQAAYSDGFGPKPADITHVAYNDLAELAAVISDNTCAVVME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+ +  +EF + +R++CD  +ALLI+DEVQ+G GRTG LFAY    V PDI+T 
Sbjct: 193 PLQGEGGIIRPTDEFAKGVRELCDKHNALLIYDEVQSGVGRTGDLFAYMGLGVTPDILTS 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++A+ +  G+HGSTYGGN LA  + E V++++ +   L  +  
Sbjct: 253 AKALGGGFPIGAMLTTTDIASHLKVGTHGSTYGGNPLACAVAEAVIDVVNTPEVLNGIKQ 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
             ++  EG+ AI  ++ + F EVRG+GLL+G       K      LLA+   D+ L+   
Sbjct: 313 REQLFREGIEAINAKY-HCFSEVRGKGLLLGAVLNDDYKGRSRDFLLASI--DQGLMALV 369

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L I   +I EGL R E+   ++
Sbjct: 370 AGTNVVRFAPSLVIPEADIKEGLVRFEKAVAQV 402


>gi|157371084|ref|YP_001479073.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Serratia proteamaculans 568]
 gi|157322848|gb|ABV41945.1| acetylornithine and succinylornithine aminotransferase [Serratia
           proteamaculans 568]
          Length = 404

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 168/391 (42%), Positives = 239/391 (61%), Gaps = 5/391 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D++   Y  +D    +G+G+ ++ + G  ++DFA GIAVN+LGH+HP + A L  Q+ K
Sbjct: 13  DDWMVPVYAPADFILVRGEGSQVWDQQGKSYIDFAGGIAVNALGHAHPVVTAALVEQAGK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+ N Y +      A  LI +TFAD+VFF NSGAE+ E A+K AR+     G ++K +
Sbjct: 73  LWHLGNGYTNEPVLRLAKQLIDATFADKVFFCNSGAEANEAALKLARKRALDQGNSSKNQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL +    I++ T A+++E
Sbjct: 133 IVAFNNAFHGRTLFTVSAGGQPKYSKDFAPLPGGITHTPFNDLAAAAEVINDHTCAVIVE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV      FLQ LR++CD  DA+LIFDEVQTG GRTG+L+AY    V PD++T 
Sbjct: 193 PIQGEGGVLPADPAFLQGLRELCDRHDAVLIFDEVQTGMGRTGELYAYTQYGVVPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +G GFPIGA L T+E+A  +  G+HG+TYGGN LA  +   V +II +   L+ V  
Sbjct: 253 AKALGCGFPIGAMLTTDELAKTLGVGTHGTTYGGNPLATAVAGAVFSIINTPEVLDGVKQ 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
             +   +GL  I  ++P +F E+RG GLLIG +     A  A +      +E ++   + 
Sbjct: 313 RHQWFLDGLNKINQQYP-IFSEIRGGGLLIGCQLTQDYAGKAKQITQLANEEGVIALIAG 371

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
            +VVR  P L I  +++ EGL R  R   ++
Sbjct: 372 PDVVRFTPSLIIPEQDVKEGLARFARAVARI 402


>gi|326390045|ref|ZP_08211607.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325993910|gb|EGD52340.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 394

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 237/376 (63%), Gaps = 3/376 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +  I   +GKG  ++ + G  +LDF +GIAVNSLGH HP LV  +K+QSEKL 
Sbjct: 9   YLMNTYSRYPITLVEGKGTKVWDDKGNVYLDFVAGIAVNSLGHCHPALVDAIKNQSEKLI 68

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY +  Q   A  +  ++F D+VFF NSGAE+ E AIK AR+Y  +   + +++++
Sbjct: 69  HCSNLYWNENQIQLAKTIAENSFGDKVFFVNSGAEANEGAIKLARKYASLKYGSKRYKVI 128

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           + + +FHGRT   ++A G+ +Y +GFGP + GF    F D+ +L   I ++  AI++E +
Sbjct: 129 SAKNSFHGRTFGALTATGQEKYHKGFGPLLSGFKYVPFNDIDALYEAIDDEVCAIMLEVV 188

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+ +   E+++  R+ICD+ D L I DEVQTG GRTGKLF YE   + PDIMT+AK
Sbjct: 189 QGEGGIHEATPEYIKAAREICDENDILFIIDEVQTGIGRTGKLFGYEHYGITPDIMTLAK 248

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFPIGA +A  E  A    G H ST+GG+ LA   G  V+N I  +GFL++V    
Sbjct: 249 GLGGGFPIGAIVA-KEDKAVFQPGDHASTFGGSPLACAAGIAVMNEITKEGFLDSVAQKG 307

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL-LAAKFRDECLLTAPSSDNVVR 364
           +     L  +K ++ ++  EVRG+GL+IG +     A  +  K   + LL    S NV+R
Sbjct: 308 EYFRRKLKNLKEKY-SVIKEVRGKGLMIGCEMDMEEASDIVTKAMGKGLLINCISHNVLR 366

Query: 365 ILPPLTITAEEIHEGL 380
            +PPLT+T EEI   L
Sbjct: 367 FVPPLTVTEEEIDTAL 382


>gi|15617128|ref|NP_240341.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. APS (Acyrthosiphon pisum)]
 gi|11131258|sp|P57600|ARGD_BUCAI RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase; Short=ACOAT; Short=DapATase;
           Short=Succinyldiaminopimelate transferase
 gi|25287232|pir||C84992 acetylornithine transaminase (EC 2.6.1.11) [imported] - Buchnera
           sp. (strain APS)
 gi|10039193|dbj|BAB13227.1| acetylornithine aminotransferase [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
          Length = 408

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 232/372 (62%), Gaps = 9/372 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV SLGH HP L   LK+QS+ LWH+SN++ +      
Sbjct: 30  KGKGSRIWDQKGKEYIDFSGGIAVTSLGHCHPILNKTLKNQSKMLWHLSNIFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ S+FA R+FF NSGAE+ E A K AR Y        K +I++F  +FHGRT  T+
Sbjct: 90  AKKLLSSSFASRIFFANSGAEANEAAFKLARYYSSKIYNFKKNKIISFYNSFHGRTFFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y   FGPK  G   A F D+ S+KN I +DT A+++E IQGEGGV      F+
Sbjct: 150 SVGGQSKYSNNFGPKPAGIVHASFNDINSVKNLIDHDTCAVVVELIQGEGGVIPANLTFV 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q L+++C   + LLIFDE+QTG GRTGKLF YE+  + PDI+TIAK +GGGFPI A L T
Sbjct: 210 QALKELCKQYNVLLIFDEIQTGIGRTGKLFYYEYYAITPDILTIAKSLGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           NEVA+ +  G HG+TYGGN LA  + E V++II +   L  V   +K +   L  I  RF
Sbjct: 270 NEVASVIAPGIHGTTYGGNPLACAVAESVIDIINTKKVLSGVEKKSKKIISELNIINKRF 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFR------DECLLTAPSSDNVVRILPPLTITA 373
             +F E+RG+GLLIG+  V  P +     +       E ++   + +NV+R+ P L I  
Sbjct: 330 -KLFTEIRGRGLLIGI--VLKPNVSRNIHKILNFSLSEGVIFLTAGNNVIRLAPSLIIKE 386

Query: 374 EEIHEGLERIER 385
            +I EG++R  R
Sbjct: 387 LDIIEGMKRFYR 398


>gi|88800589|ref|ZP_01116150.1| acetylornithine transaminase [Reinekea sp. MED297]
 gi|88776644|gb|EAR07858.1| acetylornithine transaminase [Reinekea sp. MED297]
          Length = 402

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 168/385 (43%), Positives = 241/385 (62%), Gaps = 5/385 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y    I   KG+G+ ++ ++G  ++DFA GIAVN+LGH+HP LV  L  Q +K
Sbjct: 10  DDVMVPNYAPGKIIPVKGEGSRVWDQDGREYIDFAGGIAVNALGHAHPALVNALTEQGKK 69

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   TFAD+VFF NSGAE+ E A+K ARR+ ++     K  
Sbjct: 70  LWHLSNVMTNEPAIALAKKLTDLTFADKVFFCNSGAEANEAALKLARRHAFLNHGEAKHE 129

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++   +FHGRTL T+S GG+ +Y EGF P   G     + DL +L++QIS+ TAA+++E
Sbjct: 130 IISTLSSFHGRTLFTVSVGGQAKYKEGFEPTPGGISHVPYNDLAALRDQISDKTAAVIVE 189

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV    +E+L+ +R++CD+ DALLIFDEVQ+G GRTG L+AYE   V PDI++ 
Sbjct: 190 PIQGEGGVTPATQEYLEGVRQLCDEHDALLIFDEVQSGVGRTGHLYAYEHYGVTPDILST 249

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T+ VA  +  G+HGSTYGGN LA  +   VL+ +   G L+ V  
Sbjct: 250 AKALGGGFPIGAMLCTDAVAPSLAIGTHGSTYGGNPLACSVSLAVLDELTKPGVLDAVQA 309

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
            ++    GL A+  ++  +F ++RG GLLIG +        A  F     ++ L+   + 
Sbjct: 310 KSERYKAGLAALNEKY-GIFKDIRGLGLLIGAELTDEWQGKAKDFLGAALEQGLMMLVAG 368

Query: 360 DNVVRILPPLTITAEEIHEGLERIE 384
            NV+R  P L I   +I EGL +++
Sbjct: 369 PNVIRFAPSLIIPDADIDEGLAKLD 393


>gi|270262294|ref|ZP_06190566.1| succinylornithine transaminase [Serratia odorifera 4Rx13]
 gi|270044170|gb|EFA17262.1| succinylornithine transaminase [Serratia odorifera 4Rx13]
          Length = 404

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 169/391 (43%), Positives = 238/391 (60%), Gaps = 5/391 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D++   Y  +D    +G+G+ ++ + G  ++DFA GIAVN+LGH+HP + A L  Q+ K
Sbjct: 13  DDWMVPVYAPADFILVRGEGSQVWDQQGKSYIDFAGGIAVNALGHAHPAVKAALVEQAGK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+ N Y +    + A  LI +TFA++VFF NSGAE+ E A+K AR+     G   K +
Sbjct: 73  LWHLGNGYTNEPVLLLAKQLIDATFAEKVFFCNSGAEANEAALKLARKRALDNGNAGKNQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL +    I++ T A+++E
Sbjct: 133 IVAFNNAFHGRTLFTVSAGGQPKYSKDFAPLPGGISHTAFNDLAAAAELINDQTCAVIVE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV      FLQ LR++CD  DALLIFDEVQTG GRTG L+AY    V PD++T 
Sbjct: 193 PIQGEGGVLPADAAFLQGLRELCDRHDALLIFDEVQTGVGRTGHLYAYMQYGVVPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T+ +A  ++ G+HG+TYGGN LA  +   V +II +   LE V  
Sbjct: 253 AKALGGGFPIGAMLTTDALAKTLSVGTHGTTYGGNPLATAVAGAVFSIINTPEVLEGVKQ 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
             +   +GL  I  ++P +F E+RG GLLIG +     A  A +      +E ++   + 
Sbjct: 313 RHQWFIDGLNEINRQYP-IFSEIRGGGLLIGCQLNKDYAGKAKQITQLANEEGVIALIAG 371

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
            +VVR  P L I  +++ EGL R  R   ++
Sbjct: 372 PDVVRFTPSLIIPEQDVKEGLARFARAVARI 402


>gi|152989274|ref|YP_001349964.1| bifunctional succinylornithine transaminase/acetylornithine
           aminotransferase [Pseudomonas aeruginosa PA7]
 gi|150964432|gb|ABR86457.1| N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa PA7]
          Length = 406

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 234/378 (61%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAV SLGH+HP LV  L  Q++++WHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ +TFA+RVF  NSGAE+ E A K ARRY        K+ I+    +FHGRTL T+
Sbjct: 90  ARKLVDATFAERVFLANSGAEANEAAFKLARRYASDVYGPQKYEIIAASNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPK EG     + DL++L+  IS+ T A+++EPIQGEGGV    + +L
Sbjct: 150 NVGGQPKYSDGFGPKFEGITHVPYNDLEALRAAISDKTCAVVLEPIQGEGGVLPAQQAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALL+FDEVQ+G GR G+LFAY    V PDI++ AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLVFDEVQSGMGRIGELFAYMHYGVVPDILSSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           +E+A  ++ G+HG+TYGGN LA  + E  L++I +   L+ V    +     L  I   +
Sbjct: 270 SEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKHERFKSRLQKIGQEY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLLIG            K RD       E ++   +S +VVR  P L I 
Sbjct: 330 -GIFGEIRGMGLLIGAALTEE---WKGKARDVLNAAEKEAVMVLQASPDVVRFAPSLVID 385

Query: 373 AEEIHEGLERIERTAIKL 390
             EI EGLER ER   KL
Sbjct: 386 DAEIDEGLERFERAVAKL 403


>gi|21672780|ref|NP_660847.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Buchnera aphidicola str. Sg (Schizaphis graminum)]
 gi|25008136|sp|P59086|ARGD_BUCAP RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase; Short=ACOAT; Short=DapATase;
           Short=Succinyldiaminopimelate transferase
 gi|21623428|gb|AAM68058.1| acetylornithine aminotransferase [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 404

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 170/386 (44%), Positives = 241/386 (62%), Gaps = 11/386 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           N  +   Y+ +     KGKG+ L+ + G  ++DF+ GIAV SLGH HP L  +L+ QS+K
Sbjct: 14  NKLILPVYNPAFFIPVKGKGSRLWDQKGKEYIDFSGGIAVTSLGHCHPVLNKVLRQQSKK 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN++ +      A+ LI S+FA RVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHISNIFTNEPALRLADKLISSSFASRVFFANSGAEANEAAFKLARYYSSKIYNLKKNK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++F  +FHGRT  T+S GG+ +Y + FGPK      AKF ++ S+K+ I ++T A+++E
Sbjct: 134 IISFYNSFHGRTFFTVSVGGQAKYSDFFGPKPPAIMHAKFNEINSVKSIIDDNTCAVVME 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
            IQGEGG+      F++++R +C   +ALLIFDE+QTG GRT KL+AYE   V+PDI+TI
Sbjct: 194 LIQGEGGIVPADVAFVREIRDLCYKYNALLIFDEIQTGIGRTSKLYAYEHYEVQPDILTI 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +G GFPI A L TN +A+ +  G HG+TYGGN LA  + E V+NI+ +  FL  V  
Sbjct: 254 AKSLGSGFPISATLTTNGIASVIKPGIHGTTYGGNPLACSIAESVVNIVNTKKFLLGVEK 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL-------LAAKFRDECLLTA 356
            +K +   L  I  RF  +F E+RG+GLLIG+  V  P L       L A F  E ++  
Sbjct: 314 KSKKIISELNIINKRF-GLFTEIRGKGLLIGI--VLRPELSEEIHNILNALFL-EGVIVL 369

Query: 357 PSSDNVVRILPPLTITAEEIHEGLER 382
            +  NV+R+ P L I+  +I EG++R
Sbjct: 370 TAGKNVIRLAPSLIISKRDIVEGMKR 395


>gi|262373191|ref|ZP_06066470.1| ornithine-oxo-acid transaminase [Acinetobacter junii SH205]
 gi|262313216|gb|EEY94301.1| ornithine-oxo-acid transaminase [Acinetobacter junii SH205]
          Length = 401

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 173/391 (44%), Positives = 234/391 (59%), Gaps = 5/391 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ND++   +  ++    +G+G+ L+ +N   ++DFA GIAVN+LGH+HP  V  L  Q++K
Sbjct: 12  NDWMVPVFAPANFILVRGEGSRLWDQNDKEYIDFAGGIAVNALGHAHPVAVNALTEQAQK 71

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+ N Y +      A  L+ STFAD+VFF NSGAE+ E A+K AR+   ++G  NK  
Sbjct: 72  LWHIGNGYTNEPVLRLAKQLVDSTFADKVFFCNSGAEANEAALKLARKIGLLSGNPNKNH 131

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           IV F+ AFHGRTL T++AGG+ +Y + F P  EG +   F DL++ K  I+ +T A+++E
Sbjct: 132 IVAFKNAFHGRTLFTVTAGGQPKYSQDFAPLPEGIEHTAFNDLEAAKAVINENTCAVIVE 191

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV     EFL+ LR +CD   A+LIFDEVQTG GRTG L+AY    V PDI+T 
Sbjct: 192 PIQGEGGVVPADIEFLKGLRALCDANGAVLIFDEVQTGVGRTGSLYAYMNTGVTPDILTT 251

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA + T+  A     G HG+TYGGN LA  +   V   I +   LE V  
Sbjct: 252 AKALGGGFPIGAMITTDHYANMYAVGDHGTTYGGNPLACAVAGAVFEFINTPEVLEGVKQ 311

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
             +   + L  I  ++  +F E+RGQGLLIG       A  A        +E LL   + 
Sbjct: 312 RHQYFVDALNKINAQY-GLFKEIRGQGLLIGCVLKDEHAGKAKNIVTLAGEEGLLALVAG 370

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
            +VVR  P L I  E+I EGL R  R   +L
Sbjct: 371 ADVVRFTPSLIIPMEDIDEGLNRFSRALARL 401


>gi|256822013|ref|YP_003145976.1| succinylornithine transaminase family [Kangiella koreensis DSM
           16069]
 gi|256795552|gb|ACV26208.1| succinylornithine transaminase family [Kangiella koreensis DSM
           16069]
          Length = 406

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 165/399 (41%), Positives = 249/399 (62%), Gaps = 19/399 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y+ + I  E+G G+ ++ ++G  ++DFA GIAV +LGH+HP LV  LK Q++K
Sbjct: 16  DEVMVPNYNPATIIPERGDGSRVWDQDGNDYVDFAGGIAVTALGHNHPALVKALKDQADK 75

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN++ +      A+ L  +TFAD+VFF NSG E+ E A K  R+Y +      K  
Sbjct: 76  IWHLSNVFTNKPALELADKLTKATFADKVFFANSGGEANEAAFKLVRKYAHDNFGPEKSE 135

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++F+ +FHGRTL T+  GG+ +Y EGF P   G   A++ +LQSL+  IS+ T A+++E
Sbjct: 136 IISFKQSFHGRTLFTVCVGGQPKYTEGFEPLPGGISHAEYNNLQSLEAIISDKTCAVVME 195

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+    EEF++ +R +CD  +ALL+FDEVQTG GRTG L+AY    V PDI+T 
Sbjct: 196 PVQGEGGIVPATEEFVKGVRALCDKHNALLVFDEVQTGVGRTGHLYAYMGMGVTPDILTT 255

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK MGGGFPIGA L T+++AA    G+HGSTYGGN L   +   V + I +   L++V++
Sbjct: 256 AKAMGGGFPIGAMLTTDKIAASFVPGTHGSTYGGNPLGCAVSNAVFDTINTPEMLQSVLD 315

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----------- 352
            +  +   L  I  ++ ++F  VRG+GLL+G       A+L  K++ +            
Sbjct: 316 KSAKIVARLEEIGKKY-DVFSSVRGRGLLLG-------AVLNEKWQGKARQFIEAGWQHG 367

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           ++   +  NVVR+ P L IT EEI +GL R E+    ++
Sbjct: 368 VMVLVAGMNVVRLAPALNITDEEIEDGLNRFEKAVASIA 406


>gi|107100353|ref|ZP_01364271.1| hypothetical protein PaerPA_01001378 [Pseudomonas aeruginosa PACS2]
          Length = 390

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 232/378 (61%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAV SLGH+HP LV  L  Q+ ++WHVSN++ +      
Sbjct: 14  RGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQARRIWHVSNVFTNEPALRL 73

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ +TFA+RVF  NSGAE+ E A K ARRY        K+ I+    +FHGRTL T+
Sbjct: 74  ARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYEIIAASNSFHGRTLFTV 133

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPK EG     + DL++LK  IS+ T A+++EPIQGEGGV    + +L
Sbjct: 134 NVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVVLEPIQGEGGVLPAQQAYL 193

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALL+FDEVQ+G GR G+LFAY    V PDI++ AK +GGGFPIGA L T
Sbjct: 194 EGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSSAKSLGGGFPIGAMLTT 253

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  ++ G+HG+TYGGN LA  + E  L++I +   L+ V    +     L  I   +
Sbjct: 254 GEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKHERFKSRLQKIGQEY 313

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLLIG            K RD       E ++   +S +VVR  P L I 
Sbjct: 314 -GIFGEIRGMGLLIGAALTDE---WKGKARDVLNAAEKEAVMVLQASPDVVRFAPSLVID 369

Query: 373 AEEIHEGLERIERTAIKL 390
             EI EGLER ER   KL
Sbjct: 370 DAEIDEGLERFERAVAKL 387


>gi|307264945|ref|ZP_07546506.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919930|gb|EFN50143.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 394

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 166/372 (44%), Positives = 237/372 (63%), Gaps = 3/372 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           ++ NTY +  I   +GKG  ++ + G  +LDF +GIAVNSLGH HP LV  +K+QSEKL 
Sbjct: 9   YVMNTYSRYPITLIEGKGTKVWDDKGNVYLDFVAGIAVNSLGHCHPALVDAIKNQSEKLI 68

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY +  Q   A  +  ++F DRVFF NSGAE+ E AIK AR+Y  +     +++++
Sbjct: 69  HCSNLYWNENQIELAKIIAENSFGDRVFFANSGAEANEGAIKLARKYASLKYGDKRYKVI 128

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           + + +FHGRT   ++A G+ +Y +GFGP + GF    F D+ +L   I ++  AI++E +
Sbjct: 129 SAKNSFHGRTFGALTATGQEKYHKGFGPLLSGFKYVPFNDIDALYEAIDDEVCAIMLEVV 188

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+ +   E+++  R+ICD+ D L I DEVQTG GRTGKLF YE   V PDIMT+AK
Sbjct: 189 QGEGGIHEATPEYIKVAREICDENDILFIIDEVQTGIGRTGKLFGYEHYGVTPDIMTLAK 248

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFPIGA +A  E  +  + G H ST+GGN LA   G  V+N I  +GFL++V    
Sbjct: 249 GLGGGFPIGAIVA-KEDKSVFSPGDHASTFGGNPLACAAGIAVMNEITKEGFLDSVAQKG 307

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL-LAAKFRDECLLTAPSSDNVVR 364
           +     L  +K ++ ++  EVRG+GL+IG +     A  +  K  ++ LL    S NV+R
Sbjct: 308 EYFRRKLKNLKEKY-SVIKEVRGKGLMIGCQMDMEEASDIVTKAMEKGLLINCISHNVLR 366

Query: 365 ILPPLTITAEEI 376
            +PPLT+T EEI
Sbjct: 367 FVPPLTVTEEEI 378


>gi|115377955|ref|ZP_01465139.1| acetylornithine aminotransferase [Stigmatella aurantiaca DW4/3-1]
 gi|310822319|ref|YP_003954677.1| acetylornithine transaminase [Stigmatella aurantiaca DW4/3-1]
 gi|115365060|gb|EAU64111.1| acetylornithine aminotransferase [Stigmatella aurantiaca DW4/3-1]
 gi|309395391|gb|ADO72850.1| Acetylornithine transaminase [Stigmatella aurantiaca DW4/3-1]
          Length = 421

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 159/379 (41%), Positives = 230/379 (60%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L   Y Q  I   +G+G+ ++  +G  +LD   GIA  +LGH HPE+VA +K+Q E LWH
Sbjct: 38  LLQNYKQQPIVLVRGRGSRVWDADGRQYLDLLGGIATCALGHCHPEIVAAVKAQVETLWH 97

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSN + S  Q   A  L   +   R FF NSGAE+ E  IK ARR     G   +F ++T
Sbjct: 98  VSNAFYSEPQIELAAQLTALSGLPRAFFCNSGAEANEALIKLARRVMKDRGTPERFEVLT 157

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FE +FHGRTLAT++A G+ +Y +GF P   GF  A + DL++++ ++   TAAIL+EP+Q
Sbjct: 158 FENSFHGRTLATVTATGQSKYQKGFEPLPAGFLHAPYGDLEAVRQKVGPQTAAILVEPVQ 217

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR  P  FL+ LR +CD+   LL+ DEVQTG GRTGKLFA++   ++PD +++AK 
Sbjct: 218 GEGGVRAAPTGFLKALRALCDEQGILLLVDEVQTGMGRTGKLFAFQHDGIQPDAISLAKA 277

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G G PIGA L +  V   +  G+HGST+GGN+++      V+ +I+    L  V    +
Sbjct: 278 LGNGLPIGAMLCSEAVGKSLPSGTHGSTFGGNLVSATAANVVVRLIREPQMLREVTEKGE 337

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L      ++ R P +  EVRG+GLLIG++     A +  + R++ LL   + D  +R  
Sbjct: 338 YLMARGRELQARLPTLIQEVRGRGLLIGIELNQEVAPIITRCREQGLLLNAAGDKTLRFA 397

Query: 367 PPLTITAEEIHEGLERIER 385
           P  T+T +E+ EGL  +ER
Sbjct: 398 PAFTVTRDELDEGLRILER 416


>gi|113968955|ref|YP_732748.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella sp. MR-4]
 gi|114048907|ref|YP_739457.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella sp. MR-7]
 gi|117919063|ref|YP_868255.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Shewanella sp. ANA-3]
 gi|113883639|gb|ABI37691.1| acetylornithine aminotransferase [Shewanella sp. MR-4]
 gi|113890349|gb|ABI44400.1| acetylornithine aminotransferase [Shewanella sp. MR-7]
 gi|117611395|gb|ABK46849.1| acetylornithine aminotransferase [Shewanella sp. ANA-3]
          Length = 405

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 167/383 (43%), Positives = 241/383 (62%), Gaps = 19/383 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ + G  F+DFA GIAVN LGH HP LV  LK+Q EKLWH+SN+  +      
Sbjct: 29  RGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEKLWHLSNVMTNEPALEL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L++STFA+RV+F NSGAE+ E A+K ARRY        K  I+ F+ AFHGRT  T+
Sbjct: 89  ATKLVNSTFAERVYFANSGAEANEAALKLARRYALEKFGVEKDEIIAFDKAFHGRTFFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+  Y +GFGPK +      + D+ +L+  +S+ T AI++EP+QGEGG+      FL
Sbjct: 149 SVGGQAAYSDGFGPKPQSITHLPYNDVAALEAAVSDKTCAIMLEPLQGEGGIIDADPAFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           + +R++ +  +AL+IFDEVQTG GRTG+L+AY   ++ PDI+T AK +GGGFPI A L T
Sbjct: 209 KAVRELANKHNALVIFDEVQTGVGRTGELYAYMGTDIVPDILTTAKALGGGFPIAAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HGSTYGGN LA  +G  VL+++ +   L  V +  ++L +GL  I  ++
Sbjct: 269 AEIAEHLKVGTHGSTYGGNPLACAIGNAVLDVVNTPEVLNGVKHREQLLRDGLNKINEKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RD-------ECLLTAPSSDNVVRILPP 368
            ++F E+RG+GLL+G       A+L  ++    RD       E L++  +  NVVR  P 
Sbjct: 329 -HVFSEIRGKGLLLG-------AVLNEQYQGRSRDFLVASVAEGLMSLMAGANVVRFAPS 380

Query: 369 LTITAEEIHEGLERIERTAIKLS 391
           L I   +I EGL R ER    ++
Sbjct: 381 LVIPEADIAEGLARFERAVASIA 403


>gi|256752198|ref|ZP_05493063.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|256748926|gb|EEU61965.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter ethanolicus CCSD1]
          Length = 394

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 238/372 (63%), Gaps = 3/372 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +  I   +GKG  ++ + G  +LDF +GIAVNSLGH HP LV  +K+QSEKL 
Sbjct: 9   YLMNTYSRYPITLVEGKGTKVWDDKGNVYLDFVAGIAVNSLGHCHPALVDAIKNQSEKLI 68

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY +  Q   A  +  ++F D+VFF NSGAE+ E AIK AR+Y  +   + +++++
Sbjct: 69  HCSNLYWNENQIQLAKIIAENSFGDKVFFANSGAEANEGAIKLARKYASLKYGSKRYKVI 128

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           + + +FHGRT   ++A G+ +Y +GFGP + GF    F D+ +LK  I ++  AI++E +
Sbjct: 129 SAKNSFHGRTFGALTATGQEKYHKGFGPLLSGFKYVPFNDIDALKETIDDEVCAIMLEVV 188

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+ +   E+++ +R+ICD+ D L I DEVQTG GRTGKLF YE   + PDIMT+AK
Sbjct: 189 QGEGGIHEATPEYIKAVREICDENDILFIIDEVQTGIGRTGKLFGYEHYGITPDIMTLAK 248

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFPIGA +A  E  +  + G H ST+GGN LA   G  V+  I  +GFL++V    
Sbjct: 249 GLGGGFPIGAIVA-KEDKSVFSPGDHASTFGGNPLACAAGIAVMKEITKEGFLDSVAQKG 307

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL-LAAKFRDECLLTAPSSDNVVR 364
           +     L ++K +  ++  EVRG+GL+IG +     A  +  K   + LL    S NV+R
Sbjct: 308 EYFKGKLESLKEKH-SVIKEVRGKGLMIGCEMDMEEASDIVTKAMGKGLLINCISHNVLR 366

Query: 365 ILPPLTITAEEI 376
            +PPLT+T EEI
Sbjct: 367 FVPPLTVTEEEI 378


>gi|15644529|ref|NP_229582.1| acetylornithine aminotransferase [Thermotoga maritima MSB8]
 gi|9296961|sp|Q9X2A5|ARGD_THEMA RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|150261213|pdb|2E54|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From
           Thermotoga Maritima
 gi|4982364|gb|AAD36848.1|AE001816_5 acetylornithine aminotransferase [Thermotoga maritima MSB8]
          Length = 385

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 241/383 (62%), Gaps = 5/383 (1%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +    F  GKG+W++ E G  +LDF SGIAVN LGHSHP LV  +K Q+EKL 
Sbjct: 2   YLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLI 61

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNL+ +  Q   A  L  +TF  +VFF N+G E+ E AIK AR+Y        K+RI+
Sbjct: 62  HCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKK-SEKKYRIL 120

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           +   +FHGRTL +++A G+ +Y + F P + GF+  +F +++ L+ ++S D  A+ +EPI
Sbjct: 121 SAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFLEPI 180

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGE G+    +EFL++ RK+CD+ DALL+FDEVQ G GRTGKLFAY+   V PD++T AK
Sbjct: 181 QGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAK 240

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGG PIGA +  NE A  +  G HG+T+GGN LA   G  V+  +  +GFLE V    
Sbjct: 241 GLGGGVPIGAVI-VNERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKG 299

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGL--KTVFSPALLAAKFRDECLLTAPSSDNVV 363
             L + L  +K  + ++  +VRG GL+IG+  +   S   +A K  +  LL  P+ +N +
Sbjct: 300 NYLMKKLQEMKEEY-DVVADVRGMGLMIGIQFREEVSNREVATKCFENKLLVVPAGNNTI 358

Query: 364 RILPPLTITAEEIHEGLERIERT 386
           R LPPLT+   EI   +E +++ 
Sbjct: 359 RFLPPLTVEYGEIDLAVETLKKV 381


>gi|51894017|ref|YP_076708.1| N-acetylornithine aminotransferase [Symbiobacterium thermophilum
           IAM 14863]
 gi|51857706|dbj|BAD41864.1| N-acetylornithine aminotransferase [Symbiobacterium thermophilum
           IAM 14863]
          Length = 407

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 164/379 (43%), Positives = 226/379 (59%)

Query: 8   FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV 67
             TY +  I   +G+G   +  +G  +LDF  GIAVN LGH+HP LV+ +  Q+ +L H 
Sbjct: 21  MKTYGRYPIALVRGEGVRCWDADGKEYLDFLGGIAVNVLGHAHPALVSAIADQAARLIHC 80

Query: 68  SNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTF 127
           SNLY S      A  L      DRVFF NSGAE+ E AIK AR+Y +  G   K RIV+ 
Sbjct: 81  SNLYYSEPMAELAELLTQHGGLDRVFFCNSGAEANEGAIKLARKYQWRKGLKAKNRIVSL 140

Query: 128 EGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQG 187
             +FHGRTLAT++A  K    EGFGP  EGFD  +  D+ +L+  +++ TAA+++EP+QG
Sbjct: 141 THSFHGRTLATVTATAKPAIQEGFGPLPEGFDYVEAGDVAALRAAVTDRTAAVIVEPVQG 200

Query: 188 EGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGM 247
           EGGVR +  EFL+  R ICD+  ALLIFDE+Q G GR G LFAY+   VKPDI+T+AKG+
Sbjct: 201 EGGVRPLAREFLEAARAICDERGALLIFDEIQCGMGRVGHLFAYQAFGVKPDILTLAKGL 260

Query: 248 GGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKI 307
           GGG PIGA  AT E A     G HG+T+GG+ LA       +  + S+        + + 
Sbjct: 261 GGGVPIGAVCATEEAARGFAPGDHGTTFGGSPLACAAALATVKTLLSEDLPARAAAMGEY 320

Query: 308 LFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILP 367
           L  GL  ++ + P +  EVRG GL++G++       +  K  +  LL   ++D VVR+LP
Sbjct: 321 LLAGLRRLQAKHPGLVKEVRGMGLMLGIELTRPARPVLEKCHELGLLVNVTADTVVRLLP 380

Query: 368 PLTITAEEIHEGLERIERT 386
           P  ITA +    LE +++ 
Sbjct: 381 PYIITAADCDRALEILDQA 399


>gi|15602209|ref|NP_245281.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pasteurella multocida subsp. multocida str. Pm70]
 gi|28376939|sp|Q9CNT1|ARGD_PASMU RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|12720585|gb|AAK02428.1| ArgD [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 398

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 234/371 (63%), Gaps = 5/371 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +GKG+ ++ + G  ++DF SGIAVNSLGH   E+V +LK QSEKLWH SN + S      
Sbjct: 26  RGKGSHVWDQQGKDYIDFTSGIAVNSLGHCADEIVDVLKQQSEKLWHSSNWFTSEPTLAL 85

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+  TFA+RV F NSGAE+ E A+K ARRY        K +I+ F+ +FHGRTL T+
Sbjct: 86  ATKLVEKTFAERVMFVNSGAEANEAALKLARRYAVDHFGYQKSKIIAFKQSFHGRTLFTV 145

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL +++  +  +T A+++EPIQGE G+    ++FL
Sbjct: 146 SVGGQAKYSDGFGPKPADIVHVPFNDLAAVQAVMDENTCAVIVEPIQGESGILPASQDFL 205

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q LR++CD  +ALLIFDEVQTG GRTG L+AY    V PDI+T AK +G GFPIGA L T
Sbjct: 206 QGLRELCDQHNALLIFDEVQTGVGRTGYLYAYMKYEVVPDILTSAKALGNGFPIGAMLTT 265

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           +E+A     G HG+T+GGN LA  + EKV++II +  FL+ +   ++   + L  I N+ 
Sbjct: 266 HEIAKSFAPGVHGTTFGGNPLACAVAEKVIDIISAPPFLQKIQRTSEKFMQKLQEI-NQQ 324

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNVVRILPPLTITAEE 375
             +F E+RG+GLLIG + +      A++F     D  L+   +  NV+R  P L I+ E 
Sbjct: 325 CGLFKEIRGEGLLIGAELIEQYHGRASEFVKKAADNGLMILVAGPNVLRFAPALNISEEA 384

Query: 376 IHEGLERIERT 386
           +  G ER+ +T
Sbjct: 385 LALGFERLAKT 395


>gi|254239248|ref|ZP_04932571.1| N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa C3719]
 gi|126171179|gb|EAZ56690.1| N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa C3719]
          Length = 406

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 232/378 (61%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAV SLGH+HP LV  L  Q++++WHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ +TFA+RVF  NSGAE+ E A K ARRY        K+ I+    +FHGRTL T+
Sbjct: 90  ARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYEIIAASNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPK EG     + DL++L   IS+ T A+++EPIQGEGGV    + +L
Sbjct: 150 NVGGQPKYSDGFGPKFEGITHVPYNDLEALTAAISDKTCAVVLEPIQGEGGVLPAQQAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALL+FDEVQ+G GR G+LFAY    V PDI++ AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  ++ G+HG+TYGGN LA  + E  L++I +   L+ V    +     L  I   +
Sbjct: 270 GEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKHERFKSRLQKIGQEY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLLIG            K RD       E ++   +S +VVR  P L I 
Sbjct: 330 -GIFDEIRGMGLLIGAALTDE---WKGKARDVLNAAEKEAVMVLQASPDVVRFAPSLVID 385

Query: 373 AEEIHEGLERIERTAIKL 390
             EI EGLER ER   KL
Sbjct: 386 DAEIDEGLERFERAVAKL 403


>gi|238792908|ref|ZP_04636538.1| Succinylornithine transaminase [Yersinia intermedia ATCC 29909]
 gi|238727762|gb|EEQ19286.1| Succinylornithine transaminase [Yersinia intermedia ATCC 29909]
          Length = 405

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/379 (43%), Positives = 230/379 (60%), Gaps = 13/379 (3%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DFA GIAV +LGH HP LVA L  Q E LWH SN++ +      
Sbjct: 29  KGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVAALHQQGETLWHTSNVFTNEPALRL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSG E+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 89  AQKLIAATFADRVFFANSGGEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 149 SVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSATPEFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD  +ALL+FDEVQ+G GR+GKLF Y    V PDI+T AK +GGGFPI A L T
Sbjct: 209 QGVRALCDQHNALLVFDEVQSGMGRSGKLFTYMHYGVTPDILTTAKALGGGFPISAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  +     +  + L  I N++
Sbjct: 269 EEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEVLNGIEQRHGLFVQALQDINNKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPA--------LLAAKFRDECLLTAPSSDNVVRILPPLTI 371
            ++F ++RG GLLIG +   +P         L+AA      +L A    NV+R+ P L +
Sbjct: 329 -HLFEDIRGMGLLIGAE--LTPQYHGRARELLMAAAANGLMVLNA--GPNVLRLAPSLVV 383

Query: 372 TAEEIHEGLERIERTAIKL 390
             ++I +G+ R+++    L
Sbjct: 384 ELDDIKQGMARLDKAVASL 402


>gi|145298162|ref|YP_001141003.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142850934|gb|ABO89255.1| acetylornithine aminotransferase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 405

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 168/393 (42%), Positives = 243/393 (61%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  + I   +G+G+ ++ + G  ++DFA GIAVN LGH HP+LV  LK+Q EK
Sbjct: 13  DEVMVPNYAPAKIIPVRGEGSRVWDQEGREYVDFAGGIAVNGLGHCHPKLVEALKTQGEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L+ +TFAD+V+F NSGAE+ E A+K ARRY       +K +
Sbjct: 73  LWHLSNVMTNEPALRLARKLVAATFADKVYFCNSGAEANEAALKLARRYAIEKFGEHKTQ 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T+S GG+  Y +GFGPK        + +L  L   IS++T A+++E
Sbjct: 133 IIAFHQGFHGRTFFTVSVGGQAAYSDGFGPKPADITHVTYNNLAELAAVISDNTCAVVME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+ +  +EF + +R++C   +ALL++DEVQ+G GRTG LFAY    V PDI+T 
Sbjct: 193 PLQGEGGIIRPTDEFAKGVRELCTKHNALLVYDEVQSGVGRTGDLFAYMGLGVTPDILTS 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L TNE+AA +  G+HGSTYGGN LA  + E V++++ +   L  +  
Sbjct: 253 AKALGGGFPIGAMLTTNEIAAHLKVGTHGSTYGGNPLACAVAEAVIDVVNTPEVLNGIKQ 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
             ++   GL AI  ++ + F EVRG+GLL+G       K      LLA+   D+ L+   
Sbjct: 313 REQLFRAGLDAINAKY-HCFSEVRGKGLLLGAVLNDDYKGRSRDFLLASI--DQGLMALV 369

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L I   +I EGL R E+   ++
Sbjct: 370 AGTNVVRFAPSLVIPEADIKEGLARFEKAVAQV 402


>gi|307544004|ref|YP_003896483.1| bifunctionalN-succinyldiaminopimelate-aminotransf erase/
           acetylornithine transaminase protein [Halomonas elongata
           DSM 2581]
 gi|307216028|emb|CBV41298.1| bifunctionalN-succinyldiaminopimelate-aminotransferase/
           acetylornithine transaminase protein [Halomonas elongata
           DSM 2581]
          Length = 404

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 234/381 (61%), Gaps = 17/381 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ L+ + G  ++DFA GIAVN+LGH HP LV  LK Q++KLWH++N+Y +      
Sbjct: 27  RGEGSRLWDQQGKEYIDFAGGIAVNALGHCHPVLVDALKDQADKLWHLANVYTNEPALKL 86

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+  TFAD+V+  NSG E+ E A+K ARR+ Y      K RIV+F  +FHGRT  T+
Sbjct: 87  ARSLVERTFADKVYLCNSGGEANEAALKLARRWAYDNHGERKNRIVSFGKSFHGRTFFTV 146

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGP   G    ++ DL+S++  I  DT A+++EP+QGEGG+     EFL
Sbjct: 147 SVGGQPKYSQGFGPVPGGIVHGEYNDLESVRELIDADTCAVMVEPMQGEGGIVPADPEFL 206

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           + LR++CD  DALLIFDEVQTG GRTG L+AY    V PDI+T AK +GGGFP+GA L T
Sbjct: 207 KGLRELCDANDALLIFDEVQTGVGRTGSLYAYMQYGVTPDILTTAKALGGGFPVGAMLTT 266

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           + VA  +  G+HGSTYGGN LA  +    +  I +   LE V     +  E L AI NR 
Sbjct: 267 DRVAPSLGLGTHGSTYGGNALASAVALAAVEHIDTPEVLEGVAKRHDLFREHLEAI-NRK 325

Query: 320 PNMFLEVRGQGLLIG----------LKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPL 369
             +F EVRG GLLIG           K +   A+      +E L+   +  NV+R+ P L
Sbjct: 326 HGVFKEVRGMGLLIGAEMHPEYEGRAKDILPLAI------EEGLMALVAGPNVLRMAPSL 379

Query: 370 TITAEEIHEGLERIERTAIKL 390
            I   +I EG+ R+ER   +L
Sbjct: 380 VIPEADIAEGMARLERAVARL 400


>gi|116048819|ref|YP_792381.1| bifunctional succinylornithine transaminase/acetylornithine
           aminotransferase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115584040|gb|ABJ10055.1| N-succinylglutamate 5-semialdehyde dehydrogenase [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 406

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 233/378 (61%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAV SLGH+HP LV  L  Q++++WHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+ +TFA+RVF  NSGAE+ E A K ARRY        K+ I+    +FHGRTL T+
Sbjct: 90  ARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYEIIAASNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPK EG     + DL++LK  IS+ T A+++EPIQGEGGV    + +L
Sbjct: 150 NVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVVLEPIQGEGGVLPAQQAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+C++ +ALL+FDEVQ+G GR G+LFAY    V PDI++ AK +GGGFPIGA L T
Sbjct: 210 EGARKLCNEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  ++ G+HG+TYGGN LA  + E  L++I +   L+ V    +     L  I   +
Sbjct: 270 GEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKHERFKSRLQKIGQEY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLLIG            K RD       E ++   +S +VVR  P L I 
Sbjct: 330 -GIFGEIRGMGLLIGAALTDE---WKGKARDVLNAAEKEAVMVLQASPDVVRFAPSLVID 385

Query: 373 AEEIHEGLERIERTAIKL 390
             EI EGLER ER   KL
Sbjct: 386 DAEIDEGLERFERAVAKL 403


>gi|123444132|ref|YP_001008102.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122091093|emb|CAL13976.1| acetylornithine aminotransferase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 405

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 167/382 (43%), Positives = 230/382 (60%), Gaps = 19/382 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DFA GIAV +LGH HP LVA L  Q E LWH SN++ +      
Sbjct: 29  KGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVAALHQQGEMLWHTSNVFTNEPALRL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSG E+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 89  AQKLIAATFADRVFFANSGGEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 149 SVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITAATPEFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD   ALL+FDEVQ+G GR+GKLF Y    V PDI+T AK +GGGFP+ A L T
Sbjct: 209 QGVRALCDQHKALLVFDEVQSGMGRSGKLFTYMHYGVTPDILTTAKALGGGFPVSAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  +     +  + L  I N++
Sbjct: 269 EEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEVLNGIEQRHGLFVQALQDINNKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF--RDECLLTAPSSD---------NVVRILPP 368
            ++F ++RG GLLIG       A LA ++  R    LTA +++         +V+R+ P 
Sbjct: 329 -HVFSDIRGMGLLIG-------AELAPQYHGRAREFLTAAAANGLMILNAGPDVLRLAPS 380

Query: 369 LTITAEEIHEGLERIERTAIKL 390
           L I  E+I +G+ R+E     L
Sbjct: 381 LVIEQEDIQQGMARLEHVIASL 402


>gi|152995140|ref|YP_001339975.1| acetylornithine and succinylornithine aminotransferase [Marinomonas
           sp. MWYL1]
 gi|150836064|gb|ABR70040.1| acetylornithine and succinylornithine aminotransferase [Marinomonas
           sp. MWYL1]
          Length = 411

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 163/386 (42%), Positives = 240/386 (62%), Gaps = 5/386 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +G+G+ ++ + G  ++DFA GIAV +LGHS+P LV +++ Q+ +
Sbjct: 15  DEVMVPNYAPSAVIPVRGEGSRIWDKEGKEYVDFAGGIAVTALGHSNPTLVNVMREQAGQ 74

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN   +      A  L   TFADRVFF NSGAE+ E A K ARRY +      K  
Sbjct: 75  LWHLSNTMTNEPALRLAKKLTEKTFADRVFFANSGAEANEAAFKLARRYAFDHFGPEKHE 134

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  +FHGRTL T+S GG+ +Y EGF P   G     + D++ LK  IS+ T A+++E
Sbjct: 135 IIAFYKSFHGRTLFTVSVGGQAKYKEGFEPTPGGIKHCDYNDIEQLKAIISDKTCAVVME 194

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGG+     EF +Q+R++CD  +ALL++DEVQ+G GRTG L+AYE   VKPD++T 
Sbjct: 195 PIQGEGGIIPADIEFAKQVRELCDQYNALLVYDEVQSGVGRTGTLYAYEQLGVKPDVLTT 254

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +G GFP+ A LAT + A  +  G+HGSTYGGN +A  + E V++I+ +   L  V  
Sbjct: 255 AKALGNGFPVSAMLATEKAARSLAFGTHGSTYGGNPMACAIAEAVIDIVDTPEVLGGVAK 314

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
              +  EGL AI  +  ++F ++RG GLLIG + + S A  A +      +E L    + 
Sbjct: 315 RHDLFVEGLKAINEKH-HVFKDIRGMGLLIGAEVIDSLAGKAGEIVKASAEEGLFVLVAG 373

Query: 360 DNVVRILPPLTITAEEIHEGLERIER 385
            NV+R+ P L IT ++I +GL R+++
Sbjct: 374 PNVLRLAPSLIITEQDIADGLARLDK 399


>gi|253987788|ref|YP_003039144.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211638666|emb|CAR67285.1| acetylornithine/succinyldiaminopimelate aminotransferase (ec
           2.6.1.11 (ec 2.6.1.17) (acoat) (succinyldiaminopimelate
           transferase (dapatase) [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779238|emb|CAQ82398.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Photorhabdus asymbiotica]
          Length = 403

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 172/395 (43%), Positives = 240/395 (60%), Gaps = 15/395 (3%)

Query: 9   NTYDQ------SDIRF--EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           NTYDQ      S ++F   KG+G+ ++ + G  ++DFA GIAV +LGH HP LV +LK Q
Sbjct: 10  NTYDQVMLPIYSPVQFIPVKGQGSRVWDQQGKEYIDFAGGIAVMALGHCHPALVDVLKQQ 69

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
            EKLWH+SN++ +    I A  LI  TFA+RVFF NSGAE+ E A K AR Y        
Sbjct: 70  GEKLWHISNIFTNEPALILAQKLIDVTFAERVFFANSGAEANEAAFKLARHYAITRHSPY 129

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           K +I+ F   FHGRT  T+S GG+ +Y +GFGPK        F DL ++K  I + T A+
Sbjct: 130 KTKIIAFHQGFHGRTFFTVSVGGQPKYADGFGPKPADIIHVPFNDLAAVKAVIDDHTCAV 189

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           ++EP+QGEGGV      F+  +R++CD    LL+FDEVQ+G GRTGKLF+Y   +V PDI
Sbjct: 190 VLEPVQGEGGVTPATSAFIHGVRELCDKHQVLLVFDEVQSGMGRTGKLFSYMHYDVVPDI 249

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           +T AK +G GFP+ A L T  +A+ M  G+HG+TYGGN LA  +     +II +   L+ 
Sbjct: 250 LTTAKALGNGFPVSAMLTTANIASVMVPGTHGTTYGGNPLACAVANVAFDIINTSEVLDG 309

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRDECLLT 355
           V     ++   L  I  R+ ++F E+RG+GLLIG  LK  +   S  +L     +  +L 
Sbjct: 310 VEKRHNLIVNFLNGINQRY-SVFGEIRGKGLLIGAELKGKYQGKSKDILQLAAENGLMLL 368

Query: 356 APSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  SD V+R  P L I+ EEI +G+ER+E+   +L
Sbjct: 369 SAGSD-VLRFTPSLIISEEEIAQGMERLEKAISQL 402


>gi|271502277|ref|YP_003335303.1| succinylornithine transaminase family [Dickeya dadantii Ech586]
 gi|270345832|gb|ACZ78597.1| succinylornithine transaminase family [Dickeya dadantii Ech586]
          Length = 413

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 165/378 (43%), Positives = 231/378 (61%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV +LGH HP LVA LK Q E LWH SN++ +      
Sbjct: 36  KGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVAALKEQGETLWHTSNVFTNEPALRL 95

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI++TFADRVFF NSGAE+ E A K AR Y        K +I++F  +FHGRTL T+
Sbjct: 96  ATKLINATFADRVFFANSGAEANEAAFKLARHYAITRHSPYKTKIISFYQSFHGRTLFTV 155

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+      FL
Sbjct: 156 SVGGQPKYADGFGPKPADIVHVPFNDLDAVKAVMDDHTCAVVLEPIQGEGGITPATPAFL 215

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           + +R++CD   ALL+FDEVQ G GR+GKLF+Y    + PDI+T AK +GGGFPI A L T
Sbjct: 216 KGVRELCDQYQALLVFDEVQCGMGRSGKLFSYMHYGITPDILTTAKALGGGFPISAMLTT 275

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  V++        L  I  ++
Sbjct: 276 EEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEVLSGVVDRHARFVSALERINAQY 335

Query: 320 PNMFLEVRGQGLLIGLKTVFSPA-------LLAAKFRDECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLL+G +    PA        LAA   D  L+   +  +V+R +P L IT
Sbjct: 336 -GIFDEIRGMGLLLGAQ--LKPAWHGRARDFLAAS-ADLGLMILVAGPDVIRFVPSLVIT 391

Query: 373 AEEIHEGLERIERTAIKL 390
            EEI +G+   E+   ++
Sbjct: 392 PEEIDQGMALFEKAVAQV 409


>gi|108805674|ref|YP_645611.1| acetylornithine aminotransferase [Rubrobacter xylanophilus DSM
           9941]
 gi|108766917|gb|ABG05799.1| acetylornithine aminotransferase [Rubrobacter xylanophilus DSM
           9941]
          Length = 397

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 170/374 (45%), Positives = 226/374 (60%), Gaps = 1/374 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY +  I   +G+G+WL  E G  +LDF +GIA NSLGH HP LV  +K Q+EKL H
Sbjct: 4   VMETYKRLGIAPVEGRGSWLIDERGDRYLDFIAGIATNSLGHGHPALVEAIKEQAEKLIH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+   QE  A  L  +T  DRVFF NSG ESVE AIK ARR+ +     +K  ++T
Sbjct: 64  CSNLYRVPLQEEVARMLTEATDFDRVFFCNSGTESVEAAIKLARRHAHNTSGPHKHEVLT 123

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           F G+FHGRT   ++A  +    EGF P + GF  A + DL++  ++I   TAA+L+EPIQ
Sbjct: 124 FTGSFHGRTYGGLTATAQPALHEGFAPMVGGFAYAPYGDLEAASSRIGPQTAAVLVEPIQ 183

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GE GV + PE FL+ LR++CD   ALLIFDEVQTG GRTG L+AY+   V PD +T AKG
Sbjct: 184 GESGVNEPPEGFLEGLRELCDRHGALLIFDEVQTGVGRTGHLYAYQGIGVVPDAITSAKG 243

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGG P+GA LA  E AA +  GSHGST+GGN LAM     VL +++   FLE V     
Sbjct: 244 LGGGVPVGAVLAKEEHAAALTPGSHGSTFGGNPLAMAAARAVLRVVREPSFLEEVRTKGA 303

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           IL  GL  +  R P   +  RG  L + L    +P +     +++ L+        +R+ 
Sbjct: 304 ILKNGLRELAARVPGAQVRGRGLLLGLELGPELAPEVFRRCLQEKVLVNL-VGGKTLRMA 362

Query: 367 PPLTITAEEIHEGL 380
           PPLT++  E+   L
Sbjct: 363 PPLTVSRTEVRYAL 376


>gi|293393350|ref|ZP_06637663.1| acetylornithine delta-aminotransferase [Serratia odorifera DSM
           4582]
 gi|291424170|gb|EFE97386.1| acetylornithine delta-aminotransferase [Serratia odorifera DSM
           4582]
          Length = 434

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 235/394 (59%), Gaps = 14/394 (3%)

Query: 1   MNKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAIL 57
           +++N F   +   Y  +     KGKG+ ++  NG  ++DF+ GIAV +LGH HP LVA L
Sbjct: 35  VSRNTFDQVILPVYAPAQFVPVKGKGSRVWDSNGKEYIDFSGGIAVTALGHCHPALVAAL 94

Query: 58  KSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG 117
           K Q E LWH SN++ +      A+ LI +TFADRVFF NSGAE+ E A K AR Y     
Sbjct: 95  KQQGETLWHTSNVFTNEPSLRLASKLIAATFADRVFFANSGAEANEAAFKLARHYAITRH 154

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  + + T
Sbjct: 155 SPYKTKIIAFYNAFHGRTLFTVSVGGQAKYSDGFGPKPADIVHVPFNDLAAVKAVMDDHT 214

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGG+  V  +FLQ +R++CD   ALL+FDEVQ+G GR+GKLFAY    V 
Sbjct: 215 CAVVMEPIQGEGGITPVDAQFLQGVRELCDRHQALLVFDEVQSGMGRSGKLFAYMHYGVT 274

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PDI+T AK +GGGFP+ A L T E+A+ M  G+HG+TYGGN LA  + E  L++I +   
Sbjct: 275 PDILTTAKALGGGFPVSAMLTTEEIASVMQVGTHGTTYGGNPLACAVAEAALDVINTAEV 334

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA-------LLAAKFRD 350
           L  V     +    L  I  ++  +F E+RG GLLIG +   +P        L AA  R 
Sbjct: 335 LSGVEQRHTLYVAALRDIGEKY-RIFSEIRGMGLLIGAELT-APYHGKARDFLTAAAARG 392

Query: 351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERIE 384
             +L A    NV+R  P L +  ++I +G+   E
Sbjct: 393 LMILNA--GPNVIRFAPSLVVEPQDIADGMALFE 424


>gi|331673293|ref|ZP_08374061.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli TA280]
 gi|331069491|gb|EGI40878.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli TA280]
          Length = 406

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMMPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ+LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQELRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|293610770|ref|ZP_06693070.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827114|gb|EFF85479.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 404

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 174/399 (43%), Positives = 240/399 (60%), Gaps = 15/399 (3%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ND++   +  ++    +G+G+ ++ +    ++DFA GIAVN+LGH+HP  V  L  Q+
Sbjct: 11  NFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYIDFAGGIAVNALGHAHPVAVNALTEQA 70

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            KLWHV N Y +      A  L  +TFAD+VFF NSGAE+ E A+K AR+    +G   K
Sbjct: 71  TKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFCNSGAEANEAALKLARKVGLDSGIAGK 130

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F  AFHGRTL T+SAGG+ +Y + F P   G +   F DL++ K  I+  T A++
Sbjct: 131 SGIVAFNNAFHGRTLFTVSAGGQPKYSQDFAPLPNGINHVAFNDLEAAKAVINEQTCAVI 190

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV     EFL+ LR +CD+  ALLIFDEVQTG GRTG L+AY  + V PD++
Sbjct: 191 VEPIQGEGGVIPADIEFLKGLRALCDEFGALLIFDEVQTGVGRTGALYAYMNSGVIPDVL 250

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T++ A   + G+HG+TYGGN LA  +   V   I +   LE V
Sbjct: 251 TTAKALGGGFPVGAMLTTDKFAPHFSVGTHGTTYGGNPLASAVAGAVFEFINTPEVLEGV 310

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------EC 352
            +  +   + L  +   +P +F E+RGQGLLIG  LK  +     A K +D       E 
Sbjct: 311 KHRHQYFLDALNKLNTEYP-IFEEIRGQGLLIGCVLKAEY-----AGKAKDITTWAGEEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           LL   +  NVVR  P L I  ++I EG+ R++R   KL+
Sbjct: 365 LLALIAGPNVVRFTPSLIIPEQDIDEGIARLKRALAKLA 403


>gi|94266460|ref|ZP_01290153.1| Acetylornithine and succinylornithine aminotransferase [delta
           proteobacterium MLMS-1]
 gi|93452938|gb|EAT03443.1| Acetylornithine and succinylornithine aminotransferase [delta
           proteobacterium MLMS-1]
          Length = 402

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 170/382 (44%), Positives = 227/382 (59%), Gaps = 10/382 (2%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY +  +   +G+G  LF+ +G  FLDF +GIAV +LGH HP +   ++ Q E+L H
Sbjct: 14  LMATYGRLPVTMVRGEGCRLFAADGREFLDFVAGIAVCNLGHCHPAITDAVREQVERLVH 73

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY S  Q   A  L+  +FADRVFF NSGAE+ E AIK ARR    AG   ++ I++
Sbjct: 74  VSNLYHSQPQIELAETLVAHSFADRVFFCNSGAEANEAAIKLARR----AGGEGRYEIIS 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
             G+FHGRTLAT++A G+ ++ EGF P   GF  A F DL  L+  I   T A+L EP+Q
Sbjct: 130 LTGSFHGRTLATVAATGQPRFHEGFEPLPAGFVHAPFGDLDGLRRLIGPQTCAVLCEPLQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR +  E+L  +R++CD+   LLIFDEVQ G GR G L A++   V PDI T+AKG
Sbjct: 190 GEGGVRPLAPEYLAAIRELCDERGLLLIFDEVQVGMGRAGSLLAHQQLGVVPDIATLAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G G PIGA LAT +VAA    GSH ST+GGN +       VL I+ + GF E V    +
Sbjct: 250 LGNGLPIGAMLATEQVAAAFTPGSHASTFGGNPVVCAAANAVLEIMLAPGFFEGVRQRGE 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLK-----TVFSPALLAAKFRDECLLTAPSSDN 361
            L   L  +  R+P   +EVRG GL+ GL          P ++   F    LL   + D 
Sbjct: 310 YLRGRLEELVARYPRQLVEVRGMGLIQGLVLQDDFRARGPEIIKELFAAGLLLNF-AGDT 368

Query: 362 VVRILPPLTITAEEIHEGLERI 383
            +R LPPL ++ +EI   +E +
Sbjct: 369 ALRFLPPLVVSHQEIDRAVELV 390


>gi|251787933|ref|YP_003002654.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Dickeya zeae Ech1591]
 gi|247536554|gb|ACT05175.1| succinylornithine transaminase family [Dickeya zeae Ech1591]
          Length = 413

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 166/378 (43%), Positives = 230/378 (60%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV +LGH HP LVA LK Q E LWH SN++ +      
Sbjct: 36  KGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVAALKEQGETLWHTSNVFTNEPALRL 95

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI++TFADRVFF NSGAE+ E A K AR Y        K +I++F  +FHGRTL T+
Sbjct: 96  ATKLINATFADRVFFANSGAEANEAAFKLARHYAITRHSPYKTKIISFYQSFHGRTLFTV 155

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+      FL
Sbjct: 156 SVGGQPKYADGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITPATPAFL 215

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
             +R++CD   ALL+FDEVQ G GR+GKLF+Y    + PDI+T AK +GGGFPI A L T
Sbjct: 216 NGVRELCDQYQALLVFDEVQCGMGRSGKLFSYMHYGITPDILTTAKALGGGFPISAMLTT 275

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  V++        L  I  ++
Sbjct: 276 EEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEVLSGVVDRHARFVSALERINAQY 335

Query: 320 PNMFLEVRGQGLLIGLKTVFSPA-------LLAAKFRDECLLTAPSSDNVVRILPPLTIT 372
            ++F EVRG GLL+G +    PA        LAA   D  L+   +  +V+R +P L IT
Sbjct: 336 -DIFDEVRGMGLLLGAQ--LKPAWHGRARDFLAAS-ADLGLMILVAGPDVIRFVPSLVIT 391

Query: 373 AEEIHEGLERIERTAIKL 390
            EEI +G+   E    ++
Sbjct: 392 PEEIDQGMALFENAVAQV 409


>gi|325123660|gb|ADY83183.1| succinylornithine transaminase [Acinetobacter calcoaceticus PHEA-2]
          Length = 404

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 174/399 (43%), Positives = 240/399 (60%), Gaps = 15/399 (3%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ND++   +  ++    +G+G+ ++ +    ++DFA GIAVN+LGH+HP  V  L  Q+
Sbjct: 11  NFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYIDFAGGIAVNALGHAHPVAVNALTEQA 70

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            KLWHV N Y +      A  L  +TFAD+VFF NSGAE+ E A+K AR+    +G   K
Sbjct: 71  TKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFCNSGAEANEAALKLARKVGLDSGIAGK 130

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F  AFHGRTL T+SAGG+ +Y + F P   G +   F DL++ K  I+  T A++
Sbjct: 131 SGIVAFNNAFHGRTLFTVSAGGQPKYSQDFAPLPNGINHVAFNDLEAAKAVINEQTCAVI 190

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV     EFL+ LR +CD+  ALLIFDEVQTG GRTG L+AY  + V PD++
Sbjct: 191 VEPIQGEGGVIPADIEFLKGLRALCDEFGALLIFDEVQTGVGRTGALYAYMNSGVIPDVL 250

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T++ A   + G+HG+TYGGN LA  +   V   I +   LE V
Sbjct: 251 TTAKALGGGFPVGAMLTTDKFAPHFSVGTHGTTYGGNPLASAVAGAVFEFINTPEVLEGV 310

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------EC 352
            +  +   + L  +   +P +F E+RGQGLLIG  LK  +     A K +D       E 
Sbjct: 311 KHRHQYFLDALNKLNAEYP-IFEEIRGQGLLIGCVLKAEY-----AGKAKDITTWAGEEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           LL   +  NVVR  P L I  ++I EG+ R++R   KL+
Sbjct: 365 LLALIAGPNVVRFTPSLIIPEQDIDEGIARLKRALAKLA 403


>gi|331663228|ref|ZP_08364138.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli TA143]
 gi|331059027|gb|EGI31004.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli TA143]
          Length = 406

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 232/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F+EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFIEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|307132874|ref|YP_003884890.1| Ornithine aminotransferase; Acetylornithine aminotransferase;
           N-succinyl-L,L-diaminopimelate aminotransferase [Dickeya
           dadantii 3937]
 gi|306530403|gb|ADN00334.1| Ornithine aminotransferase; Acetylornithine aminotransferase;
           N-succinyl-L,L-diaminopimelate aminotransferase [Dickeya
           dadantii 3937]
          Length = 407

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 165/368 (44%), Positives = 227/368 (61%), Gaps = 11/368 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV +LGH HP LVA LK Q E LWH SN++ +      
Sbjct: 30  KGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVAALKEQGETLWHTSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI++TFADRVFF NSGAE+ E A K AR Y        K +I++F  +FHGRTL T+
Sbjct: 90  ATKLINATFADRVFFANSGAEANEAAFKLARHYAITRHSPYKTKIISFYQSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL +LK  + + T A+++EPIQGEGG+      FL
Sbjct: 150 SVGGQPKYADGFGPKPADIVHVPFNDLDALKAVMDDHTCAVVLEPIQGEGGITPATPAFL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
             +R++CD   ALL+FDEVQ G GR+GKLF+Y    + PDI+T AK +GGGFPI A L T
Sbjct: 210 SGVRELCDQYQALLVFDEVQCGMGRSGKLFSYMHYGITPDILTTAKALGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  V++        L  I  ++
Sbjct: 270 EEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEVLSGVMDRHARFVSALERINAQY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPA-------LLAAKFRDECLLTAPSSDNVVRILPPLTIT 372
            ++F E+RG GLL+G +    PA        LAA   D  L+   +  +V+R +P L IT
Sbjct: 330 -DIFDEIRGMGLLLGAQ--LKPAWHGRARDFLAAS-ADLGLMILVAGPDVIRFVPSLVIT 385

Query: 373 AEEIHEGL 380
            EEI +G+
Sbjct: 386 PEEIDQGM 393


>gi|114778320|ref|ZP_01453179.1| acetylornithine aminotransferase [Mariprofundus ferrooxydans PV-1]
 gi|114551422|gb|EAU53978.1| acetylornithine aminotransferase [Mariprofundus ferrooxydans PV-1]
          Length = 386

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 168/377 (44%), Positives = 233/377 (61%), Gaps = 2/377 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           + NTY +  +   +G G  ++ + G  +LDF SGIAVN+LGH+HP+L A L +Q+  + H
Sbjct: 4   VMNTYARFPLTLVRGAGTRVWDDAGNAYLDFISGIAVNTLGHAHPKLTAALSAQAGTMLH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL+    Q+  A  L   +  +R FF NSGAE+ E AIK AR+Y Y  G T +  I+T
Sbjct: 64  CSNLFHIPTQQQLAARLTQLSGLERAFFCNSGAEANEAAIKLARKYFYDQGSTRR-TIIT 122

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
              +FHGRTL T++A G+ +   GF P   GF      D+++LK  ++  TAAIL+EP+Q
Sbjct: 123 AHQSFHGRTLLTLTATGQEKVKTGFDPLPPGFIHVPLNDIEALKQSVNEHTAAILLEPLQ 182

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGV     E+LQ +R++CD+   LL+ DEVQTG GR G +FA+E A + PDI+T+AKG
Sbjct: 183 GEGGVNLADAEYLQAVRRLCDEHGLLLLLDEVQTGIGRCGTMFAFEQAGIVPDILTLAKG 242

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +GGG PIGA LA   VA     GSHGST+GGN L+      VL+ I++   L+NV   + 
Sbjct: 243 LGGGVPIGAMLAREGVATSFGPGSHGSTFGGNPLSCTAALTVLDEIETTALLDNVRARSA 302

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            L  GLTA+  RFP M  ++RGQGLLIG       A L A  R   LL   +   V+R+L
Sbjct: 303 QLRSGLTAMAARFPGMG-DIRGQGLLIGASLNVDVAPLIAAARAAGLLVLAAGPQVLRLL 361

Query: 367 PPLTITAEEIHEGLERI 383
           PPL ++  E+ E L+++
Sbjct: 362 PPLNVSEAEVDEALQKL 378


>gi|225849741|ref|YP_002729975.1| acetylornithine aminotransferase (acoat) [Persephonella marina
           EX-H1]
 gi|225645161|gb|ACO03347.1| acetylornithine aminotransferase (acoat) [Persephonella marina
           EX-H1]
          Length = 388

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 164/385 (42%), Positives = 241/385 (62%), Gaps = 9/385 (2%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L   Y +  + F KG+G +L+   G  ++D  +GIAVN+LG++HP L   L +Q + + 
Sbjct: 11  YLIQNYARYPVSFVKGEGVYLYDTEGKRYIDMLAGIAVNTLGYNHPLLTEALCNQIKDVI 70

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           HVSNL+    Q   A  L+ ++  DRVFF NSGAE+ E AIK  R+Y Y  GK  KF IV
Sbjct: 71  HVSNLFYIQPQIDVAKILVENSCLDRVFFCNSGAEANETAIKLVRKYFYDKGKPEKFEIV 130

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           TF G FHGRT+ +++A  + +Y EGF P ++G   A+F +++SLK+ ++ +TAA++ E I
Sbjct: 131 TFTGGFHGRTIGSLTATAQPKYHEGFKPLLQGIRYAEFNNVESLKSAVNENTAAVMFEFI 190

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+  +  +FL ++ KI  + D L++ DEVQTG GRTGKLFAY+  ++ PDI+T+AK
Sbjct: 191 QGEGGINPIDRDFLSEIVKISREYDLLIVVDEVQTGIGRTGKLFAYQHYDICPDIVTLAK 250

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGG PIGA LA  EVA     G+HGST+GGN ++    + VLN +  DGFLE+V    
Sbjct: 251 GLGGGVPIGAVLAKEEVAEVFTPGTHGSTFGGNYISTTAAKVVLNEVLKDGFLEDVEKKG 310

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDNVV 363
           + L E L        N+ L+ RG+GL++G  L        +A K  DE L+   +  N +
Sbjct: 311 EFLIEELR-------NIGLKPRGKGLMVGCPLPEDIKAGDIAKKALDEGLIIGTAGGNTL 363

Query: 364 RILPPLTITAEEIHEGLERIERTAI 388
           R +PPL I  E+I E +  +++  +
Sbjct: 364 RFVPPLIIQKEQIQEAVNILKKVVV 388


>gi|149910068|ref|ZP_01898716.1| acetylornithine transaminase (NAcOATase and DapATase),PLP-dependent
           [Moritella sp. PE36]
 gi|149806936|gb|EDM66897.1| acetylornithine transaminase (NAcOATase and DapATase),PLP-dependent
           [Moritella sp. PE36]
          Length = 406

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 167/386 (43%), Positives = 242/386 (62%), Gaps = 5/386 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y  + +   +GKG+ ++ +    ++DFA+GIAV+ LGH HP LVA L+ QS++
Sbjct: 14  DDVMVPNYAPAAMIPVRGKGSRVWDQADNEYIDFAAGIAVSCLGHCHPPLVAALQQQSQQ 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWHVSNL  +      AN L  +TFAD+VFF NSGAE+ E A+K ARRY        K +
Sbjct: 74  LWHVSNLLTNEPALRLANKLTKATFADKVFFANSGAEANEAALKLARRYALDKFGDGKDQ 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK    D   F DL +++  +S+ T A+++E
Sbjct: 134 IIAFNKGFHGRTFFTVTVGGQSSYSDGFGPKPGAIDHVDFNDLAAVEALMSDKTCAVMME 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+    ++FL  +R +CD  +ALLIFDEVQTG GRTG  +AY+  ++KPDI+T 
Sbjct: 194 PLQGEGGINAANQQFLIGVRALCDKYNALLIFDEVQTGVGRTGTFYAYQHTDIKPDILTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+G GFPI A L T  +A  ++ G+HGSTYGGN LA  + E V++ I +D FL  V  
Sbjct: 254 AKGLGAGFPIAAMLTTGNIAKSLSVGTHGSTYGGNPLACSVAEVVVDTINNDDFLAQVKV 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAA--KFRDECLLTAPSS 359
            + I  E LT I N++  +F ++RG GLL+G  LK  +    +A   +     LL   + 
Sbjct: 314 KSAIFQEALTQINNQYA-IFSDIRGDGLLLGAELKEQYQGQAIAIMNQAAQHGLLILVAG 372

Query: 360 DNVVRILPPLTITAEEIHEGLERIER 385
            NV+R  P L I  ++IH G++++ +
Sbjct: 373 ANVLRFTPALNIPEDDIHAGMKKLSQ 398


>gi|238751111|ref|ZP_04612606.1| Succinylornithine transaminase [Yersinia rohdei ATCC 43380]
 gi|238710589|gb|EEQ02812.1| Succinylornithine transaminase [Yersinia rohdei ATCC 43380]
          Length = 408

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 167/398 (41%), Positives = 239/398 (60%), Gaps = 22/398 (5%)

Query: 1   MNKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAIL 57
           +N++ F   +   Y  +     KGKG+ ++ + G  ++DFA GIAV +LGH HP LVA L
Sbjct: 11  VNRSTFDQVILPVYAPAQFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVAAL 70

Query: 58  KSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG 117
             Q E LWH SN++ +      A  LI +TFADRVFF NSGAE+ E A K AR Y     
Sbjct: 71  HQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFANSGAEANEAAFKLARHYAIERH 130

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  + + T
Sbjct: 131 SPYKTKIIAFHHAFHGRTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHT 190

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGG+     EFLQ +R++C    ALL+FDEVQ+G GR+GKLF Y    V 
Sbjct: 191 CAVVLEPIQGEGGITAATPEFLQGVRELCSQHKALLVFDEVQSGMGRSGKLFTYMHYGVT 250

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PDI+T AK +GGGFPI A L T E+A+ M  G+HG+TYGGN LA  + E  L++I +   
Sbjct: 251 PDILTTAKALGGGFPISAMLTTEEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEV 310

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC--LLT 355
           L+ +     +  + L AI N++ ++F ++RG GLLIG       A L+ ++R      LT
Sbjct: 311 LDGIEQRHGLFVQALQAINNKY-SVFSDIRGMGLLIG-------AELSPQYRGRAREFLT 362

Query: 356 APSSD---------NVVRILPPLTITAEEIHEGLERIE 384
             +++         +V+R+ P L +  E+I +G+ R++
Sbjct: 363 VAAANGVMILNAGPDVLRLAPSLVVELEDIKQGMARLD 400


>gi|238797266|ref|ZP_04640767.1| Succinylornithine transaminase [Yersinia mollaretii ATCC 43969]
 gi|238718903|gb|EEQ10718.1| Succinylornithine transaminase [Yersinia mollaretii ATCC 43969]
          Length = 410

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 169/404 (41%), Positives = 236/404 (58%), Gaps = 22/404 (5%)

Query: 1   MNKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAIL 57
           +N++ F   +   Y  +     KGKG+ ++ + G  ++DFA GIAV +LGH HP LVA L
Sbjct: 11  VNRSTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVAAL 70

Query: 58  KSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG 117
             Q E LWH SN++ +      A  LI +TFADRVFF NSG E+ E A K AR Y     
Sbjct: 71  HQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFANSGGEANEAAFKLARHYAIERH 130

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  + + T
Sbjct: 131 SPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHT 190

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGG+     EFLQ +R +C    ALL+FDEVQ+G GR+GKLF Y    V 
Sbjct: 191 CAVVLEPIQGEGGITAATPEFLQGVRDLCTQHKALLVFDEVQSGMGRSGKLFTYMHYGVT 250

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PDI+T AK +GGGFPI A L T E+A+ M+ G+HG+TYGGN LA  + E  L++I +   
Sbjct: 251 PDILTTAKALGGGFPISAMLTTEEIASVMSVGTHGTTYGGNPLACAVAEAALDVINTPEV 310

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC--LLT 355
           LE +     +  + L  I  ++  +F ++RG GLLIG       A LA ++R      LT
Sbjct: 311 LEGIEQRHGLFVQALQVINRKY-AVFSDIRGMGLLIG-------AELAPQYRGRAREFLT 362

Query: 356 APSS---------DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           A ++          +V+R+ P L +  E+I +G+ R+E     L
Sbjct: 363 AAAAHGLMILNAGPDVLRLAPSLVVELEDIQQGMARLENAIASL 406


>gi|238783138|ref|ZP_04627164.1| Succinylornithine transaminase [Yersinia bercovieri ATCC 43970]
 gi|238715934|gb|EEQ07920.1| Succinylornithine transaminase [Yersinia bercovieri ATCC 43970]
          Length = 406

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 169/404 (41%), Positives = 238/404 (58%), Gaps = 22/404 (5%)

Query: 1   MNKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAIL 57
           +N++ F   +   Y  +     KGKG+ ++ + G  ++DFA GIAV +LGH HP LVA L
Sbjct: 7   VNRSTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVAAL 66

Query: 58  KSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAG 117
             Q E LWH SN++ +      A  LI +TFADRVFF NSG E+ E A K AR Y     
Sbjct: 67  HQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFANSGGEANEAAFKLARHYAIERH 126

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  + + T
Sbjct: 127 SPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHT 186

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGG+     EFLQ +R++C    ALL+FDEVQ+G GR+GKLF Y    V 
Sbjct: 187 CAVVLEPIQGEGGITAATPEFLQGVRELCTQHKALLVFDEVQSGMGRSGKLFTYMHYGVT 246

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PDI+T AK +GGGFPI A L T E+A+ M  G+HG+TYGGN LA  + E  L++I +   
Sbjct: 247 PDILTTAKALGGGFPISAMLTTEEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEV 306

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC--LLT 355
           LE +     +  + L  I  ++ ++F ++RG GLLIG       A LA ++R      LT
Sbjct: 307 LEGIEQRHGLFVQALEVINRKY-SVFSDIRGMGLLIG-------AELAPQYRGRAREFLT 358

Query: 356 APSSD---------NVVRILPPLTITAEEIHEGLERIERTAIKL 390
           A +++         +V+R+ P L I  ++I +G+ R+E     L
Sbjct: 359 AAAANGLMILNAGPDVLRLAPSLVIELDDIQQGVARLESAIASL 402


>gi|197286650|ref|YP_002152522.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Proteus mirabilis HI4320]
 gi|227355159|ref|ZP_03839570.1| succinyldiaminopimelate transaminase [Proteus mirabilis ATCC 29906]
 gi|194684137|emb|CAR45561.1| acetylornithine/succinyldiaminopimelate aminotransferase [Proteus
           mirabilis HI4320]
 gi|227164946|gb|EEI49793.1| succinyldiaminopimelate transaminase [Proteus mirabilis ATCC 29906]
          Length = 405

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 167/389 (42%), Positives = 234/389 (60%), Gaps = 11/389 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +  +   Y  +D    KG+G+ ++ + G  ++DFA GIAV +LGH+HP L   L+ QSEK
Sbjct: 12  DQVMLPIYSPADFIPVKGQGSRVWDQQGKSYIDFAGGIAVLALGHAHPLLNKALQEQSEK 71

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWHVSN++ +      A  LI  TFA+RVFF NSGAE+ E A+K AR Y        K +
Sbjct: 72  LWHVSNVFTNEPALCLAQKLIQHTFAERVFFANSGAEANEAALKLARHYAITRHNPYKTK 131

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRT  T+S GG+ +Y +GFGPK        F  L ++K  I + T A+++E
Sbjct: 132 IIAFHHAFHGRTFFTVSVGGQPKYADGFGPKPADIIHVPFNSLDAVKAVIDSHTCAVILE 191

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV     EF+  LR +CD   ALLI DEVQTG GRTGKLFAY   +++PDI+T 
Sbjct: 192 PIQGEGGVTPATAEFMHGLRTLCDKHQALLILDEVQTGMGRTGKLFAYMHYDIQPDIITS 251

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +G GFP+ A L T ++A+ M  G+HG+TYGGN LA  +G    ++I +   LE V  
Sbjct: 252 AKALGSGFPLSAMLTTEDIASVMGVGTHGTTYGGNPLACAVGNAAFDLINTQAVLEGVSE 311

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTA 356
             + + + L AI   +  +F ++RGQGLLIG +   +P L A K ++         L+  
Sbjct: 312 RHRWIVDELQAINQTYA-VFSQIRGQGLLIGAQ--LAP-LYAGKAKELLALASKHGLMIL 367

Query: 357 PSSDNVVRILPPLTITAEEIHEGLERIER 385
            +  +V+R  P L IT EE+ EG+  + +
Sbjct: 368 NAGADVIRFTPSLIITLEELQEGMNALRK 396


>gi|259910027|ref|YP_002650383.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Erwinia pyrifoliae Ep1/96]
 gi|224965649|emb|CAX57181.1| Acetylornithine aminotransferase [Erwinia pyrifoliae Ep1/96]
 gi|283480125|emb|CAY76041.1| bifunctional acetylornithine delta-aminotransferase /
           N-succinyldiaminopimelate aminotransferase [Erwinia
           pyrifoliae DSM 12163]
          Length = 405

 Score =  315 bits (807), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 169/388 (43%), Positives = 235/388 (60%), Gaps = 15/388 (3%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +  +   Y  +     KG+G+ ++ + G  ++DF+ GIAV +LGH HP LV  LK+Q E 
Sbjct: 14  DQVILPVYAPAQFVPVKGQGSRIWDQQGKEYIDFSGGIAVTALGHCHPALVEALKTQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +      A+ LI +TFA+RVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVFTNEPALRLASKLIDATFAERVFFANSGAEANEAAFKLARYYASQRHSPYKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLAAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV    EEF+Q LR++CD+  ALL+ DEVQ+G GR+GKLFA E   V PDI+T 
Sbjct: 194 PIQGEGGVVPATEEFMQGLRQLCDEHHALLVLDEVQSGMGRSGKLFACEHYGVSPDILTT 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L TN++A+ M  G HG+TYGGN LA  + E  L+II +   L+ V  
Sbjct: 254 AKALGGGFPVSAMLTTNDIASVMAPGVHGTTYGGNPLACAVAEAALDIINTPEVLDGVAA 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------ECLL 354
             ++  + L A+ N   ++F ++RG+GLLIG  LK  +     A K R+       E ++
Sbjct: 314 RRQLFVDALQAL-NAKRDLFSDIRGKGLLIGAALKPQY-----ADKAREILNVAAAEGVM 367

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLER 382
              +   V+R  P L I   +I EG+ R
Sbjct: 368 VLVAGSGVMRFAPSLVIEPADIAEGMVR 395


>gi|150401070|ref|YP_001324836.1| acetylornithine aminotransferase [Methanococcus aeolicus Nankai-3]
 gi|150013773|gb|ABR56224.1| acetylornithine and succinylornithine aminotransferase
           [Methanococcus aeolicus Nankai-3]
          Length = 403

 Score =  315 bits (807), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 235/381 (61%), Gaps = 12/381 (3%)

Query: 1   MNKND--FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILK 58
           M KND  ++  TY +  I   KG G  +   NG  + DF +GI VN++GH HPE+V  L+
Sbjct: 16  MIKNDKKYIIGTYGRYGIVPVKGYGMIVEDINGKKYKDFLAGIGVNNVGHCHPEVVKTLQ 75

Query: 59  SQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGK 118
            Q+E L H SNLY    Q      L+  T  D+ FF+NSGAE+ E AIK AR++    GK
Sbjct: 76  KQAELLIHTSNLYHIIPQVQLGKKLVELTGMDKAFFSNSGAEANEAAIKLARKH----GK 131

Query: 119 TNKF---RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN 175
            N      I+T E +FHGRTL TI+A  K  Y EG+ P  +GF   KF D+++LK  ISN
Sbjct: 132 NNNIGEGEIITMEHSFHGRTLTTITATAKPAYQEGYEPLPKGFKYVKFNDIEALKEGISN 191

Query: 176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN 235
            T AI++EPIQGEGG+    +E+L+ +R IC+D + +LIFDEVQ G GRTGK+FAYE  N
Sbjct: 192 KTTAIMLEPIQGEGGIHIADKEYLKGVRDICNDKNIVLIFDEVQCGMGRTGKMFAYEHYN 251

Query: 236 VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD 295
           +KPDI+T+AK +GGG PIGA +AT EVA     GSHG+T+GGN LA       + +++  
Sbjct: 252 IKPDILTLAKALGGGAPIGATIATEEVATAFTPGSHGTTFGGNPLACSASYASVRVLE-- 309

Query: 296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLT 355
           G LEN  N+ +     L  +KN++     EVRG GL+IG++  F+   +  K  ++  L 
Sbjct: 310 GLLENTQNMGEYFITELNKLKNKY-GFIKEVRGIGLMIGIELSFNGGDIVKKMLEKGYLI 368

Query: 356 APSSDNVVRILPPLTITAEEI 376
             +SD V+R LPPL +   +I
Sbjct: 369 NCTSDVVLRFLPPLIVEKTDI 389


>gi|260779525|ref|ZP_05888415.1| acetylornithine aminotransferase/N-succinyl-L,L-diaminopimelate
           aminotransferase/succinylornithine transaminase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260604334|gb|EEX30638.1| acetylornithine aminotransferase/N-succinyl-L,L-diaminopimelate
           aminotransferase/succinylornithine transaminase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 404

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 166/393 (42%), Positives = 241/393 (61%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y+  ++   KG+GA ++ + G  ++DFA GIAV+ LGH HP +V  L  Q +K
Sbjct: 13  DEVMVPCYNPMEMVPVKGEGARVWDQEGKEYIDFAGGIAVSCLGHCHPAMVNALTEQGQK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   +FA++VFF NSGAE+ E A+K ARRY        K  
Sbjct: 73  LWHLSNVMTNEPALRLAKKLTDVSFAEKVFFANSGAEANEAALKLARRYAADQFGPEKSE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+  FHGRT  T++ GG+  Y +GFGPK        + D+++L+  IS+ T AI++E
Sbjct: 133 IIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDVEALRAHISDRTCAIMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+    +EF+Q +R++CD  +ALLIFDEVQTG GRTG  +AY+   V PDI++ 
Sbjct: 193 PLQGEGGIISPTDEFVQTVRELCDKHNALLIFDEVQTGNGRTGHFYAYQGLGVTPDILST 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T E++  +  G+HGSTYGGN LA  + E V++I+ +   L  V  
Sbjct: 253 AKSLGGGFPIGAMLTTTELSKHLKVGTHGSTYGGNPLACAVAEAVVDIVSAPETLAGVAE 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
              +  +GL  + +++ NMF EVRG+GLL+G       +      L+AA    E L+   
Sbjct: 313 REALFRDGLAKLNDKY-NMFAEVRGKGLLLGAALNDEWQGRARDVLVAAG--KEGLMVLV 369

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L IT EEI EGL ++++    L
Sbjct: 370 AGANVVRFTPSLVITKEEIAEGLAKLDKALATL 402


>gi|218548683|ref|YP_002382474.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia fergusonii ATCC 35469]
 gi|254807559|sp|B7LQ44|ASTC_ESCF3 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|218356224|emb|CAQ88841.1| succinylornithine transaminase, PLP-dependent [Escherichia
           fergusonii ATCC 35469]
          Length = 406

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 172/385 (44%), Positives = 232/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMLPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + DL S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDLNSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLIGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|109896494|ref|YP_659749.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas atlantica T6c]
 gi|109698775|gb|ABG38695.1| acetylornithine aminotransferase apoenzyme [Pseudoalteromonas
           atlantica T6c]
          Length = 401

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 166/387 (42%), Positives = 237/387 (61%), Gaps = 9/387 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y  S I   +GKG+ ++ +N   F+DFA GIAVN LGH HP LV  L  Q +K
Sbjct: 9   DDVMVPNYAPSAIIPVRGKGSRVWDQNDKEFIDFAGGIAVNCLGHCHPALVQALTEQGQK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   TFA++V+F NSGAE+ E A+K ARR+        K +
Sbjct: 69  LWHLSNVMTNEPALRLAQRLTQLTFAEKVYFANSGAEANEAALKLARRWALDVYGAQKSQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++F  +FHGRT  T++ GG+  Y +GFGPK      A + DL  L+  IS+ T A+++E
Sbjct: 129 IISFNKSFHGRTFFTVTVGGQTAYSDGFGPKPGDIAHADYNDLAGLEALISDKTCAVMLE 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     +F++ +R +CD  +AL+IFDEVQTG GRTG ++AY+   V PDI+T 
Sbjct: 189 PLQGEGGIISPDADFIKGVRALCDKHNALMIFDEVQTGVGRTGAMYAYQNLGVTPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T E+A  +  G+HGSTYGGN LA  + E VL+++  D  L+ V  
Sbjct: 249 AKALGGGFPIGAMLTTTEIAKHLKIGTHGSTYGGNPLACAVAEAVLDVVSHDDVLQGVAK 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
              +  EGL  I +++ ++F E+RG+GLL+G       K      L+AA   +  L+   
Sbjct: 309 RETLFREGLERINDKY-HVFAEIRGKGLLLGAALNEKYKGRAKAFLVAAA--EHGLMCLI 365

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIE 384
           +  +VVR  P L I  ++I  GL+R E
Sbjct: 366 AGADVVRFTPSLVIPEQDIELGLQRFE 392


>gi|310765628|gb|ADP10578.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Erwinia sp. Ejp617]
          Length = 405

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 172/393 (43%), Positives = 237/393 (60%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +  +   Y  +     KG+G+ ++ + G  ++DF+ GIAV +LGH HP LV  LK+Q E 
Sbjct: 14  DQVILPVYAPAQFVPVKGQGSRIWDQQGKEYIDFSGGIAVTALGHCHPALVEALKTQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +      A+ LI +TFA+RVFF NSGAE+ E A K AR Y        K +
Sbjct: 74  LWHTSNVFTNEPALRLASKLIDATFAERVFFANSGAEANEAAFKLARYYASQRHSPYKSK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T AI++E
Sbjct: 134 IIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLAAVKAVIDDHTCAIVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV    EEF+Q LR++CD+  ALL+ DEVQ+G GR+GKLFA E   V PDI+T 
Sbjct: 194 PIQGEGGVVPATEEFMQGLRQLCDEHHALLVLDEVQSGMGRSGKLFACEHYGVSPDILTT 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L TN++A+ M  G HG+TYGGN LA  + E  L+II +   L+ V  
Sbjct: 254 AKALGGGFPVSAMLTTNDIASVMAPGVHGTTYGGNPLACAVAEAALDIINTPEVLDGVAA 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPA----LLAAKFRDECLLTAP 357
             ++  + L A+ N   ++F ++RG+GLLIG  LK  ++      L AA      +L A 
Sbjct: 314 RRQLFVDALQAL-NAKRDLFSDIRGKGLLIGAALKPQYADKAREILNAAAAEGVMVLVAG 372

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           S   V+R  P L I   +I EG+ R      K+
Sbjct: 373 S--GVMRFAPSLVIEPADIAEGMVRFAAAVDKV 403


>gi|323978070|gb|EGB73156.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli TW10509]
          Length = 406

 Score =  315 bits (806), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRFGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ+LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQELRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLIGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|260772077|ref|ZP_05880994.1| acetylornithine aminotransferase/N-succinyl-L,L-diaminopimelate
           aminotransferase/succinylornithine transaminase [Vibrio
           metschnikovii CIP 69.14]
 gi|260612944|gb|EEX38146.1| acetylornithine aminotransferase/N-succinyl-L,L-diaminopimelate
           aminotransferase/succinylornithine transaminase [Vibrio
           metschnikovii CIP 69.14]
          Length = 403

 Score =  315 bits (806), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 169/377 (44%), Positives = 234/377 (62%), Gaps = 9/377 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KG+G+ ++ + G  ++DFA GIAV+ LGH HP +V  L  Q+ KLWH+SN+  +      
Sbjct: 29  KGQGSRVWDQQGREYIDFAGGIAVSCLGHCHPAMVNALTEQANKLWHLSNVMTNEPALQL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           AN LI  +FAD+VFF NSGAE+ E A+K ARRY        K  I+ F+  FHGRT  T+
Sbjct: 89  ANKLIELSFADKVFFANSGAEANEAALKLARRYAADVYGPEKTEIIAFKQGFHGRTFFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+  Y +GFGPK        + D+ +L+  +S+ T AI++EP+QGEGG+     EF+
Sbjct: 149 TVGGQAAYSDGFGPKPGDITHLPYNDIDALQAHMSDRTCAIMMEPLQGEGGIISPTPEFV 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R++CD  +ALLIFDEVQTG GRTG  +AY+   V PDI++ AK +GGGFPIGA L T
Sbjct: 209 QAVRELCDKHNALLIFDEVQTGNGRTGHFYAYQGLGVTPDILSTAKSLGGGFPIGAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           N++A  M  G+HGSTYGGN LA  +G  V++I+     L  V        EGLT I +++
Sbjct: 269 NKLAEHMKVGTHGSTYGGNPLACAVGLAVVDIVSQPETLAGVKQREAWFREGLTKINDKY 328

Query: 320 PNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITA 373
            ++F E+RGQGLL+G       +      LLAA      LL A    NV+R+ P L IT 
Sbjct: 329 -HVFSEIRGQGLLLGAALNEQWQGRSRDILLAAGEHGLMLLVA--GPNVIRMTPSLLITQ 385

Query: 374 EEIHEGLERIERTAIKL 390
           +EI +GL ++E+    L
Sbjct: 386 QEIEQGLAKLEQAIATL 402


>gi|293410064|ref|ZP_06653640.1| argD [Escherichia coli B354]
 gi|291470532|gb|EFF13016.1| argD [Escherichia coli B354]
          Length = 406

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 232/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|224825594|ref|ZP_03698699.1| succinylornithine transaminase family [Lutiella nitroferrum 2002]
 gi|224602515|gb|EEG08693.1| succinylornithine transaminase family [Lutiella nitroferrum 2002]
          Length = 413

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 169/371 (45%), Positives = 237/371 (63%), Gaps = 11/371 (2%)

Query: 21  GKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFA 80
           GKG+ L+ + G  ++DFASGIAV SLGH HPEL A+L  Q ++LWH+SN + +      A
Sbjct: 28  GKGSRLWDQGGNEYIDFASGIAVTSLGHLHPELTAVLHEQVDRLWHLSNTFTNEPALRLA 87

Query: 81  NHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATIS 140
             L  STFA++VFF+NSGAE+ E A+K ARRY +     +K  IV+ + AFHGRTL T+S
Sbjct: 88  RRLTESTFAEKVFFSNSGAEANEAALKLARRYAFDHFGGDKTGIVSCKQAFHGRTLFTVS 147

Query: 141 AGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQ 200
            GG+ +Y EGF P     +  +F +L + +  I++ T A+++EP+QGEGGV     E+L+
Sbjct: 148 VGGQPKYTEGFAPLPGNLNHIEFNNLAAAEAAINDGTCAVIVEPVQGEGGVLPATPEYLK 207

Query: 201 QLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATN 260
           +LR++CD  +ALLIFDEVQ G GR+G LFAY    V PDI+T AK +G G PIGA L T+
Sbjct: 208 KLRELCDKHNALLIFDEVQIGVGRSGSLFAYMEYGVTPDILTSAKALGNGMPIGAMLTTS 267

Query: 261 EVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFP 320
           ++AA    G+HGSTYGGN LA  + +KV+ II +   L+ V    ++L +GL  I  +  
Sbjct: 268 KIAASFVVGTHGSTYGGNPLACTVADKVIEIINTPEVLDGVKRRHQLLVDGLKRIGAKH- 326

Query: 321 NMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTITA 373
           + F +VRG GLL+G + V     LA K +D         L+   +  N+VRI P L I  
Sbjct: 327 HAFKDVRGMGLLVGAELVDE---LAGKAKDFLTAAARHGLVLLVAGPNIVRIAPSLVIPE 383

Query: 374 EEIHEGLERIE 384
            ++ EGL+R+E
Sbjct: 384 ADLEEGLKRLE 394


>gi|77362337|ref|YP_341911.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76877248|emb|CAI89465.1| putative acetylornithine transaminase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 401

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 162/386 (41%), Positives = 235/386 (60%), Gaps = 5/386 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ND +   Y+ S +   +G G+ ++ ++   F+DFA GIAVN LGH HP LV  LK Q EK
Sbjct: 9   NDVMVPNYNPSAVIPVRGVGSRVWDQDNNEFIDFAGGIAVNCLGHCHPALVNALKEQGEK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  ++ +TFA++V+F NSGAE+ E A+K ARR+        K +
Sbjct: 69  IWHLSNVMTNEPALRLAKKMVDATFAEKVYFANSGAEANEAALKLARRFALDVHGAEKTQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK        F D+ + +  IS+ T A+++E
Sbjct: 129 IIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPADIVHCDFNDISAFEALISDKTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+    ++F  ++R++C   +ALLIFDEVQTG GRTG L+AY+  NV PDI+T 
Sbjct: 189 PLQGEGGIISPTDDFAHKVRELCTKHNALLIFDEVQTGVGRTGDLYAYQGLNVVPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA + T  +AA +  G+HGSTYGGN LA  + E   + + +   L  V  
Sbjct: 249 AKALGGGFPIGAMITTTAIAAHLKVGTHGSTYGGNPLACAVAEAAFDTVNTPKVLSGVKE 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
             ++  +GL AI  ++ N+F E+RG+GLLIG       A  A  F     +  L+   + 
Sbjct: 309 REQLFRDGLNAINEKY-NVFSEIRGKGLLIGAALNDKFAGRARDFLIASANNGLMNLVAG 367

Query: 360 DNVVRILPPLTITAEEIHEGLERIER 385
            +V+R  P L I  E+I EGLER ++
Sbjct: 368 ADVIRFTPSLVIPLEDIKEGLERFDK 393


>gi|229592156|ref|YP_002874275.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas fluorescens SBW25]
 gi|229364022|emb|CAY51583.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Pseudomonas fluorescens SBW25]
          Length = 406

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 173/384 (45%), Positives = 235/384 (61%), Gaps = 19/384 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G G+ ++ + G   +DFA GIAVN LGH+HP LV  L  Q+ KLWHVSN++ +      
Sbjct: 30  RGAGSRVWDQAGRELIDFAGGIAVNVLGHAHPALVGALTEQANKLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI +TFA+RVFF NSGAE+ E A K ARR  +    T K+ I+    +FHGRTL T+
Sbjct: 90  AHKLIDATFAERVFFCNSGAEANEAAFKLARRVAFDRFGTEKYEIIAALNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPKI G     + DL +LK  +S+ T A+++EPIQGEGGV      +L
Sbjct: 150 NVGGQSKYSDGFGPKITGITHVPYNDLDALKAAVSDKTCAVVLEPIQGEGGVLPAELAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q  R++CD  +ALL+FDEVQTG GR+G LFAY+   V PDI+T AK +GGGFPI A L T
Sbjct: 210 QGARELCDANNALLVFDEVQTGMGRSGHLFAYQHYGVVPDILTSAKSLGGGFPIAAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEG-LTAIKNR 318
             +A  +  G+HG+TYGGN LA  + E V+++I +   L  V N    LF+  L  I  +
Sbjct: 270 EALAKHLVVGTHGTTYGGNPLACAVAEAVIDVINTPEVLAGV-NAKHDLFKARLEQIGKQ 328

Query: 319 FPNMFLEVRGQGLLIGL----------KTVFSPALLAAKFRDECLLTAPSSDNVVRILPP 368
           +  +F EVRG GLLIG           K VF+ A        E L+   +  +VVR  P 
Sbjct: 329 Y-GIFTEVRGMGLLIGCVLSDAFKGKAKDVFNAA------EKENLMILQAGPDVVRFAPS 381

Query: 369 LTITAEEIHEGLERIERTAIKLSH 392
           L +   +I+EGL+R ER    L+H
Sbjct: 382 LVVEEADINEGLDRFERAVKSLTH 405


>gi|119468769|ref|ZP_01611821.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Alteromonadales bacterium TW-7]
 gi|119447825|gb|EAW29091.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Alteromonadales bacterium TW-7]
          Length = 401

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/393 (42%), Positives = 238/393 (60%), Gaps = 19/393 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ND +   Y+ S +   +G+G+ ++ +N   F+DFA GIAVN LGH HP LV  LK Q EK
Sbjct: 9   NDVMVPNYNPSAVIPVRGEGSRVWDQNDNEFIDFAGGIAVNCLGHCHPALVNALKEQGEK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  ++ +TFAD+V+F NSGAE+ E A+K ARR+        K +
Sbjct: 69  IWHLSNVMTNEPALRLAQKMVEATFADKVYFANSGAEANEAALKLARRFALDKFGAEKSQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK        + D+++ +  IS+ T A+++E
Sbjct: 129 IIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGDIMHCDYNDIEAFEALISDKTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+    +EF +++R++C   +ALLIFDEVQTG GRTG L+AYE   V PDI+T 
Sbjct: 189 PLQGEGGIISPTDEFAKKVRELCTKHNALLIFDEVQTGVGRTGDLYAYEGLGVVPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA +    +A  +  G+HGSTYGGN LA  + E   + + +   L  V  
Sbjct: 249 AKALGGGFPIGAMITRTAIAEHLKIGTHGSTYGGNPLACAVAEAAFDTVNTPDVLNGVKE 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF--RDECLLTAPSSD- 360
             ++  +GL AI  ++ N+F EVRG+GLLIG       A+L  KF  R    L A +++ 
Sbjct: 309 REQLFRDGLNAINEKY-NVFSEVRGKGLLIG-------AVLNEKFEGRARDFLVASANNG 360

Query: 361 --------NVVRILPPLTITAEEIHEGLERIER 385
                   NV+R  P L I  E+I EGL R E+
Sbjct: 361 LMNLVAGMNVIRFTPSLVIPFEDIKEGLARFEK 393


>gi|242237823|ref|YP_002986004.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Dickeya dadantii Ech703]
 gi|242129880|gb|ACS84182.1| succinylornithine transaminase family [Dickeya dadantii Ech703]
          Length = 406

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/375 (44%), Positives = 228/375 (60%), Gaps = 5/375 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LK+Q E LWH SN++ +      
Sbjct: 30  KGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVEALKTQGETLWHTSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI +TFADRVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 90  ASKLIAATFADRVFFANSGAEANEAAFKLARHYAIERHSPYKTKIIAFYQAFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 150 SVGGQAKYADGFGPKPADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITPATPEFL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
             +R++CD  +ALL+FDEVQ G GR+GKLF+Y    V+PDI+T AK +GGGFPI ACL T
Sbjct: 210 TGVRELCDQYNALLVFDEVQCGMGRSGKLFSYMHYGVRPDILTTAKALGGGFPISACLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            EVA+ M+ G HG+TYGGN LA  + E  L++I +   L  V    +     L  I  RF
Sbjct: 270 EEVASVMSVGLHGTTYGGNPLACAVAEAALDVINTPEVLSGVEARHERFAAALHRINERF 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAPSSDNVVRILPPLTITAEE 375
             +F EVRG GLLIG +   +    A  F        L+   +  +V+R +P L I  ++
Sbjct: 330 -GIFDEVRGMGLLIGAQLKKAWHGRARDFLSASAELGLMILVAGPDVIRFVPSLVIELDD 388

Query: 376 IHEGLERIERTAIKL 390
           I +G+   E+   K+
Sbjct: 389 IDQGMALFEQAVAKV 403


>gi|150402279|ref|YP_001329573.1| acetylornithine aminotransferase [Methanococcus maripaludis C7]
 gi|150033309|gb|ABR65422.1| acetylornithine and succinylornithine aminotransferase
           [Methanococcus maripaludis C7]
          Length = 395

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 160/375 (42%), Positives = 238/375 (63%), Gaps = 5/375 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           ++  ++ NTY +  +   KGKG  +F   G  +LDF +GI VN++GH HP++V  +K+Q+
Sbjct: 12  DEKKYVINTYGRVPVVLVKGKGMSVFDTEGKEYLDFLAGIGVNNVGHCHPKVVETIKNQA 71

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           E L H+SN+Y +  Q   A  L++ +  D+ FF NSGAE+ E AIK AR+Y    GK  +
Sbjct: 72  ETLIHISNIYYNVPQIELAKKLVNLSGLDKAFFCNSGAEANEAAIKLARKYGKTKGKQGE 131

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             I+T E +FHGRTL T++A  K +Y EGF P  +GF    F D+++LK  IS  TAAI+
Sbjct: 132 --IITMEHSFHGRTLTTVTATPKAKYQEGFEPLPQGFAYIPFNDIEALKAGISEKTAAIM 189

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           IEP+QGEGG+    +++L+ +RK+CD+ + +LIFDEVQ G GRTG +FAYE   V PDI+
Sbjct: 190 IEPVQGEGGIHVADKDYLKAVRKLCDENNIVLIFDEVQCGMGRTGTIFAYEQYGVLPDIV 249

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T+AKG+GGG PIGA +A +++A+    GSHG+T+GGN LA       +++I   G LEN 
Sbjct: 250 TLAKGLGGGVPIGAIVAKSKIASAFTPGSHGTTFGGNPLACASSNAAIDVIS--GLLENT 307

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDN 361
           + +       L  +  ++     EVR  GL+IG++  F+ + + +K  ++  L   +SD 
Sbjct: 308 LEMGDYFKNKLKILDKKY-EFIKEVRSLGLMIGIELTFNGSDIVSKMFEKGFLINCTSDT 366

Query: 362 VVRILPPLTITAEEI 376
           V+R LPPL +  E I
Sbjct: 367 VLRFLPPLIVEKEHI 381


>gi|293415065|ref|ZP_06657708.1| succinylornithine transaminase [Escherichia coli B185]
 gi|291432713|gb|EFF05692.1| succinylornithine transaminase [Escherichia coli B185]
          Length = 406

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 232/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNIINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|281178819|dbj|BAI55149.1| succinylornithine transaminase [Escherichia coli SE15]
          Length = 406

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWEQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQLSQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GLER
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLER 392


>gi|325294964|ref|YP_004281478.1| Acetylornithine/succinyldiaminopimelate aminotransferase
           [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065412|gb|ADY73419.1| Acetylornithine/succinyldiaminopimelate aminotransferase
           [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 395

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 236/377 (62%), Gaps = 1/377 (0%)

Query: 5   DFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           +F+  TY++  + F KG+G WL+ +    +LD  +GIAV +LGH HP +   +  Q+ KL
Sbjct: 9   NFVMKTYNRFSVNFVKGEGCWLYDDKDKKYLDMLAGIAVCNLGHCHPTVSDAICEQARKL 68

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
            HVSNL+    Q   A  +  ++F ++VFF NSGAE+ E AIK ARRY        K+ I
Sbjct: 69  IHVSNLFHIETQAELAELICKNSFGEKVFFCNSGAEANEGAIKLARRYG-TEKNPEKYEI 127

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           V F  +FHGRT+A +S  G+ +Y EGFGP + G   A+F +L S+K  +S+ TA I++EP
Sbjct: 128 VAFRQSFHGRTMAAVSITGQGKYNEGFGPMLRGVKFAEFNNLDSVKEVVSDKTAGIIVEP 187

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQGEGG+    ++FL  LRKI D+IDA+LIFDEVQTG GRTGKLFAY+   ++PD+MT+A
Sbjct: 188 IQGEGGIVPADKDFLLGLRKIADEIDAILIFDEVQTGIGRTGKLFAYQHYGIEPDVMTLA 247

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K +G G PIGA +A  + A  +  G H ST+GGN LA   G +V+ I+  + FL+ V   
Sbjct: 248 KALGNGVPIGAIVAKGKAADVLKPGLHASTFGGNPLATRAGIEVIKIVSDEEFLKEVERK 307

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
            K L + L  +K  F  +   VRG+GL++G       + +     ++ L+   ++ NV+R
Sbjct: 308 GKYLAKKLEELKGEFSEIINFVRGKGLMLGAVCKIPCSDIVKLALEKGLIINCTAGNVLR 367

Query: 365 ILPPLTITAEEIHEGLE 381
            +PPL IT +EI  G++
Sbjct: 368 FVPPLVITEDEIDYGIK 384


>gi|300725100|ref|YP_003714428.1| acetylornithine transaminase [Xenorhabdus nematophila ATCC 19061]
 gi|297631645|emb|CBJ92358.1| acetylornithine transaminase (NAcOATase and DapATase),
           PLP-dependent [Xenorhabdus nematophila ATCC 19061]
          Length = 426

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 165/375 (44%), Positives = 228/375 (60%), Gaps = 19/375 (5%)

Query: 21  GKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFA 80
           GKG+ ++ + G  ++DFA GIAV +LGH HP LV  LK Q EKLWHVSN++ +      A
Sbjct: 47  GKGSRVWDQQGNEYIDFAGGIAVLALGHCHPALVDTLKQQGEKLWHVSNVFTNIPALTLA 106

Query: 81  NHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATIS 140
             LI +TFA +VFF NSGAE+ E A K ARRY       NK +I+ F  AFHGRT  T+S
Sbjct: 107 QKLIDATFAQKVFFANSGAEANEAAFKLARRYAITRHHPNKTKIIAFHQAFHGRTFFTVS 166

Query: 141 AGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQ 200
            GG+ +Y + FGPK        F DL +++  I   T A+++EPIQGEGG+    +EFL+
Sbjct: 167 VGGQSKYADRFGPKPADIVHVPFNDLDAVRAAIDEYTCAVVLEPIQGEGGITPATKEFLR 226

Query: 201 QLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATN 260
            +R++CD   ALL+FDEVQ+G GRTGKL+AY+   + PDI+T AK +GGGFPI A L T+
Sbjct: 227 GVRELCDKYQALLVFDEVQSGMGRTGKLYAYQHDGIVPDILTTAKALGGGFPISAMLTTD 286

Query: 261 EVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFP 320
            +A  M  G+HG+TYGGN LA  +G   L+II +   L  V     ++   L  +  ++ 
Sbjct: 287 AIAVAMETGAHGTTYGGNPLACSVGCAALDIINTPEVLAGVEKRHDMIIHALKNLNQKY- 345

Query: 321 NMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DECLLTAPSSDNVVRILPPL 369
            +F E RG+GLLIG       A+L AK++           +  L+   + DNV+R  P L
Sbjct: 346 GIFQEFRGKGLLIG-------AVLKAKYQGKSKEILQQSVEHGLMLLSAGDNVLRFTPSL 398

Query: 370 TITAEEIHEGLERIE 384
            I  E+I EG+  ++
Sbjct: 399 IIPEEDIAEGMALLD 413


>gi|94265425|ref|ZP_01289177.1| Acetylornithine and succinylornithine aminotransferase [delta
           proteobacterium MLMS-1]
 gi|93454082|gb|EAT04417.1| Acetylornithine and succinylornithine aminotransferase [delta
           proteobacterium MLMS-1]
          Length = 402

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 169/382 (44%), Positives = 226/382 (59%), Gaps = 10/382 (2%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L  TY +  +   +G+G  LF+ +G  FLDF +GIAV +LGH HP +   ++ Q E+L H
Sbjct: 14  LMATYGRLPVTMVRGEGCRLFAADGREFLDFVAGIAVCNLGHCHPAITDAVREQVERLVH 73

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNLY S  Q   A  L+  +FADRVFF NSGAE+ E AIK ARR    AG   ++ I++
Sbjct: 74  VSNLYHSQPQIELAETLVAHSFADRVFFCNSGAEANEAAIKLARR----AGGEGRYEIIS 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
             G+FHGRTLAT++A G+ ++ EGF P   GF  A F DL  L+  I + T A+L EP+Q
Sbjct: 130 LTGSFHGRTLATVAATGQPRFHEGFEPLPAGFVHAPFGDLDGLRRLIGSQTCAVLCEPLQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGVR +  E+L  +R++CD+   LLIFDEVQ G GR G L A++   V PDI T+AKG
Sbjct: 190 GEGGVRPLAPEYLAAIRELCDERGLLLIFDEVQVGMGRAGSLLAHQQLGVVPDIATLAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G G PIGA LAT +VAA    GSH ST+GGN +       VL I+ + GF   V     
Sbjct: 250 LGNGLPIGAMLATEQVAAAFTPGSHASTFGGNPVVCAAANAVLEIMLAPGFFAGVRQRGD 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLK-----TVFSPALLAAKFRDECLLTAPSSDN 361
            L   L  +  R+P   +EVRG GL+ GL          P ++   F    LL   + D 
Sbjct: 310 YLRGRLEELVARYPRQLVEVRGMGLIQGLVLQDDFRARGPEIIKELFAAGLLLNF-AGDT 368

Query: 362 VVRILPPLTITAEEIHEGLERI 383
            +R LPPL ++ +EI   +E +
Sbjct: 369 ALRFLPPLVVSHQEIDRAVELV 390


>gi|301026481|ref|ZP_07189911.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 69-1]
 gi|300395499|gb|EFJ79037.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 69-1]
          Length = 406

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 231/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N + ++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDQWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|218695306|ref|YP_002402973.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli 55989]
 gi|254807547|sp|B7L6M2|ASTC_ECO55 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|218352038|emb|CAU97775.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           55989]
          Length = 406

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N N+++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFNEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQDLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  + +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTLNHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|239616507|ref|YP_002939829.1| acetylornithine and succinylornithine aminotransferase [Kosmotoga
           olearia TBF 19.5.1]
 gi|239505338|gb|ACR78825.1| acetylornithine and succinylornithine aminotransferase [Kosmotoga
           olearia TBF 19.5.1]
          Length = 399

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 173/386 (44%), Positives = 250/386 (64%), Gaps = 3/386 (0%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           MN  ++L NTY++  + F+ G+GA ++ +NG  +LDF SGIAVN LGHSHP+LV  +K+Q
Sbjct: 1   MNGMNYLMNTYNRFPVVFDHGEGARIWDKNGKSYLDFTSGIAVNVLGHSHPKLVETIKTQ 60

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           +EKL H SNLY +  Q   A  L  +T   +VFF NSG E+ E AIK AR+Y       N
Sbjct: 61  AEKLIHCSNLYWTEPQIELAKLLGENTLKGKVFFVNSGTEANETAIKIARKYGKKK-DKN 119

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           K++I++   +FHGRTL +++A G+ +Y E F P ++GFD  +F ++ SLK +ISN+  A+
Sbjct: 120 KYKILSAHDSFHGRTLGSLTATGQPKYQEDFKPLVDGFDYFEFNNIDSLKQKISNEVCAV 179

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           ++EP+QGE G+    ++FL+ +RK+C++ + LLIFDEVQ G GRTGKLFAY+   V PDI
Sbjct: 180 ILEPVQGESGIIPATKDFLEAVRKLCNEYETLLIFDEVQCGMGRTGKLFAYQRYGVDPDI 239

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           +T+AKG+GGG PIGA +  N+ A  +  G HGST+GGN LA   G  V+  I  +  LE 
Sbjct: 240 LTVAKGLGGGVPIGA-VVVNKKADILEPGDHGSTFGGNPLACSAGVTVMREILENNLLEQ 298

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLK-TVFSPALLAAKFRDECLLTAPSS 359
           V  +   L + L  +K +FP    E RG GL++G++    S    A K  ++ LL  P+ 
Sbjct: 299 VEKLGIYLKKKLENLKEKFPEHVKETRGIGLMLGMELKEISAKDFAKKCFEKGLLLVPAG 358

Query: 360 DNVVRILPPLTITAEEIHEGLERIER 385
           +N VR LPP  IT ++I + LE ++ 
Sbjct: 359 NNTVRFLPPFVITEDDIDQALEIVKE 384


>gi|149376091|ref|ZP_01893857.1| acetylornithine transaminase [Marinobacter algicola DG893]
 gi|149359728|gb|EDM48186.1| acetylornithine transaminase [Marinobacter algicola DG893]
          Length = 405

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 168/386 (43%), Positives = 237/386 (61%), Gaps = 6/386 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y    +   KG+G+ ++ + G  ++D A GIAV  LGH+HP LV  L  Q+EK
Sbjct: 12  DEVMVPNYAPGSVIPVKGEGSHVWDQGGKEYIDLAGGIAVTCLGHNHPGLVGALMEQAEK 71

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  L   TFA+RVFF NSG E+ E A K ARRY +      K  
Sbjct: 72  IWHLSNVMTNEPALRLAKTLCDLTFAERVFFANSGGEANEAAFKLARRYAWEHFGAEKNE 131

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND-TAAILI 182
           I++F+ +FHGRTL T+S GG+ +YLEGF P   G   A F DL+S++  IS D T A+++
Sbjct: 132 IISFKSSFHGRTLFTVSVGGQPKYLEGFEPAPGGIHHADFNDLESVRKLISKDKTCAVVV 191

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           EPIQGEGGV     EFL+ LR++CD+ DALL+FDEVQ+G GRTG L+AY+   V PDI++
Sbjct: 192 EPIQGEGGVMPGDPEFLKGLRQLCDENDALLVFDEVQSGVGRTGHLYAYQMYGVTPDILS 251

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
            AKG+GGGFP+ A L T +VA  +  G+HGSTYGGN LA  + ++V++ +     L+ V 
Sbjct: 252 TAKGLGGGFPVAAMLTTEKVAKSLGIGTHGSTYGGNALACAVAQRVIDTVSQPDILKGVG 311

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPS 358
             ++ L +G+  I  R+  +F EVRG GLL+G          A +F     +E ++   +
Sbjct: 312 ARSERLRKGMMDIGERY-GIFSEVRGSGLLLGCVLTEEWKGKAKEFLNAGLNEGVMVLIA 370

Query: 359 SDNVVRILPPLTITAEEIHEGLERIE 384
             NVVR+ P L I   +I E L R E
Sbjct: 371 GPNVVRLAPSLIIPEPDIDEALARFE 396


>gi|15895654|ref|NP_349003.1| acetylornithine aminotransferase [Clostridium acetobutylicum ATCC
           824]
 gi|28376929|sp|Q97GH9|ARGD_CLOAB RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|15025400|gb|AAK80343.1|AE007738_11 N-acetylornithine aminotransferase [Clostridium acetobutylicum ATCC
           824]
 gi|325509804|gb|ADZ21440.1| N-acetylornithine aminotransferase [Clostridium acetobutylicum EA
           2018]
          Length = 387

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/382 (42%), Positives = 233/382 (60%), Gaps = 2/382 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY + ++ F+KG+G  L+ ++G  ++DF SG+AVN LGH +P +V  ++ QS KL 
Sbjct: 5   YLMNTYGRFNVTFDKGEGTKLYDKDGNEYIDFVSGVAVNCLGHCNPSIVKAIEEQSSKLM 64

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           HVSN Y +         L  ++  D+VF  NSG E++E  +K AR+Y  + G  NK  I+
Sbjct: 65  HVSNYYWNENAMELTEILCKNSEFDKVFMCNSGTEAIEAGLKLARKYALLHGDENKKEII 124

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
             + +FHGRT+  +S  G+ +Y E F P I      KF DL  +K +IS+ TAA+++EPI
Sbjct: 125 YMDNSFHGRTMGALSVTGQPKYQESFKPLIGAVKSVKFNDLDDIKQKISSKTAAVIVEPI 184

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+    +E+L+ LR +CD+ +ALLIFDEVQ G GR G LFAY+   V PDI+ IAK
Sbjct: 185 QGEGGIIPAKKEYLKLLRDLCDENNALLIFDEVQCGMGRVGSLFAYQKFEVVPDIVCIAK 244

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE-NVINI 304
            +GGGFPIGA LA   VA+    G HG+TYGGN LA  +   VL  +     +E NV   
Sbjct: 245 ALGGGFPIGAMLAKESVASSFVPGDHGNTYGGNPLACAVAIAVLKELVDKKVVEINVNEK 304

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
           +K LF+ L  +K ++  +  +VRG GLLIG++       +  K  +  LL   +  NVVR
Sbjct: 305 SKYLFDKLMTLKEKY-KVINDVRGMGLLIGVEVACDVKKIINKCFESKLLLITAGKNVVR 363

Query: 365 ILPPLTITAEEIHEGLERIERT 386
            LPPL ++ EEI + L   E +
Sbjct: 364 FLPPLNVSFEEIDKALGIFEES 385


>gi|238754142|ref|ZP_04615500.1| Succinylornithine transaminase [Yersinia ruckeri ATCC 29473]
 gi|238707638|gb|EEP99997.1| Succinylornithine transaminase [Yersinia ruckeri ATCC 29473]
          Length = 392

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 225/372 (60%), Gaps = 9/372 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DFA GIAV +LGH HP LV  L  Q E LWH SN++ +      
Sbjct: 15  KGKGSRVWDQQGNEYIDFAGGIAVTALGHCHPALVMALHQQGEMLWHTSNVFTNEPALRL 74

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSG E+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 75  AEKLIAATFADRVFFANSGGEANEAAFKLARHYAIERHSPYKTKIIAFHHAFHGRTLFTV 134

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  I + T A+++EPIQGEGGV     EFL
Sbjct: 135 SVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVIDDHTCAVVLEPIQGEGGVTAATPEFL 194

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q LR +CD   ALL+FDEVQ+G GR+GKLF Y    V PDI+T AK +GGGFPI A L T
Sbjct: 195 QGLRDLCDQHQALLVFDEVQSGMGRSGKLFTYMHYGVIPDILTTAKALGGGFPISAMLTT 254

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  +    ++    LTA+  ++
Sbjct: 255 EEIASVMTVGTHGTTYGGNPLACAVAEAALDVINTPKVLNGIAQRHELFVTALTAMGQQY 314

Query: 320 PNMFLEVRGQGLLIG--LKTVFSPA----LLAAKFRDECLLTAPSSDNVVRILPPLTITA 373
            ++F ++RG GLL+G  LK  F       L AA      +L A    NV+R  P L I  
Sbjct: 315 -DLFSDIRGMGLLVGAELKPQFHGQARNFLTAAAANGLMILNA--GPNVLRFAPSLVIEL 371

Query: 374 EEIHEGLERIER 385
           ++I +G++R  +
Sbjct: 372 KDIEQGMQRFAQ 383


>gi|311695933|gb|ADP98806.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [marine bacterium HP15]
          Length = 404

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/393 (43%), Positives = 238/393 (60%), Gaps = 6/393 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y    I   +G+G+ ++ + G  F+D   GIAV  LGHSHP LV  L  Q+EK
Sbjct: 12  DEVMVPNYAPGSIIPVRGEGSRIWDQEGREFIDLQGGIAVTCLGHSHPGLVGALHDQAEK 71

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  L   TFA+RVFF NSGAE+ E A K ARRY +      K  
Sbjct: 72  IWHLSNVMTNEPALRLAKTLCDLTFAERVFFANSGAEANEAAFKLARRYAWEHHGKEKNE 131

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND-TAAILI 182
           I++F+ +FHGRTL T+S GG+ +YLEGF P   G   A+F DL+S+K  IS + T AI++
Sbjct: 132 IISFKNSFHGRTLFTVSVGGQPKYLEGFEPAPGGIHHAEFNDLESVKKLISKEKTCAIVV 191

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           EPIQGEGGV    + FLQ LR +CD+ DALL+FDEVQ+G GR+G  +AY+   V PDI++
Sbjct: 192 EPIQGEGGVMPGDQAFLQGLRDLCDENDALLVFDEVQSGVGRSGHFYAYQMYGVVPDILS 251

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
            AKG+GGGFP+ A L T +VAA +  G+HGSTYGGN LA  + ++V++ +     L+ V 
Sbjct: 252 SAKGLGGGFPVAAMLTTAKVAASLGVGTHGSTYGGNALACAVAQRVVDTVSQPEILKGVK 311

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPS 358
             +  L +G+  I  R+  +F EVRG GLL+G          A  F     +E ++   +
Sbjct: 312 ARSDKLRKGMMDIGERY-GVFTEVRGAGLLLGCVLTEKWQGKAKDFLNAGLEEGVMVLVA 370

Query: 359 SDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
             NV+R+ P L I   +I   LER E    KL+
Sbjct: 371 GANVIRLAPSLIIPEPDIELALERFEAAVKKLT 403


>gi|299768610|ref|YP_003730636.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Acinetobacter sp. DR1]
 gi|298698698|gb|ADI89263.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Acinetobacter sp. DR1]
          Length = 404

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 174/397 (43%), Positives = 239/397 (60%), Gaps = 11/397 (2%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ND++   +  ++    +G+G+ ++ +    ++DFA GIAVN+LGH+HP  V  L  Q+
Sbjct: 11  NFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYIDFAGGIAVNALGHAHPVAVNALTEQA 70

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            KLWHV N Y +      A  L  +TFAD+VFF NSGAE+ E A+K AR+    +G   K
Sbjct: 71  TKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFCNSGAEANEAALKLARKVGLDSGVAGK 130

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F  AFHGRTL T+SAGG+ +Y + F P   G +   F DL++ K  I+  T A++
Sbjct: 131 SGIVAFNNAFHGRTLFTVSAGGQPKYSQDFAPLPNGINHVAFNDLEAAKAVINEQTCAVI 190

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV     EFL+ LR +CD+  ALLIFDEVQTG GRTG L+AY  + V PD++
Sbjct: 191 VEPIQGEGGVIPADIEFLKGLRALCDEFGALLIFDEVQTGVGRTGALYAYMNSGVIPDVL 250

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T++ A   + G+HG+TYGGN LA  +   V   I +   LE V
Sbjct: 251 TTAKALGGGFPVGAMLTTDKFAPHFSVGTHGTTYGGNPLASAVAGAVFEFINTPEVLEGV 310

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLL 354
            +  +   + L A+ N    +F E+RGQGLLIG +     A  A K +D       E LL
Sbjct: 311 KHRHQYFLDALNAL-NAEHQIFEEIRGQGLLIGCEL---KAEYAGKAKDITTWAGEEGLL 366

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
              +  NVVR  P L I  ++I EG+ R++R   KL+
Sbjct: 367 ALIAGPNVVRFTPSLIIPEQDIDEGIARLKRALAKLA 403


>gi|170288832|ref|YP_001739070.1| acetylornithine and succinylornithine aminotransferase [Thermotoga
           sp. RQ2]
 gi|170176335|gb|ACB09387.1| acetylornithine and succinylornithine aminotransferase [Thermotoga
           sp. RQ2]
          Length = 385

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 167/383 (43%), Positives = 241/383 (62%), Gaps = 5/383 (1%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +    F  GKG+W++ E G  +LDF SGIAVN LGHSHP LV  +K Q+EKL 
Sbjct: 2   YLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLI 61

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNL+ +  Q   A  L  +TF  +VFF N+G E+ E AIK AR+Y        K++I+
Sbjct: 62  HCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKK-SEKKYKIL 120

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           +   +FHGRTL +++A G+ +Y + F P + GF+  +F +++ L+ ++S D  A+ +EPI
Sbjct: 121 SAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNIEDLRKKMSEDVCAVFLEPI 180

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGE G+    +EFL+  RK+CD+ DALL+FDEVQ G GRTGKLFAY+   V PD++T AK
Sbjct: 181 QGESGIVPATKEFLEGARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAK 240

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGG PIGA +  NE A  +  G HG+T+GGN LA   G  V+  +  +GFLE V    
Sbjct: 241 GLGGGVPIGAVI-VNERADVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKG 299

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGL--KTVFSPALLAAKFRDECLLTAPSSDNVV 363
             L + L  +K  F ++  +VRG GL+IG+  +   +   +A K  +  LL  P+ +N +
Sbjct: 300 NYLMKKLQEMKEEF-DLVADVRGMGLMIGIQFREEVNNREIATKCFENKLLVVPAGNNTI 358

Query: 364 RILPPLTITAEEIHEGLERIERT 386
           R+LPPLT+   EI   +E +++ 
Sbjct: 359 RLLPPLTVEYGEIDLAVETLKKV 381


>gi|238758737|ref|ZP_04619911.1| Succinylornithine transaminase [Yersinia aldovae ATCC 35236]
 gi|238703034|gb|EEP95577.1| Succinylornithine transaminase [Yersinia aldovae ATCC 35236]
          Length = 409

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 225/377 (59%), Gaps = 19/377 (5%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DFA GIAV +LGH HP LVA L  Q E LWH SN++ +      
Sbjct: 33  KGKGSRVWDQQGAEYIDFAGGIAVTALGHCHPALVAALHQQGEMLWHTSNVFTNEPALRL 92

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSG E+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 93  AQKLIAATFADRVFFANSGGEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTV 152

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 153 SVGGQPKYSDGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSANPEFL 212

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD   ALL+FDEVQ+G GR+GKLF Y    V PDI+T AK +GGGFPI A L T
Sbjct: 213 QGVRDLCDQHKALLVFDEVQSGMGRSGKLFTYMHYGVTPDILTTAKALGGGFPISAMLTT 272

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  +     +  + L  I +++
Sbjct: 273 AEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEVLNGIEQRHGLFVQALHDINSKY 332

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC-----------LLTAPSSDNVVRILPP 368
             +F ++RG GLLIG       A L A++R              L+   +  +V+R  P 
Sbjct: 333 -QLFSDIRGMGLLIG-------AELTAQYRGRAREFLNAAAANGLMILNAGPDVLRFAPS 384

Query: 369 LTITAEEIHEGLERIER 385
           L I  E+I +G+ R+E+
Sbjct: 385 LVIDVEDIKQGMVRLEK 401


>gi|331647241|ref|ZP_08348335.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli M605]
 gi|331044024|gb|EGI16160.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli M605]
          Length = 406

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLHGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQLSQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|255320370|ref|ZP_05361554.1| succinylornithine transaminase [Acinetobacter radioresistens SK82]
 gi|262379347|ref|ZP_06072503.1| ornithine-oxo-acid transaminase [Acinetobacter radioresistens
           SH164]
 gi|255302565|gb|EET81798.1| succinylornithine transaminase [Acinetobacter radioresistens SK82]
 gi|262298804|gb|EEY86717.1| ornithine-oxo-acid transaminase [Acinetobacter radioresistens
           SH164]
          Length = 401

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 169/393 (43%), Positives = 235/393 (59%), Gaps = 5/393 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ND++   +  ++    +G+G+ ++ ++   ++DFA GIAVN+LGH+HP  V  L  Q+
Sbjct: 10  NFNDWMVPVFAPANFILVRGEGSRIWDQDDKEYIDFAGGIAVNALGHAHPVAVNALTEQA 69

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           +KLWH+ N Y +      A  L+ STFAD+VFF NSGAE+ E A+K AR+   ++G + K
Sbjct: 70  QKLWHIGNGYTNEPVLRLAKQLVESTFADKVFFCNSGAEANEAALKLARKVGLLSGNSEK 129

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T++AGG+ +Y + F P   G +   F DL++ K  I+ +T A++
Sbjct: 130 NHIVAFKNAFHGRTLFTVTAGGQPKYSQDFAPLPGGIEHTAFNDLEAAKALITENTCAVI 189

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV     EFL+ LR +CD+  A+LIFDEVQTG GRTG L+AY    V PDI+
Sbjct: 190 VEPIQGEGGVLPADIEFLKGLRALCDEKGAVLIFDEVQTGVGRTGSLYAYMNTGVTPDIL 249

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFPIGA + T+  A     G HG+TYGGN LA  +   V   I +   L+ V
Sbjct: 250 TTAKALGGGFPIGAMITTDHYANMYAVGDHGTTYGGNPLACAVAGAVFEFINTPEVLDGV 309

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAP 357
               +   + L  I  ++  +F E+RGQGLLIG       A  A        +E LL   
Sbjct: 310 KQRHQYFIDALNKINAQY-GLFKEIRGQGLLIGCVLKDEHAGKAKNIVTLAGEEGLLALV 368

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  +VVR  P L I  E+I EGL R  R   +L
Sbjct: 369 AGADVVRFTPSLIIPQEDIDEGLNRFTRALARL 401


>gi|324007122|gb|EGB76341.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 57-2]
          Length = 406

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATKECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQLSQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|227112121|ref|ZP_03825777.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
          Length = 408

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/376 (43%), Positives = 232/376 (61%), Gaps = 7/376 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ ++G  ++DF+ GIAV +LGH HP LV  L+ Q EKLWH SN++ +      
Sbjct: 30  KGKGSRVWDQDGREYIDFSGGIAVTALGHCHPALVNALQQQGEKLWHTSNIFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI +TFADRVFF NSGAE+ E A K AR Y        K +I++F  AFHGRTL T+
Sbjct: 90  ASKLIDATFADRVFFVNSGAEANEAAFKLARHYAVKRHSPYKTKIISFYNAFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EP+QGEGG+     EFL
Sbjct: 150 SVGGQPKYADGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPVQGEGGITPATPEFL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD   ALL+FDEVQ+G GRTGKLF+Y    + PDI+T AK +GGGFPI A L T
Sbjct: 210 QGVRDLCDQHKALLVFDEVQSGMGRTGKLFSYMHYGITPDILTTAKALGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G HG+TYGGN LA  + E  L+II +   L  V +    L   L  I  ++
Sbjct: 270 EEIASAMTVGVHGTTYGGNPLACAVAEAALDIINTPEVLSGVADRHDRLVSELEKINQQY 329

Query: 320 PNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRDECLLTAPSSDNVVRILPPLTITAE 374
             +F +VRG GLL+G  LK  +   +   LAA    + L+   +  NV+R +P L I  +
Sbjct: 330 -GVFEQVRGMGLLLGAELKPQWHGRAGEFLAAA-TSQGLMVLMAGPNVIRFVPSLIIDED 387

Query: 375 EIHEGLERIERTAIKL 390
           +I +G+ +  +   ++
Sbjct: 388 DIAQGMAKFAKAVAQV 403


>gi|156934326|ref|YP_001438242.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Cronobacter sakazakii ATCC BAA-894]
 gi|156532580|gb|ABU77406.1| hypothetical protein ESA_02157 [Cronobacter sakazakii ATCC BAA-894]
          Length = 406

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 176/395 (44%), Positives = 241/395 (61%), Gaps = 17/395 (4%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     + +G+ L+ + G  ++DFA GIAVN+LGH+HP+L   L++Q+
Sbjct: 9   NFDEWMIPVYAPAAFIPVRAEGSTLWDQEGKEYIDFAGGIAVNALGHAHPKLREALETQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY---HYMAGK 118
            K+WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR+Y   HY A K
Sbjct: 69  AKIWHTGNGYTNEPVLRLAKRLIDATFADRVFFCNSGAEANEAALKLARKYAHDHYGAQK 128

Query: 119 TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTA 178
           +    IV F+ AFHGRTL T+SAGG+  Y + F P       A F DL S    I++DT 
Sbjct: 129 SG---IVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPQISHAVFNDLDSAAALINDDTC 185

Query: 179 AILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP 238
           A+++EP+QGEGGV    + FLQ LR++CD  +ALLIFDEVQTG GRTG L+AY    V P
Sbjct: 186 AVIVEPVQGEGGVVPATKAFLQGLRELCDRHNALLIFDEVQTGVGRTGHLYAYMHYGVTP 245

Query: 239 DIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFL 298
           D+++ AK +GGGFPIGA L T   AA M  G+HG+TYGGN LA  +  +VL+++ +   L
Sbjct: 246 DVLSTAKALGGGFPIGAMLTTERCAAVMGVGTHGTTYGGNPLAGAVAGQVLDLVNTPEML 305

Query: 299 ENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSP-----ALLAAKFRDE 351
            +V        E L A+  R   +F E+RG GLLIG  LK  ++      +L AAK   E
Sbjct: 306 NDVKARHDAFVEQLNAMNQRL-GLFKEIRGLGLLIGCVLKDEYAGKAKAISLAAAK---E 361

Query: 352 CLLTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
             +   +  NV+R  P L I+ +EI  GL R+ R 
Sbjct: 362 GAMVLIAGANVLRFAPALNISHQEIETGLARMARA 396


>gi|291282927|ref|YP_003499745.1| Succinylornithine transaminase [Escherichia coli O55:H7 str.
           CB9615]
 gi|209768564|gb|ACI82594.1| acetylornithine delta-aminotransferase [Escherichia coli]
 gi|290762800|gb|ADD56761.1| Succinylornithine transaminase [Escherichia coli O55:H7 str.
           CB9615]
 gi|320657839|gb|EFX25601.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320658413|gb|EFX26107.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O55:H7 str. USDA 5905]
          Length = 406

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 231/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNESVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNIINHRY-GLFNEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|134105364|pdb|2ORD|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Ec
           2.6.1.11) (Acoat) (Tm1785) From Thermotoga Maritima At
           1.40 A Resolution
 gi|134105365|pdb|2ORD|B Chain B, Crystal Structure Of Acetylornithine Aminotransferase (Ec
           2.6.1.11) (Acoat) (Tm1785) From Thermotoga Maritima At
           1.40 A Resolution
          Length = 397

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 238/383 (62%), Gaps = 5/383 (1%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +    F  GKG+W++ E G  +LDF SGIAVN LGHSHP LV  +K Q+EKL 
Sbjct: 14  YLXNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLI 73

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNL+ +  Q   A  L  +TF  +VFF N+G E+ E AIK AR+Y        K+RI+
Sbjct: 74  HCSNLFWNRPQXELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKK-SEKKYRIL 132

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           +   +FHGRTL +++A G+ +Y + F P + GF+  +F +++ L+ + S D  A+ +EPI
Sbjct: 133 SAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKXSEDVCAVFLEPI 192

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGE G+    +EFL++ RK+CD+ DALL+FDEVQ G GRTGKLFAY+   V PD++T AK
Sbjct: 193 QGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGXGRTGKLFAYQKYGVVPDVLTTAK 252

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGG PIGA +  NE A  +  G HG+T+GGN LA   G  V+  +  +GFLE V    
Sbjct: 253 GLGGGVPIGAVI-VNERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKG 311

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGL--KTVFSPALLAAKFRDECLLTAPSSDNVV 363
             L + L   K  + ++  +VRG GL IG+  +   S   +A K  +  LL  P+ +N +
Sbjct: 312 NYLXKKLQEXKEEY-DVVADVRGXGLXIGIQFREEVSNREVATKCFENKLLVVPAGNNTI 370

Query: 364 RILPPLTITAEEIHEGLERIERT 386
           R LPPLT+   EI   +E +++ 
Sbjct: 371 RFLPPLTVEYGEIDLAVETLKKV 393


>gi|330911552|gb|EGH40062.1| succinylornithine transaminase [Escherichia coli AA86]
          Length = 406

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQLSQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|15802159|ref|NP_288181.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O157:H7 EDL933]
 gi|15831708|ref|NP_310481.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O157:H7 str. Sakai]
 gi|168749433|ref|ZP_02774455.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168756755|ref|ZP_02781762.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762183|ref|ZP_02787190.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4501]
 gi|168770514|ref|ZP_02795521.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168774948|ref|ZP_02799955.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168782168|ref|ZP_02807175.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168788149|ref|ZP_02813156.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC869]
 gi|195937433|ref|ZP_03082815.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O157:H7 str. EC4024]
 gi|208810617|ref|ZP_03252493.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816699|ref|ZP_03257819.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818993|ref|ZP_03259313.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400956|ref|YP_002270817.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217329050|ref|ZP_03445131.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254793366|ref|YP_003078203.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O157:H7 str. TW14359]
 gi|261227759|ref|ZP_05942040.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261258076|ref|ZP_05950609.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           O157:H7 str. FRIK966]
 gi|30172895|sp|Q8X598|ASTC_ECO57 RecName: Full=Succinylornithine transaminase; Short=SOAT; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807548|sp|B5YQ35|ASTC_ECO5E RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|12515767|gb|AAG56734.1|AE005397_11 acetylornithine delta-aminotransferase [Escherichia coli O157:H7
           str. EDL933]
 gi|13361921|dbj|BAB35877.1| acetylornithine delta-aminotransferase [Escherichia coli O157:H7
           str. Sakai]
 gi|187769463|gb|EDU33307.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188016311|gb|EDU54433.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4113]
 gi|189000265|gb|EDU69251.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189356137|gb|EDU74556.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360648|gb|EDU79067.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367450|gb|EDU85866.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189371912|gb|EDU90328.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC869]
 gi|208725133|gb|EDZ74840.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208731042|gb|EDZ79731.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739116|gb|EDZ86798.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209162356|gb|ACI39789.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209768558|gb|ACI82591.1| acetylornithine delta-aminotransferase [Escherichia coli]
 gi|209768560|gb|ACI82592.1| acetylornithine delta-aminotransferase [Escherichia coli]
 gi|209768566|gb|ACI82595.1| acetylornithine delta-aminotransferase [Escherichia coli]
 gi|217318397|gb|EEC26824.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254592766|gb|ACT72127.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           O157:H7 str. TW14359]
 gi|320188435|gb|EFW63097.1| Succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320641596|gb|EFX10984.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O157:H7 str. G5101]
 gi|320646956|gb|EFX15789.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O157:H- str. 493-89]
 gi|320652238|gb|EFX20536.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O157:H- str. H 2687]
 gi|320668311|gb|EFX35138.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O157:H7 str. LSU-61]
 gi|326342115|gb|EGD65896.1| Succinylornithine transaminase [Escherichia coli O157:H7 str. 1044]
          Length = 406

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 231/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNESVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNIINHRY-GLFNEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|320181220|gb|EFW56139.1| Succinylornithine transaminase [Shigella boydii ATCC 9905]
          Length = 406

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 231/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLQLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDSHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISLEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|324119233|gb|EGC13121.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli E1167]
          Length = 406

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N N+++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFNEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  + +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTLNHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|222033501|emb|CAP76242.1| Succinylornithine transaminase [Escherichia coli LF82]
 gi|312946348|gb|ADR27175.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O83:H1 str. NRG 857C]
          Length = 406

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|331653150|ref|ZP_08354155.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli M718]
 gi|331049248|gb|EGI21320.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli M718]
          Length = 406

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I  R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINYRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|306815000|ref|ZP_07449156.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli NC101]
 gi|305851648|gb|EFM52101.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli NC101]
          Length = 406

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|260549894|ref|ZP_05824110.1| succinylornithine transaminase [Acinetobacter sp. RUH2624]
 gi|260407144|gb|EEX00621.1| succinylornithine transaminase [Acinetobacter sp. RUH2624]
          Length = 404

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 172/399 (43%), Positives = 238/399 (59%), Gaps = 15/399 (3%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ND++   +  ++    +G+G+ ++ +    ++DFA GIAVN+LGH+HP  V  L  Q+
Sbjct: 11  NFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYIDFAGGIAVNALGHAHPVAVNALTEQA 70

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           +KLWHV N Y +      A  L  +TFAD+VFF NSGAE+ E A+K AR+    +G   K
Sbjct: 71  KKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFCNSGAEANEAALKLARKVGLDSGIAGK 130

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F  AFHGRTL T+SAGG+ +Y + F P   G     + DL++ K  I+  T A++
Sbjct: 131 SGIVAFNNAFHGRTLFTVSAGGQPKYSQDFAPLPNGISHVAYNDLEAAKAVINEQTCAVI 190

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGGV     EFL+ LR +CD  DALLIFDEVQTG GRTG L+AY    V PD++
Sbjct: 191 VEPVQGEGGVIPADIEFLKGLRALCDQFDALLIFDEVQTGVGRTGALYAYMNYGVTPDVL 250

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T++ A   +  +HG+TYGGN LA  +   V   I +   LE V
Sbjct: 251 TTAKALGGGFPVGAMLTTDKFAPHFSVSTHGTTYGGNPLASAVAGAVFEFINTPEVLEGV 310

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------EC 352
            +  +  F+ L  +   +  +F E+RGQGLLIG  LK  +     A K +D       E 
Sbjct: 311 KHRHQYFFDALNTLNAEY-QVFDEIRGQGLLIGCVLKAEY-----AGKAKDITTWAGEEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           LL   +  NVVR  P L I  ++I EG+ R++R   KL+
Sbjct: 365 LLALIAGPNVVRFTPSLIIPEQDIDEGIARLKRALAKLA 403


>gi|37524403|ref|NP_927747.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|41016842|sp|Q7N9E5|ARGD_PHOLL RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase; Short=ACOAT; Short=DapATase;
           Short=Succinyldiaminopimelate transferase
 gi|36783827|emb|CAE12689.1| acetylornithine delta-aminotransferase [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 403

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 169/395 (42%), Positives = 240/395 (60%), Gaps = 15/395 (3%)

Query: 9   NTYDQ------SDIRF--EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           NTYDQ      S  +F   +G+G+ ++ ++G  ++DFA GIAV +LGH HP LV +LK Q
Sbjct: 10  NTYDQVMLPIYSPAQFIPVRGQGSRVWDQHGKEYIDFAGGIAVVALGHCHPTLVDVLKQQ 69

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
            EKLWH+SN++ +    I A  LI +TFA+RVFF NSGAE+ E A K AR Y        
Sbjct: 70  GEKLWHISNIFTNEPALILAQKLIDATFAERVFFANSGAEANEAAFKLARHYAIARHNPY 129

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           K +I+ F   FHGRTL T+S GG+ +Y +GFGPK        F DL ++K  I + T A+
Sbjct: 130 KTKIIAFHQGFHGRTLFTVSVGGQPKYADGFGPKPADIIHVPFNDLDAVKAVIDDHTCAV 189

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           ++EP+QGEGGV      F+  +R++CD    LL+FDEVQ+G GRTGKLF+Y   +V PDI
Sbjct: 190 VLEPVQGEGGVTAAAPAFIHGVRELCDKHQVLLVFDEVQSGMGRTGKLFSYMHYDVTPDI 249

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           +T AK +G GFPI A L T  +A+ M  G+HG+TYGGN LA  +     +II +   L  
Sbjct: 250 ITTAKALGNGFPISAMLTTVNIASVMTPGAHGTTYGGNPLACAVANVAFDIINTPAVLAG 309

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAK-----FRDECLLT 355
           V     ++   L  I  ++ ++F E+RG+GLLIG + + +P    AK       +  L+ 
Sbjct: 310 VEKRHNLMVNFLNDINQKY-SIFGEIRGKGLLIGAE-LKAPHQGKAKDILQLAAENGLML 367

Query: 356 APSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
             +  +V+R  P L I+ EEI +G+ER+E+   +L
Sbjct: 368 LSAGGDVLRFTPSLIISEEEIAQGMERLEQVINQL 402


>gi|283833418|ref|ZP_06353159.1| acetylornithine transaminase [Citrobacter youngae ATCC 29220]
 gi|291071071|gb|EFE09180.1| acetylornithine transaminase [Citrobacter youngae ATCC 29220]
          Length = 406

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 234/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HP L   L  Q+
Sbjct: 9   NFDEWMMPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNDQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFA+RVFF NSGAE+ E A+K AR+Y +      K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRFGNQK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             +V F+ AFHGRTL T+SAGG+  Y + F P       A + DL S    I + T A++
Sbjct: 129 SGVVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAVYNDLDSASQLIDDTTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPVQGEGGVVPATNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFPIGA LAT + A+ M  G+HG+TYGGN LA  +  K+L+I+ +   L  V
Sbjct: 249 TTAKALGGGFPIGALLATEDCASVMTVGTHGTTYGGNPLASAVAGKLLDIVNTPDVLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFS--PALLAAKFRDECLLTAP 357
                   E + AI  RF  +F E+RG GLLIG  L T F+    L++ +  +  ++   
Sbjct: 309 KQRHDWFVERINAINERF-GLFSEIRGLGLLIGCVLNTDFAGKAKLISQEAANAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGANVVRFAPALNVSEEEVATGLDR 392


>gi|188997014|ref|YP_001931265.1| acetylornithine and succinylornithine aminotransferase
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932081|gb|ACD66711.1| acetylornithine and succinylornithine aminotransferase
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 387

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 240/385 (62%), Gaps = 10/385 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           + +LF  Y +    F KG+G +L  ENG  +LD  SGIAVN LG++HP+L   +  Q+++
Sbjct: 7   DKYLFPNYARLPYSFVKGEGCYLHDENGKKYLDMLSGIAVNQLGYNHPKLTESICRQAKE 66

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           + H+SNL+    Q   A  L+ ++  D+VFF NSGAE+ E  IK  RRY Y   K N++ 
Sbjct: 67  IIHISNLFYIKPQYEVAKILVENSCGDKVFFCNSGAEANEALIKLIRRYFY-DKKENRYE 125

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+TFEG+FHGRTLATI+A  + +Y EGF P  EGF  AKF D+ S+K  I++ TAA+LIE
Sbjct: 126 IITFEGSFHGRTLATITATAQPKYQEGFQPLPEGFKYAKFNDIDSVKQLINDKTAAVLIE 185

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
            +QGEGGV    ++F+++L  IC +   L   DEVQTG GRTGKLFAY+  +++PDI+++
Sbjct: 186 LVQGEGGVNPADKKFIKELYSICRENGILFTVDEVQTGIGRTGKLFAYQHYDIEPDIISL 245

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGG PIGA +A +E+A     G+H ST+GGN LA    + VL  I SDGFL+ VI 
Sbjct: 246 AKGLGGGVPIGAVIAKDEIAKSFVPGTHASTFGGNYLATAAAKVVLEEILSDGFLDKVIK 305

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDN 361
             + L EGL      +P     V+G GL+IG  L    S   +  K  +  L+   +  N
Sbjct: 306 NGEYLKEGLKTFG--YP-----VKGLGLMIGMDLPEEISAKEIMKKALENGLIIGTAGKN 358

Query: 362 VVRILPPLTITAEEIHEGLERIERT 386
            +R +PPL I  ++I   +  +E+ 
Sbjct: 359 TLRFVPPLIIRKDDIDLAVNILEKV 383


>gi|194433505|ref|ZP_03065783.1| succinylornithine transaminase [Shigella dysenteriae 1012]
 gi|194418268|gb|EDX34359.1| succinylornithine transaminase [Shigella dysenteriae 1012]
 gi|332085864|gb|EGI91028.1| acetylornithine/succinyldiaminopimelate aminotransferase [Shigella
           dysenteriae 155-74]
          Length = 406

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 231/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLQLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISLEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|311279860|ref|YP_003942091.1| succinylornithine transaminase family [Enterobacter cloacae SCF1]
 gi|308749055|gb|ADO48807.1| succinylornithine transaminase family [Enterobacter cloacae SCF1]
          Length = 406

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 170/390 (43%), Positives = 241/390 (61%), Gaps = 11/390 (2%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N +D++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HP ++  L  Q+
Sbjct: 9   NFDDWMMPVYAPAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPAMIKALTEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y +    T+K
Sbjct: 69  GKFWHTGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYAHDKFGTHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S +  I++DT A++
Sbjct: 129 NGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPQIQHAVYNDIDSARALINDDTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGGV      FL++LR +CD  +A+LIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPMQGEGGVVPAAPAFLKELRALCDRHNAVLIFDEVQTGVGRTGELYAYMHYGVTPDVL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           + AK +GGGFPIGA L T++ A+ M  G+HG+TYGGN LA  +   V ++I +   L  V
Sbjct: 249 STAKALGGGFPIGAMLTTDKFASVMVVGTHGTTYGGNPLASAVAGAVFSLINTHEVLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSP-----ALLAAKFRDECLL 354
               +   E L+AI  R+P +F EVRG GLLIG  LK  ++      + LAA   +  L+
Sbjct: 309 KQRHQWFTERLSAINARYP-LFDEVRGMGLLIGCVLKAEYAGKAKQISQLAA---EHGLM 364

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLERIE 384
              +  NVVR  P L I+ EE+  G +R E
Sbjct: 365 VLIAGANVVRFAPALIISEEEVKTGFDRFE 394


>gi|284921667|emb|CBG34739.1| succinylornithine transaminase [Escherichia coli 042]
          Length = 406

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 231/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FL  LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLHGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  + +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTVNHRY-GLFSEVRGLGLLIGCVLNTDYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|260597608|ref|YP_003210179.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Cronobacter turicensis z3032]
 gi|260216785|emb|CBA30238.1| Succinylornithine transaminase [Cronobacter turicensis z3032]
          Length = 406

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 174/395 (44%), Positives = 239/395 (60%), Gaps = 17/395 (4%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     + +G+ L+ + G  ++DFA GIAVN+LGH+HP+L   L++Q+
Sbjct: 9   NFDEWMIPVYAPAAFIPVRAEGSTLWDQEGKEYIDFAGGIAVNALGHAHPKLRQALETQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY---HYMAGK 118
            K+WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR+Y   HY A K
Sbjct: 69  AKIWHTGNGYTNEPVLRLAKRLIDATFADRVFFCNSGAEANEAALKLARKYAHDHYGAQK 128

Query: 119 TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTA 178
           +    IV F+ AFHGRTL T+SAGG+  Y + F P       A F DL S    I++DT 
Sbjct: 129 SG---IVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPQISHAVFNDLNSAAALINDDTC 185

Query: 179 AILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP 238
           A+++EP+QGEGGV    + FL+ LR++CD  +ALLIFDEVQTG GRTG L+AY    V P
Sbjct: 186 AVIVEPVQGEGGVVPATKAFLKGLRELCDRHNALLIFDEVQTGVGRTGHLYAYMHYGVTP 245

Query: 239 DIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFL 298
           D+++ AK +GGGFPIGA L T   AA M  G+HG+TYGGN LA  +  +VL+++ +   L
Sbjct: 246 DVLSTAKALGGGFPIGAMLTTERCAAVMGVGTHGTTYGGNPLASAVAGEVLDLVNTPEML 305

Query: 299 ENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL-------KTVFSPALLAAKFRDE 351
           + V      L E L A+  R   +F E+RG GLLIG            + +L AAK   E
Sbjct: 306 DGVKARHDALVEQLNAMNQRL-GVFKEIRGLGLLIGCVLSDEYAGKAKAMSLAAAK---E 361

Query: 352 CLLTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
             +   +  NV+R  P L I+ +EI  GL R+ R 
Sbjct: 362 GAMVLIAGANVLRFAPALNISHQEIETGLARVARA 396


>gi|170680032|ref|YP_001743501.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli SMS-3-5]
 gi|300938916|ref|ZP_07153618.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 21-1]
 gi|254807558|sp|B1LDY3|ASTC_ECOSM RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|170517750|gb|ACB15928.1| succinylornithine transaminase [Escherichia coli SMS-3-5]
 gi|300456176|gb|EFK19669.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 21-1]
          Length = 406

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 232/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIHHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + +  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|238751532|ref|ZP_04613023.1| Succinylornithine transaminase [Yersinia rohdei ATCC 43380]
 gi|238710250|gb|EEQ02477.1| Succinylornithine transaminase [Yersinia rohdei ATCC 43380]
          Length = 413

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 174/393 (44%), Positives = 244/393 (62%), Gaps = 13/393 (3%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  +D    +G+GA L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 13  DEWIVPTYAPADFIVVRGEGATLWDQAGKSYIDFAGGIAVNALGHGHPAVKAALIEQADK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHY-----MAGK 118
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y         G+
Sbjct: 73  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYARDNFANQPGQ 132

Query: 119 TN-KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +IV F+ AFHGRTL T+SAGG+ +Y + F P  EG     F DL S +  I++ T
Sbjct: 133 VGEKNQIVAFKNAFHGRTLFTVSAGGQPKYSQDFAPLPEGIRHGIFNDLASAQALINDQT 192

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV    +EFL  LR +CD  +ALLIFDEVQTG GRTG L+AY    V 
Sbjct: 193 CAVIVEPIQGEGGVLPADKEFLHGLRALCDRHNALLIFDEVQTGVGRTGDLYAYMHYGVT 252

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I +   
Sbjct: 253 PDVLTSAKALGGGFPIAAMLTTTQYASALNIGSHGTTYGGNPLACAVAGTVLSLINTPEV 312

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRDEC 352
           L  V    +   +GL  I  R+  +F E+RG+GLLIG  L + +   S  ++ A   +  
Sbjct: 313 LAGVKERHQWFLDGLVEINARY-KVFTEIRGRGLLIGCVLNSDYAGKSKEIIQAA-AEHG 370

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
           L+   +  +VVR  P L I+A +I EGL R+ +
Sbjct: 371 LIALIAGPDVVRFAPSLIISAHDIKEGLARLAK 403


>gi|323175177|gb|EFZ60791.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli LT-68]
          Length = 406

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 231/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            KLWH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKLWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|95928616|ref|ZP_01311363.1| acetylornithine and succinylornithine aminotransferases
           [Desulfuromonas acetoxidans DSM 684]
 gi|95135406|gb|EAT17058.1| acetylornithine and succinylornithine aminotransferases
           [Desulfuromonas acetoxidans DSM 684]
          Length = 401

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 158/377 (41%), Positives = 233/377 (61%), Gaps = 1/377 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +  +  TY +  +   KG+G WL+  +G  +LDF +G+AVN+LGH HP++V  L+ Q+  
Sbjct: 12  DQHITTTYGRYPLVAVKGEGCWLWDADGNKYLDFLAGVAVNNLGHCHPKVVEALQRQAAT 71

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           L H SN Y    Q   A  L   +F DRVFF NSGAE+ E A+K  R+Y       N+F 
Sbjct: 72  LIHCSNYYHIPSQIELAEILCEHSFGDRVFFCNSGAEANEAAMKLVRKYSAEKHGENRFE 131

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           ++T   +FHGRT+ TISA G+    +GF P + GF    F D+ ++++ IS +T A+++E
Sbjct: 132 VITALASFHGRTIGTISATGQDAVRKGFTPVVPGFKYVPFGDIDAMRSAISPNTCAVMLE 191

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGGV   PE +L+ +R++CD+ D LL+FDEVQ G GRTG LFAY+   + PDIMT+
Sbjct: 192 PVQGEGGVNVPPEGYLKAVRQLCDEQDLLLVFDEVQVGCGRTGTLFAYQHDEIAPDIMTL 251

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK + GG PIGA +AT EVAA    G+HGST+GGN L        +  +  DG L+N + 
Sbjct: 252 AKALAGGPPIGAMVATEEVAATFVPGTHGSTFGGNPLMTSAAVAAMRCLLDDGVLDNCVA 311

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVV 363
           +   L E L A+ +RF +    VRG+GL++GL+     A +  +   + LL   ++ +V+
Sbjct: 312 MGDYLREQLEALSSRF-SFAGAVRGRGLILGLQLETPGADIVKQAMAKGLLINCTAGSVL 370

Query: 364 RILPPLTITAEEIHEGL 380
           R +PPL ++ EEI + +
Sbjct: 371 RFVPPLIVSREEIDQAM 387


>gi|325288618|ref|YP_004264799.1| acetylornithine aminotransferase apoenzyme [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324964019|gb|ADY54798.1| acetylornithine aminotransferase apoenzyme [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 404

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 163/385 (42%), Positives = 240/385 (62%), Gaps = 2/385 (0%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           ++  +++ NTY +  +   KG+G  ++  +G  +LDF +G+AV SLGHSHPE+V  +K Q
Sbjct: 14  LDGQEYVMNTYGRLPMALVKGQGTRVWDSDGKAYLDFVTGLAVTSLGHSHPEVVEAIKEQ 73

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           +E++ H SNLY    Q   A  L  ++FAD+VFF NSGAE+ E AIK AR+Y  +    +
Sbjct: 74  AEQIIHSSNLYWIPNQVRLAELLAENSFADKVFFCNSGAEANEGAIKLARKYAKLNFGNH 133

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           K  IV+ + +FHGRTLAT++A G+ +Y   + P   GF  A+  + + L + ++ +TAA+
Sbjct: 134 KTEIVSLKNSFHGRTLATLTATGQTKYQNYYDPLPPGFSYAELNNSEELDSAVTENTAAL 193

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           +IEPIQGEGGV  V +EF+Q+ R+ICD    LLIFDEVQ G GRTGKLFA+EW  V PDI
Sbjct: 194 IIEPIQGEGGVYPVTQEFIQKAREICDQKGVLLIFDEVQCGVGRTGKLFAHEWFGVTPDI 253

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           M++AK +  G PIGA LAT++ A+C   G H ST+GGN L      KV+ I+ ++GFL+ 
Sbjct: 254 MSVAKALANGVPIGAVLATDK-ASCFQPGDHASTFGGNFLTTAAACKVMEIMTAEGFLQG 312

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
           V   A    + L  + +++  +  EVRG G ++GL        +      + LL      
Sbjct: 313 VRKKAGYFRDKLQGLADKY-GLTEEVRGLGFILGLPVGKIGPDIVRSCSVKGLLINCVGG 371

Query: 361 NVVRILPPLTITAEEIHEGLERIER 385
             +R LPPLT++ EEI E +  +++
Sbjct: 372 ETLRFLPPLTVSYEEIDEAISLLDQ 396


>gi|293395673|ref|ZP_06639955.1| succinylornithine transaminase [Serratia odorifera DSM 4582]
 gi|291421610|gb|EFE94857.1| succinylornithine transaminase [Serratia odorifera DSM 4582]
          Length = 404

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 170/391 (43%), Positives = 236/391 (60%), Gaps = 5/391 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D++   Y  +D    +G+G+ ++ + G  ++DFA GIAVN+LGH+HP + A L  Q+ K
Sbjct: 13  DDWMIPVYAPADFILVRGEGSHVWDQQGKQYIDFAGGIAVNALGHAHPVVKAALVEQAGK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR++      + K R
Sbjct: 73  LWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKHAMDNYGSEKNR 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           IV F  AFHGRTL T+SAGG+ +Y + F P   G     + DL +    I++ T A+++E
Sbjct: 133 IVAFNNAFHGRTLFTVSAGGQPKYSQDFAPLPGGIMHTAYNDLAAAAEAINDQTCAVIVE 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV      FLQ LR +CD  +ALLIFDEVQTG GRTG L+AY    V PD++T 
Sbjct: 193 PIQGEGGVLPADGAFLQGLRDLCDRHNALLIFDEVQTGVGRTGDLYAYMQYGVVPDVLTT 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T+ +A+ +  G+HG+TYGGN LA  +   VL++I +   L  V  
Sbjct: 253 AKALGGGFPIGAMLTTDALASTLGVGTHGTTYGGNPLATAVAGAVLSLINTPEVLNGVKQ 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFS--PALLAAKFRDECLLTAPSS 359
                 E L AI  R+P +F E+RG GLLIG  L   F+     +     +E ++   + 
Sbjct: 313 RHLWFIEQLNAINQRYP-IFSEIRGGGLLIGCVLNQDFAGKAKQITQYANEEGVIALIAG 371

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
            NVVR  P L I   +I+EGL R  R   ++
Sbjct: 372 PNVVRFTPSLIIPEADINEGLARFARAVARI 402


>gi|332090562|gb|EGI95659.1| acetylornithine/succinyldiaminopimelate aminotransferase [Shigella
           boydii 5216-82]
          Length = 406

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 231/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLQLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCILNADYAGQAKQISLEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|312969776|ref|ZP_07783959.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli 1827-70]
 gi|310338061|gb|EFQ03150.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli 1827-70]
          Length = 406

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GLER
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLER 392


>gi|238788939|ref|ZP_04632729.1| Succinylornithine transaminase [Yersinia frederiksenii ATCC 33641]
 gi|238722966|gb|EEQ14616.1| Succinylornithine transaminase [Yersinia frederiksenii ATCC 33641]
          Length = 410

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 231/378 (61%), Gaps = 16/378 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV +LGH HP+LV  L  Q E LWH SN++ +      
Sbjct: 33  KGKGSRVWDQQGTEYIDFSGGIAVTALGHCHPKLVEALHQQGETLWHTSNVFTNEPALRL 92

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSG E+ E A K AR Y        K +I+ F  AFHGRT  T+
Sbjct: 93  AKKLIDATFADRVFFANSGGEANEAAFKLARHYAIERYSPYKTKIIAFHHAFHGRTFFTV 152

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 153 SVGGQPKYSDGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSATPEFL 212

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD   ALL+FDEVQ+G GR+GKLF Y    V PDI+T AK +GGGFPI A L T
Sbjct: 213 QGVRALCDQYKALLVFDEVQSGMGRSGKLFTYMHYGVTPDILTTAKALGGGFPISAMLTT 272

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L+ +     +  + L  I +R+
Sbjct: 273 EEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEVLDGIEQRHGLFVQALQDINSRY 332

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD---------NVVRILPPLT 370
            ++F ++RG GLLIG +   +P     + R    LTA +++         +V+R+ P L 
Sbjct: 333 -HVFSDIRGMGLLIGAE--LTPVY---RGRAREFLTAAAANGLMILNAGPDVLRLAPSLV 386

Query: 371 ITAEEIHEGLERIERTAI 388
           +  E+I +G+ R+E TAI
Sbjct: 387 VELEDIKQGMARLE-TAI 403


>gi|294669063|ref|ZP_06734149.1| acetylornithine transaminase [Neisseria elongata subsp. glycolytica
           ATCC 29315]
 gi|291309055|gb|EFE50298.1| acetylornithine transaminase [Neisseria elongata subsp. glycolytica
           ATCC 29315]
          Length = 394

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 166/385 (43%), Positives = 226/385 (58%), Gaps = 5/385 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
            ++L   +  + I  E+G+G+ ++   G  ++D A GIAVN+LGH HP L+A L  Q++K
Sbjct: 2   QNYLTPNFTFAPIIPERGQGSRVWDTEGREYIDLAGGIAVNALGHCHPALLAALTEQAQK 61

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+Y +T  +  A  L   TFAD+VFF NSGAE+ E A+K AR+Y        K +
Sbjct: 62  LWHISNIYTTTPAQALAKRLTEHTFADKVFFCNSGAEANEAALKLARKYARDRHGEGKHQ 121

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+    AFHGRTL T+S GG+ +Y   F P  EG     F D  +L+  +S  T A++IE
Sbjct: 122 IIACTNAFHGRTLFTVSVGGQPKYSRDFAPLPEGITHIPFNDPDALRQAVSAQTCAVIIE 181

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGE GV     EFLQ  R++CD  DA LIFDEVQTG GRTGKLFAY+   + PDI+T 
Sbjct: 182 PVQGESGVLPATAEFLQTARELCDRFDAALIFDEVQTGMGRTGKLFAYQHGGIAPDILTS 241

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +G GFPIGA L T+ +A     G+HGST+GGN LA  +G    +II S+    N + 
Sbjct: 242 AKALGSGFPIGAMLTTDRIAPSFGPGTHGSTFGGNPLACAVGCAAFDIINSEATRANTVR 301

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECL----LTAPSS 359
            +  L   L  I      +F  VRGQGLLIG     + A  AA+     L    +   + 
Sbjct: 302 QSAKLTAALQKIGEET-GVFQTVRGQGLLIGCVLAEAYAGRAAEITAAALKHGVMVLVAG 360

Query: 360 DNVVRILPPLTITAEEIHEGLERIE 384
            NVVR+ P L I   +I E + +++
Sbjct: 361 ANVVRLAPSLLIEGRDIDEAVPKLK 385


>gi|261339486|ref|ZP_05967344.1| acetylornithine transaminase [Enterobacter cancerogenus ATCC 35316]
 gi|288318298|gb|EFC57236.1| acetylornithine transaminase [Enterobacter cancerogenus ATCC 35316]
          Length = 406

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N N+++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HP L   L  Q+
Sbjct: 9   NFNEWMMPVYAPAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALRQALNDQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y +     +K
Sbjct: 69  AKFWHTGNGYTNEPALRLAKKLIDATFAEKVFFCNSGAEANEAALKLARKYAHDKFGAHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + DLQS    I++ T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPSYSQDFAPLPPDIRHASYNDLQSASELINDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGGV    + FLQ LR++CD  +A+LIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPMQGEGGVLPAQQAFLQGLRELCDRHNAVLIFDEVQTGVGRTGELYAYMHYGVTPDVL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           + AK +GGGFP+GA L T++ A+ M  G+HG+TYGGN LA  +  +VL+II +   L  V
Sbjct: 249 STAKALGGGFPVGAILTTDKFASVMTVGTHGTTYGGNPLASAVAGQVLDIINTPEVLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E LTAI N    +F E+RG GLLIG +     A  A     E     ++   
Sbjct: 309 KQRHDWFVERLTAI-NAKTGLFKEIRGLGLLIGCELAPEFAGKAKLISQEAAKLGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L +T EEI  GL+R
Sbjct: 368 AGANVVRFAPALIVTEEEIRTGLDR 392


>gi|77359165|ref|YP_338740.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76874076|emb|CAI85297.1| acetylornithine transaminase (NAcOATase and DapATase),
           PLP-dependent [Pseudoalteromonas haloplanktis TAC125]
          Length = 401

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 235/394 (59%), Gaps = 10/394 (2%)

Query: 1   MNKNDFLFN-----TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVA 55
           M  N  LF+      Y  S +   +G+G+ ++ + G  F+DFA GIAVN LGH HP LV 
Sbjct: 1   MTVNRELFDHVMVPNYAPSSVIPVRGEGSRVWDQQGREFIDFAGGIAVNCLGHCHPALVG 60

Query: 56  ILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYM 115
            LK Q EKLWH+SN+  +      A  ++ +TFA++V+F NSGAE+ E A+K ARR+   
Sbjct: 61  ALKEQGEKLWHLSNVMTNEPALRLAKKMVDATFAEKVYFANSGAEANEAALKLARRFALD 120

Query: 116 AGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN 175
                K +I+ F   FHGRT  T++ GG+  Y +GFGPK        + DL + +  IS+
Sbjct: 121 QFGAEKSQIIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGDIVHCDYNDLAAFEALISD 180

Query: 176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN 235
            T A+++EP+QGEGG+    +EF Q +R +C   +ALLIFDEVQTG GRTG L+AY+  N
Sbjct: 181 KTCAVMMEPLQGEGGIVSPTDEFAQGVRDLCTKHNALLIFDEVQTGVGRTGNLYAYQGLN 240

Query: 236 VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD 295
           V PDI+T AK +GGGFPIGA + T E+A  +  G+HGSTYGGN LA  + E   + + + 
Sbjct: 241 VVPDILTTAKALGGGFPIGAMITTTEIAQHLKVGTHGSTYGGNPLACAVAEAAFDTVNTP 300

Query: 296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDE 351
             L  V   A +  + LT I N++ ++F E+RGQGLLIG          A +F     + 
Sbjct: 301 EVLAGVTAKAALFNQLLTEINNKY-HVFSEIRGQGLLIGAVVSEQYKGRAKEFLVAGTEH 359

Query: 352 CLLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
            L++  +  +VVR  P L I   +I EG+ R E+
Sbjct: 360 GLMSLVAGADVVRFTPSLVIPEADIREGMARFEK 393


>gi|256830635|ref|YP_003159363.1| acetylornithine and succinylornithine aminotransferase
           [Desulfomicrobium baculatum DSM 4028]
 gi|256579811|gb|ACU90947.1| acetylornithine and succinylornithine aminotransferase
           [Desulfomicrobium baculatum DSM 4028]
          Length = 397

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 161/383 (42%), Positives = 231/383 (60%), Gaps = 7/383 (1%)

Query: 1   MNKNDF-------LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPEL 53
           MN  D        L  TY +  +   + +G  LF+  G  + D  +GIAV +LGHSHPEL
Sbjct: 1   MNSEDIKQGEASALCRTYARYPLAVSRAEGTRLFTPEGRVYTDLLAGIAVCNLGHSHPEL 60

Query: 54  VAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYH 113
           V ++ +Q++KL HVSNL+   +Q   A  L+ ++   RVFF NSGAE+ E AIK ARRY 
Sbjct: 61  VEVICAQAKKLVHVSNLFYQEEQVALATRLLGTSHLKRVFFCNSGAEANEGAIKLARRYM 120

Query: 114 YMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI 173
                  +F I+T  G+FHGRTLAT++A G+ +   GFGP  EGF    F DL+++K  +
Sbjct: 121 REGRGEERFEIITLSGSFHGRTLATLTATGQDKIKTGFGPLPEGFITVPFADLEAMKAAM 180

Query: 174 SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW 233
           +  TAA+LIE IQGEGGV+ +P+E+++ L  +C +   LLI DE+QTG GRTGK +A++ 
Sbjct: 181 NERTAAVLIEMIQGEGGVKPLPQEYVRGLAALCAEKGVLLIIDEIQTGVGRTGKFWAHQH 240

Query: 234 ANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQ 293
             + PDI+T+AKG+ GG P+GA + + EV+     GSHG+T+GGN L   + +KV+ II+
Sbjct: 241 LGLVPDIVTVAKGLAGGLPMGAVMCSEEVSKGFPPGSHGTTFGGNALISAVADKVIEIIE 300

Query: 294 SDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECL 353
            D        +   L   L  IK+R P    EVR  GL+IG++     A +     +   
Sbjct: 301 RDDLCGRAARMGDWLRGRLEGIKSRLPEQIAEVRVHGLMIGIELTHPGAEVWKALLERGF 360

Query: 354 LTAPSSDNVVRILPPLTITAEEI 376
           +   + D V+R+LPPL IT EE+
Sbjct: 361 VLNLTQDTVLRLLPPLVITEEEL 383


>gi|157372814|ref|YP_001480803.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Serratia proteamaculans 568]
 gi|157324578|gb|ABV43675.1| acetylornithine and succinylornithine aminotransferase [Serratia
           proteamaculans 568]
          Length = 405

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 164/373 (43%), Positives = 227/373 (60%), Gaps = 13/373 (3%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +GKG+ ++   G  ++DF+ GIAV +LGH HP LV  LK Q E LWH SN++ +      
Sbjct: 29  RGKGSRVWDSQGKEYIDFSGGIAVTALGHCHPALVEALKQQGETLWHTSNVFTNEPALRL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI++TFADRVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 89  ATKLINATFADRVFFANSGAEANEAAFKLARHYAITRHSPYKTKIIAFYNAFHGRTLFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+  V  EFL
Sbjct: 149 SVGGQAKYSDGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVMEPIQGEGGITPVNAEFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           + +R++CD   ALL+FDEVQ+G GR+GKLFAY    V PDI+T AK +GGGFP+ A L T
Sbjct: 209 KGVRELCDKHQALLVFDEVQSGMGRSGKLFAYMHYGVTPDILTTAKALGGGFPVSAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  +     +  + L  I +++
Sbjct: 269 EEIASVMQVGTHGTTYGGNPLACAVAEAALDVINTPEVLSGIELRHGLYVQALKKIGDKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPA--------LLAAKFRDECLLTAPSSDNVVRILPPLTI 371
             +F ++RG GLLIG +   +P         L AA  R   +L A    NV+R  P L +
Sbjct: 329 -GIFSDIRGMGLLIGAE--LTPQYQGKARDFLTAAAARGLMILNA--GPNVIRFAPSLVV 383

Query: 372 TAEEIHEGLERIE 384
             ++I EG+   E
Sbjct: 384 ETQDIDEGMALFE 396


>gi|168800067|ref|ZP_02825074.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC508]
 gi|189377545|gb|EDU95961.1| succinylornithine transaminase [Escherichia coli O157:H7 str.
           EC508]
 gi|209768562|gb|ACI82593.1| acetylornithine delta-aminotransferase [Escherichia coli]
 gi|326343667|gb|EGD67429.1| Succinylornithine transaminase [Escherichia coli O157:H7 str. 1125]
          Length = 406

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 172/391 (43%), Positives = 232/391 (59%), Gaps = 17/391 (4%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNESVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL----------KTVFSPALLAAKFRDE 351
                   E L  I +R+  +F EVRG GLLIG           K +F  A  A      
Sbjct: 309 KQRHDWFVERLNIINHRY-GLFNEVRGLGLLIGCVLNADYAGQAKQIFQEAAKAG----- 362

Query: 352 CLLTAPSSDNVVRILPPLTITAEEIHEGLER 382
            ++   +  NVVR  P L ++ EE+  GL+R
Sbjct: 363 -VMVLIAGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|134298152|ref|YP_001111648.1| acetylornithine aminotransferase [Desulfotomaculum reducens MI-1]
 gi|134050852|gb|ABO48823.1| acetylornithine aminotransferase apoenzyme [Desulfotomaculum
           reducens MI-1]
          Length = 396

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 160/385 (41%), Positives = 232/385 (60%), Gaps = 1/385 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
             ++ NTY +  +   KG+GAW++  +G  +LDF SGIAVN LGH+HPE+   +  Q + 
Sbjct: 11  QQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT 70

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           L H SN+Y    Q   A  L+ ++ AD+ FF NSGAE+ E AIK AR+Y       +K+ 
Sbjct: 71  LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYE 130

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+T   +FHGRTLAT++A G+ +Y  G  P  +GF    F DL++LKN I   T A+++E
Sbjct: 131 IITATNSFHGRTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLE 190

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGGV    + +L+ ++++C++   LLIFDEVQ G GRTGK   Y+   V+PDI+T+
Sbjct: 191 PVQGEGGVIPAAQAYLEGVKQLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITL 250

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA LA  +VA     G H ST+GGN LA       +  +   G LEN   
Sbjct: 251 AKALGGGFPIGAMLAKEQVAQAFQPGDHASTFGGNPLAATASLATMETLLQKGVLENAWQ 310

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVV 363
           + +     LT +    P +  EVRG GL+IGL+       + A   ++ LL   ++ NV+
Sbjct: 311 MGEYFKAELTKLAAEVP-LVKEVRGLGLMIGLELGIEGKDIVAHCLEQGLLINCTNGNVL 369

Query: 364 RILPPLTITAEEIHEGLERIERTAI 388
           R LPPL IT +EI + ++ ++R  +
Sbjct: 370 RFLPPLIITKDEIDQAVQILKRAML 394


>gi|23098533|ref|NP_691999.1| N-acetylornithine aminotransferase [Oceanobacillus iheyensis
           HTE831]
 gi|41016896|sp|Q8CUM9|ARGD_OCEIH RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|22776759|dbj|BAC13034.1| N-acetylornithine aminotransferase [Oceanobacillus iheyensis
           HTE831]
          Length = 399

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 163/384 (42%), Positives = 240/384 (62%), Gaps = 1/384 (0%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           +  TY++  I   KGKG++L+ +NG  +LD+ SGIA  +LGH    +   + +Q + LWH
Sbjct: 11  VMQTYNRFPITATKGKGSFLWDDNGEKYLDYTSGIATCNLGHVPDNVQHAISNQLKDLWH 70

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY    QE  A  L   +  D+VFF NSGAE+ E AIK A++Y    G  ++  I+T
Sbjct: 71  CSNLYHIPSQEKLAALLTEYSCLDQVFFCNSGAEANEAAIKIAKKYAKDKGYDDRTEIIT 130

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FE +FHGRT +T++A  + +  +GF P  EGF    F + +SL    +  T+A+L+E IQ
Sbjct: 131 FEQSFHGRTGSTMAATAQEKIHQGFTPLTEGFRYLPFNNKESLSEIDNGKTSAVLLEVIQ 190

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG+    +++L+QL  IC   D LL+ DE+QTG GRTG LFAY+   ++PD++T+AKG
Sbjct: 191 GEGGIHTAEKDWLKQLAAICKQADILLMIDEIQTGIGRTGSLFAYQPYGIEPDVITVAKG 250

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G GFPIGA LA   +AA  + G+HGST+GGN +A   G   L  I SDGFLEN     +
Sbjct: 251 LGSGFPIGAMLAKQHIAASFSPGTHGSTFGGNPVAAAAGIATLKEILSDGFLENCKEGQE 310

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
            LF  L +IK   P +  ++RG+G L+G++ +   +    K R++ +L  P+ + VVRIL
Sbjct: 311 ELFNQLKSIKEISP-LIKDIRGKGYLMGIEVMNQASAWIEKLREKQILVLPAGEKVVRIL 369

Query: 367 PPLTITAEEIHEGLERIERTAIKL 390
           PPLT T EE+   ++ ++  A++L
Sbjct: 370 PPLTTTKEELQICIQALKEVALEL 393


>gi|215486965|ref|YP_002329396.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli O127:H6 str. E2348/69]
 gi|312966948|ref|ZP_07781166.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli 2362-75]
 gi|254807545|sp|B7USC9|ASTC_ECO27 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|215265037|emb|CAS09424.1| succinylornithine transaminase AstC, PLP-dependent [Escherichia
           coli O127:H6 str. E2348/69]
 gi|312288412|gb|EFR16314.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli 2362-75]
          Length = 406

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 233/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DF+ GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFSGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATKECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|15605627|ref|NP_213001.1| N-acetylornithine aminotransferase [Aquifex aeolicus VF5]
 gi|6225065|sp|O66442|ARGD_AQUAE RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|2982764|gb|AAC06390.1| N-acetylornithine aminotransferase [Aquifex aeolicus VF5]
          Length = 376

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 167/372 (44%), Positives = 236/372 (63%), Gaps = 10/372 (2%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L N Y +  ++F +GKG +L+ E G  +LDF SGI VNSLGH++P+L   LK Q EKL 
Sbjct: 3   YLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLL 62

Query: 66  HVSNLYQSTQQEIFANHLIHSTFAD-RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           HVSNLY++  QE  A+ L+   + + +VFF NSG ESVE AIK AR+Y    GK NK++ 
Sbjct: 63  HVSNLYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKYWRDKGK-NKWKF 121

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           ++FE +FHGRT  ++SA G+ ++ +GF P + GF  AK  D+ S+   +  +TA I+IE 
Sbjct: 122 ISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLLDEETAGIIIEV 181

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQGEGGV +  E+FL +L++IC + D LLI DEVQTG GRTG+ +AY+  N+KPD++ +A
Sbjct: 182 IQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALA 241

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           KG+GGG PIGA LA  EVA     GSHGST+GGN LA   G  V++ ++    L +V  +
Sbjct: 242 KGLGGGVPIGAILAREEVAQSFTPGSHGSTFGGNPLACRAGTVVVDEVEK--LLPHVREV 299

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
                E L  +         +V+G+GL++GL+          K  ++ LL   ++  V+R
Sbjct: 300 GNYFKEKLKELGKG------KVKGRGLMLGLELERECKDYVLKALEKGLLINCTAGKVLR 353

Query: 365 ILPPLTITAEEI 376
            LPPL I  E I
Sbjct: 354 FLPPLIIQKEHI 365


>gi|74311933|ref|YP_310352.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Shigella sonnei Ss046]
 gi|193069005|ref|ZP_03049964.1| succinylornithine transaminase [Escherichia coli E110019]
 gi|118572872|sp|Q3Z295|ASTC_SHISS RecName: Full=Succinylornithine transaminase; Short=SOAT; AltName:
           Full=Succinylornithine aminotransferase
 gi|73855410|gb|AAZ88117.1| acetylornithine delta-aminotransferase [Shigella sonnei Ss046]
 gi|192957800|gb|EDV88244.1| succinylornithine transaminase [Escherichia coli E110019]
 gi|323166245|gb|EFZ52020.1| acetylornithine/succinyldiaminopimelate aminotransferase [Shigella
           sonnei 53G]
          Length = 406

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLTTEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|16329751|ref|NP_440479.1| acetylornithine aminotransferase [Synechocystis sp. PCC 6803]
 gi|2492853|sp|P73133|ARGD_SYNY3 RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|1652236|dbj|BAA17159.1| N-acetylornithine aminotransferase [Synechocystis sp. PCC 6803]
          Length = 429

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 171/396 (43%), Positives = 243/396 (61%), Gaps = 13/396 (3%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           + ++ NTY +  I   +G+G+ L+   G  +LDF +GIA  +LGH+HP LV  +  Q +K
Sbjct: 32  DTYVMNTYGRFPIAIARGQGSTLWDTEGKSYLDFVAGIATCTLGHAHPALVRAVSDQIQK 91

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY-HYMAGKTNKF 122
           L HVSNLY   +Q   A  ++  + ADRVFF NSGAE+ E AIK  R+Y H +     + 
Sbjct: 92  LHHVSNLYYIPEQGELAKWIVEHSCADRVFFCNSGAEANEAAIKLVRKYAHTVLDFLEQP 151

Query: 123 RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN------D 176
            I+T + +FHGRTLATI+A G+ +Y + F P + GFD   + D++SL+N++++       
Sbjct: 152 VILTAKASFHGRTLATITATGQPKYQQYFDPLVPGFDYVPYNDIRSLENKVADLDEGNSR 211

Query: 177 TAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANV 236
            AAI +EP+QGEGGVR     + +++R+ICD  D LL+FDEVQ G GRTGKL+ YE   V
Sbjct: 212 VAAIFLEPLQGEGGVRPGDLAYFKRVREICDQNDILLVFDEVQVGVGRTGKLWGYEHLGV 271

Query: 237 KPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDG 296
           +PDI T AKG+ GG PIGA +   +       G+H ST+GGN LA   G  VL  I+ D 
Sbjct: 272 EPDIFTSAKGLAGGVPIGAMMC-KKFCDVFEPGNHASTFGGNPLACAAGLAVLKTIEGDR 330

Query: 297 FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDEC 352
            L+NV    + L  GL  IKN++P +F EVRG GL+ GL+     +L + +      ++ 
Sbjct: 331 LLDNVQARGEQLRSGLAEIKNQYPTLFTEVRGWGLINGLEISAESSLTSVEIVKAAMEQG 390

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAI 388
           LL AP+   V+R +PPL +T  EI + +E I R AI
Sbjct: 391 LLLAPAGPKVLRFVPPLVVTEAEIAQAVE-ILRQAI 425


>gi|169632296|ref|YP_001706032.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Acinetobacter baumannii SDF]
 gi|169151088|emb|CAO99749.1| succinylornithine transaminase (also has acetylornitine
           transaminase activity, PLP-dependent) (carbon starvation
           protein C) [Acinetobacter baumannii]
          Length = 404

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 172/399 (43%), Positives = 239/399 (59%), Gaps = 15/399 (3%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ND++   +  ++    +G+G+ ++ +    ++DFA GIAVN+LGH+HP  V  L  Q+
Sbjct: 11  NFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYIDFAGGIAVNALGHAHPVAVNALTEQA 70

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           +KLWHV N Y +      A  L  +TFAD+VFF NSGAE+ E A+K AR+    +G   K
Sbjct: 71  KKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFCNSGAEANEAALKLARKVGLDSGVAGK 130

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F  AFHGRTL T+SAGG+ +Y + F P   G     + DL++ K  I+  T A++
Sbjct: 131 SGIVAFNNAFHGRTLFTVSAGGQPKYSQDFAPLPNGISHVAYNDLEAAKAVINEQTCAVI 190

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGGV     EFL+ LR++CD   ALLIFDEVQTG GRTG L+AY    V PD++
Sbjct: 191 VEPVQGEGGVIPADIEFLKGLRELCDQFGALLIFDEVQTGVGRTGALYAYMNYGVVPDVL 250

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T++ A   + G+HG+TYGGN LA  +   V   I +   LE V
Sbjct: 251 TTAKALGGGFPVGAMLTTDKFAPHFSVGTHGTTYGGNPLASAVAGAVFEFINTPEVLEGV 310

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------EC 352
            +  +   + L A+   +  +F E+RGQGLLIG  LK  +     A K +D       E 
Sbjct: 311 KHRHQYFLDALNALNAEY-QVFDEIRGQGLLIGCVLKAEY-----AGKAKDITTWAGEEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           LL   +  NVVR  P L I  ++I EG+ R++R   KL+
Sbjct: 365 LLALIAGPNVVRFTPSLIIPEQDIDEGIARLKRALAKLA 403


>gi|312962614|ref|ZP_07777104.1| acetylornithine and succinylornithine aminotransferase [Pseudomonas
           fluorescens WH6]
 gi|311283194|gb|EFQ61785.1| acetylornithine and succinylornithine aminotransferase [Pseudomonas
           fluorescens WH6]
          Length = 406

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 170/383 (44%), Positives = 230/383 (60%), Gaps = 17/383 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G G+ ++ + G   +DFA GIAVN LGH+HP LV  L  Q+ KLWHVSN++ +      
Sbjct: 30  RGAGSRVWDQAGRELIDFAGGIAVNVLGHAHPALVGALTEQANKLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI +TFA+RVFF NSGAE+ E A K ARR  +    T K+ I+    +FHGRTL T+
Sbjct: 90  AHKLIDATFAERVFFCNSGAEANEAAFKLARRVAFDRFGTEKYEIIAALNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPKI G     + DL +LK  +S+ T A+++EPIQGEGGV      +L
Sbjct: 150 NVGGQSKYSDGFGPKITGITHVPYNDLAALKAAVSDKTCAVVLEPIQGEGGVLPAELAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q  R++CD  DALL+FDEVQTG GR+G LFAY+   V PDI+T AK +GGGFPI A L T
Sbjct: 210 QGARELCDANDALLVFDEVQTGMGRSGHLFAYQHYGVTPDILTSAKSLGGGFPIAAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
             +A  +  G+HG+TYGGN LA  + E V+++I +   L  V          L  I  ++
Sbjct: 270 EALAKHLVVGTHGTTYGGNPLACAVAEAVIDVINTPEVLAGVKAKHDQFKARLEQIGKQY 329

Query: 320 PNMFLEVRGQGLLIGL----------KTVFSPALLAAKFRDECLLTAPSSDNVVRILPPL 369
             +F EVRG GLLIG           K VF+ A        E L+   +  +VVR  P L
Sbjct: 330 -GIFTEVRGMGLLIGCVLSDAFKGKAKDVFNAA------EKENLMILQAGPDVVRFAPSL 382

Query: 370 TITAEEIHEGLERIERTAIKLSH 392
            +   +I+EGL+R ER    L+ 
Sbjct: 383 VVEDADINEGLDRFERAVKTLTQ 405


>gi|297619371|ref|YP_003707476.1| acetylornithine and succinylornithine aminotransferase
           [Methanococcus voltae A3]
 gi|297378348|gb|ADI36503.1| acetylornithine and succinylornithine aminotransferase
           [Methanococcus voltae A3]
          Length = 408

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 162/379 (42%), Positives = 238/379 (62%), Gaps = 7/379 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           ++ + + +TY +  +   KGKG  ++  +G  +LDF  GIAVN++GH +PE+V  LKSQ 
Sbjct: 17  DERENIIHTYGRLPVVLTKGKGMKVYDIDGNEYLDFLGGIAVNNMGHCNPEIVEALKSQI 76

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           + L H+SN+Y +  Q      L+  +  D+ FF NSGAE+ E AIK ARRY         
Sbjct: 77  DNLMHISNIYYNVPQVELGKMLVELSGLDKSFFCNSGAEANEAAIKLARRYGKQISSKKG 136

Query: 122 F----RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
           F     +++ E +FHGRTL T++A  K +Y EGF P   GF  A F D+++LK+ +S  T
Sbjct: 137 FIKSGEVISMEHSFHGRTLTTVTATPKPKYQEGFEPLPTGFRYAPFNDIEALKSMVSEHT 196

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
           +AI+IEP+QGEGG+  V +E+L+++RKICD++D +LIFDEVQ G GRTGK+FA E   VK
Sbjct: 197 SAIIIEPVQGEGGIYPVDKEYLKEVRKICDELDIVLIFDEVQCGMGRTGKMFACEHYGVK 256

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PDI+T+AK +G GFPIGA +A  EVA     GSHG+T+GGN +A     K L ++++   
Sbjct: 257 PDIITLAKALGNGFPIGAIIAKEEVAEAFQPGSHGTTFGGNPMACATAIKTLELLKNQ-- 314

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAP 357
           L+  + I K     L  +KN++     EVRG GL++G+   F+ + +  +  ++  L   
Sbjct: 315 LDYTLEIGKYFKMRLEELKNKY-GFIKEVRGLGLMLGIDLSFNGSNIVPEMLEKGYLINC 373

Query: 358 SSDNVVRILPPLTITAEEI 376
           +SD V+R LPPL +  E I
Sbjct: 374 TSDTVLRFLPPLIVEREHI 392


>gi|146311352|ref|YP_001176426.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Enterobacter sp. 638]
 gi|145318228|gb|ABP60375.1| succinylornithine aminotransferase apoenzyme [Enterobacter sp. 638]
          Length = 406

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 236/385 (61%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HP L   L  Q+
Sbjct: 9   NFDEWMMPVYAPAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALRQALNDQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFA+++FF NSGAE+ E A+K AR+Y +      K
Sbjct: 69  AKFWHTGNGYTNEPALRLAKKLIDATFAEKIFFCNSGAEANEAALKLARKYAHDHFGAQK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y E F P       A + DLQS    I++DT A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSEDFAPLPPDIRHAIYNDLQSAAALINDDTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGGV    + FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPMQGEGGVVPADKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDVL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           + AK +GGGFPIGA L TN+ A+ M  G+HG+TYGGN LA  +  +VL+II +   L+ V
Sbjct: 249 STAKALGGGFPIGAILTTNKCASVMVVGTHGTTYGGNPLASAVAGQVLDIINTPEVLKGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA----LLAAKFRDECLLTAP 357
                   E L AI ++   MF E+RG GLLIG +     A    L++ +     ++   
Sbjct: 309 KQRHDWFVERLNAINSK-TGMFKEIRGLGLLIGCELTAEFAGKAKLISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGANVVRFAPALIVSEEEVATGLDR 392


>gi|158428351|pdb|2EH6|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From
           Aquifex Aeolicus Vf5
 gi|158428352|pdb|2EH6|B Chain B, Crystal Structure Of Acetylornithine Aminotransferase From
           Aquifex Aeolicus Vf5
          Length = 375

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 167/372 (44%), Positives = 236/372 (63%), Gaps = 10/372 (2%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L N Y +  ++F +GKG +L+ E G  +LDF SGI VNSLGH++P+L   LK Q EKL 
Sbjct: 2   YLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLL 61

Query: 66  HVSNLYQSTQQEIFANHLIHSTFAD-RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
           HVSNLY++  QE  A+ L+   + + +VFF NSG ESVE AIK AR+Y    GK NK++ 
Sbjct: 62  HVSNLYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKYWRDKGK-NKWKF 120

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           ++FE +FHGRT  ++SA G+ ++ +GF P + GF  AK  D+ S+   +  +TA I+IE 
Sbjct: 121 ISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLLDEETAGIIIEV 180

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQGEGGV +  E+FL +L++IC + D LLI DEVQTG GRTG+ +AY+  N+KPD++ +A
Sbjct: 181 IQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALA 240

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           KG+GGG PIGA LA  EVA     GSHGST+GGN LA   G  V++ ++    L +V  +
Sbjct: 241 KGLGGGVPIGAILAREEVAQSFTPGSHGSTFGGNPLACRAGTVVVDEVEK--LLPHVREV 298

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
                E L  +         +V+G+GL++GL+          K  ++ LL   ++  V+R
Sbjct: 299 GNYFKEKLKELGKG------KVKGRGLMLGLELERECKDYVLKALEKGLLINCTAGKVLR 352

Query: 365 ILPPLTITAEEI 376
            LPPL I  E I
Sbjct: 353 FLPPLIIQKEHI 364


>gi|332163292|ref|YP_004299869.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|325667522|gb|ADZ44166.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
          Length = 405

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 165/382 (43%), Positives = 228/382 (59%), Gaps = 19/382 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DFA GIAV +LGH HP LVA L  Q E LWH SN++ +      
Sbjct: 29  KGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVAALHQQGEMLWHTSNVFTNEPALRL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFA+RVFF NSG E+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 89  AQKLIAATFAERVFFANSGGEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 149 SVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITAATPEFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD   ALL+FDEVQ+G GR+GKLF Y    V PDI+T AK +GGGFP+ A L T
Sbjct: 209 QGVRALCDQNKALLVFDEVQSGMGRSGKLFTYMHYGVTPDILTTAKALGGGFPVSAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  +     +  + L  I N++
Sbjct: 269 EEIASVMAVGTHGTTYGGNPLACAVAEAALDVINTPEVLNGIEQRHSLFVQALRDINNKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF--RDECLLTAPSSD---------NVVRILPP 368
            ++F ++RG GLLIG       A LA ++  R    LTA +++         +V+R+ P 
Sbjct: 329 -HVFSDIRGMGLLIG-------AELAPQYHGRAREFLTAAAANGLMILNAGPDVLRLAPS 380

Query: 369 LTITAEEIHEGLERIERTAIKL 390
           L I   +I  G+ R+E     L
Sbjct: 381 LVIEQADIQLGMARLEHAIASL 402


>gi|169334506|ref|ZP_02861699.1| hypothetical protein ANASTE_00909 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259223|gb|EDS73189.1| hypothetical protein ANASTE_00909 [Anaerofustis stercorihominis DSM
           17244]
          Length = 393

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 156/381 (40%), Positives = 242/381 (63%), Gaps = 2/381 (0%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ L NTY +  + F++G+G +L+ + G  +LDF +GIAVN+LG++   L   L  Q +K
Sbjct: 9   SEVLMNTYGRIPVVFDRGEGVYLYDDKGNKYLDFVAGIAVNALGYNDEGLNNALSEQMKK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           L+HVSNLY +      A  L+ ++  DRVFF NSGAE+ E A+K +R Y Y   K  + +
Sbjct: 69  LYHVSNLYYTKANVEAAKLLVDNSKLDRVFFCNSGAEATEAALKLSRLYAYKF-KNKETK 127

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+  + +FHGRT  +I+A G+L+Y +G GP +       F D ++L+ +  +    I++E
Sbjct: 128 IIAMKNSFHGRTFGSITATGQLKYQKGLGPILPDVTHVDFMDYEALEKEARSGACGIILE 187

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+R   +EFLQ++RK+CD++D LLIFDEVQ G GRTG LFAYE+ +V PD++ +
Sbjct: 188 PVQGEGGIRPATKEFLQKVRKLCDELDILLIFDEVQCGIGRTGYLFAYEYFDVVPDVVAM 247

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFPIGA L + + A     G+H ST+GGN LA    + V+N I ++G L+NV  
Sbjct: 248 AKGLGGGFPIGAILVSEDKAKGFEPGNHASTFGGNALASTASKYVVNKILNEGILDNVKE 307

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVV 363
             + L   L ++K ++P    +VRG GL++G++  F  A +      + LL   S  N++
Sbjct: 308 QGEYLKSKLESLKEKYP-FITDVRGVGLMLGMELEFPVADIINSALSKGLLLLNSGVNII 366

Query: 364 RILPPLTITAEEIHEGLERIE 384
           R +PPL ++  +I   +E ++
Sbjct: 367 RFVPPLIVSKGDIDNCIEILD 387


>gi|157146020|ref|YP_001453339.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Citrobacter koseri ATCC BAA-895]
 gi|254807543|sp|A8AHE0|ASTC_CITK8 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|157083225|gb|ABV12903.1| hypothetical protein CKO_01774 [Citrobacter koseri ATCC BAA-895]
          Length = 406

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 235/385 (61%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HP L   L  Q+
Sbjct: 9   NFDEWMMPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFA+RVFF NSGAE+ E A+K AR+Y +    T+K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKMLIDATFAERVFFCNSGAEANEAALKLARKYAHDRFGTHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + DL +    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAVYNDLNAASELIDDTTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGGV    + FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPMQGEGGVLPATKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFPIGA LAT + A+ M  G+HG+TYGGN LA  +  K+L I+ +   L  V
Sbjct: 249 TTAKALGGGFPIGALLATEKCASVMTVGTHGTTYGGNPLASAVAGKLLEIVNTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFS--PALLAAKFRDECLLTAP 357
                   E L AI  RF  +F E+RG GLLIG  L+  F+    L++ +     ++   
Sbjct: 309 KQRHDGFVERLNAINERF-GLFSEIRGLGLLIGCVLEAEFAGKAKLISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGANVVRFAPALNVSKEEVATGLDR 392


>gi|170722933|ref|YP_001750621.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas putida W619]
 gi|169760936|gb|ACA74252.1| succinylornithine transaminase family [Pseudomonas putida W619]
          Length = 406

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 171/380 (45%), Positives = 235/380 (61%), Gaps = 11/380 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAVN+LGH HP LV  L  Q+  LWHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANTLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ L+ +TFADR FF NSGAES E A K ARR  +     +K  I++   +FHGRTL T+
Sbjct: 90  AHKLVDATFADRAFFCNSGAESNEAAFKLARRVAHDRFGPDKHEIISAVNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPKI G     + DL++LK QIS+ T A++IEPIQGE GV    + +L
Sbjct: 150 SVGGQPKYSDGFGPKITGISHVPYNDLEALKAQISDKTCAVVIEPIQGESGVVPADKAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALLIFDEVQTG GRTG L+AY+   V PDI+T AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLIFDEVQTGVGRTGSLYAYQHYGVTPDILTSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           +E+A  +  G+HG+TYGGN L   +   VL++I +   L  +    +     L  I  + 
Sbjct: 270 SELAKHLAVGTHGTTYGGNPLGCAVACAVLDVINTPETLAGIKAKHERFKVRLEKIGQQ- 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
             +F +VRG GLLIG   V + A    K +D       E ++   +  +VVR  P L I 
Sbjct: 329 AGLFSQVRGVGLLIG--CVLTEA-WQGKAKDILNAAEKEGVMVLQAGPDVVRFAPSLVIE 385

Query: 373 AEEIHEGLERIERTAIKLSH 392
             +I EGL+R ER   KL+ 
Sbjct: 386 DADIDEGLDRFERAVAKLTQ 405


>gi|91227430|ref|ZP_01261794.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Vibrio alginolyticus 12G01]
 gi|269964495|ref|ZP_06178736.1| Acetylornithine aminotransferasee [Vibrio alginolyticus 40B]
 gi|91188580|gb|EAS74871.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Vibrio alginolyticus 12G01]
 gi|269830833|gb|EEZ85051.1| Acetylornithine aminotransferasee [Vibrio alginolyticus 40B]
          Length = 403

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 166/393 (42%), Positives = 239/393 (60%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y+  ++   KG+G+ ++ + G  ++DFA GIAV+ LGH HP +V  L  Q+ K
Sbjct: 13  DEVMVPCYNPMEMIPVKGEGSRVWDQEGNEYIDFAGGIAVSCLGHCHPVMVNALTEQANK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   +FA+RVFF NSGAE+ E A+K ARRY      T K  
Sbjct: 73  LWHLSNVMTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVHGTEKSE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+  FHGRT  T++ GG+  Y +GFGPK        + D+++L+  +S+ T A+++E
Sbjct: 133 IIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHMSDRTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF Q +R++CD  +ALLIFDEVQTG GRTG  +AY+   + PDI++ 
Sbjct: 193 PLQGEGGIVPPTPEFAQAVRELCDKHNALLIFDEVQTGNGRTGNFYAYQGLGITPDILST 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++A  M  G+HGSTYGGN LA  + E V+N +     L  V+ 
Sbjct: 253 AKSLGGGFPIGAMLTTAKLAEHMKVGTHGSTYGGNPLACAVAEAVVNEVTKPEVLAGVLE 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
              +  EGL  I  ++ N+F EVRGQGLL+G       +      L+AA  +   +L A 
Sbjct: 313 REAMFREGLEKINAKY-NIFSEVRGQGLLLGAALNEEWQGRARDVLVAAGKQGLMVLVAG 371

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L IT +EI EGL ++++    L
Sbjct: 372 A--NVVRFTPSLVITQQEIEEGLAKLDKAIATL 402


>gi|253773298|ref|YP_003036129.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254161807|ref|YP_003044915.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli B str. REL606]
 gi|297520262|ref|ZP_06938648.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli OP50]
 gi|242377469|emb|CAQ32222.1| succinylornithine transaminase / acetylornithine transaminase,
           catabolic [Escherichia coli BL21(DE3)]
 gi|253324342|gb|ACT28944.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253973708|gb|ACT39379.1| succinylornithine transaminase, PLP-dependent [Escherichia coli B
           str. REL606]
 gi|253977902|gb|ACT43572.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           BL21(DE3)]
          Length = 406

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|332532534|ref|ZP_08408411.1| acetylornithine aminotransferase / N-succinyl-L,L-diaminopimelate
           aminotransferase / succinylornithine transaminase
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037955|gb|EGI74403.1| acetylornithine aminotransferase / N-succinyl-L,L-diaminopimelate
           aminotransferase / succinylornithine transaminase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 401

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 170/393 (43%), Positives = 237/393 (60%), Gaps = 19/393 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ND +   Y+ S I   +G+G+ ++ +N   F+DFA GIAVN LGH HP LV  LK Q EK
Sbjct: 9   NDVMVPNYNPSAIIPVRGEGSRVWDQNNNEFIDFAGGIAVNCLGHCHPALVKALKEQGEK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           +WH+SN+  +      A  ++ +TFAD+V+F NSGAE+ E A+K ARRY        K +
Sbjct: 69  IWHLSNVMTNEPALRLAQKMVEATFADKVYFANSGAEANEAALKLARRYALDVYSAEKTQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK        F D+ + +  IS+ T A+++E
Sbjct: 129 IIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPADIVHCDFNDIAAFEALISDKTCAVMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+    +EF +++R++C   +ALLIFDEVQTG GRTG L+AYE   V PDI+T 
Sbjct: 189 PLQGEGGIISPTDEFAKKVRELCTKHNALLIFDEVQTGVGRTGDLYAYEGLGVVPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA +    +A  +  G+HGSTYGGN LA  + E   + + +   L  V  
Sbjct: 249 AKALGGGFPIGAMITRTPIAEHLKIGTHGSTYGGNALACAVAEAAFDTVNTPDVLNGVKK 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF--RDECLLTAPSSD- 360
             ++  +GL AI  ++ N+F EVRG+GLLIG       A+L  KF  R    L A +++ 
Sbjct: 309 REQLFRDGLNAINEKY-NVFSEVRGKGLLIG-------AVLNDKFEGRARDFLVASANNG 360

Query: 361 --------NVVRILPPLTITAEEIHEGLERIER 385
                   NV+R  P L I  E+I EGL R E+
Sbjct: 361 LMNLVAGMNVIRFTPSLIIPFEDIKEGLARFEK 393


>gi|50122985|ref|YP_052152.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pectobacterium atrosepticum SCRI1043]
 gi|49613511|emb|CAG76962.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Pectobacterium atrosepticum SCRI1043]
          Length = 408

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 162/375 (43%), Positives = 227/375 (60%), Gaps = 5/375 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ ++G  ++DF+ GIAV +LGH HP LV  L+ Q E LWH SN++ +      
Sbjct: 30  KGKGSRVWDQDGREYIDFSGGIAVTALGHCHPALVNALRQQGETLWHTSNIFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI +TFADRVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 90  ASKLIDATFADRVFFVNSGAEANEAAFKLARHYAVKRHSPYKTKIIAFYNAFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 150 SVGGQPKYADGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITPATPEFL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD   ALL+FDEVQ+G GRTGKLF+Y    + PDI+T AK +GGGFPI A L T
Sbjct: 210 QGVRDLCDQHKALLVFDEVQSGMGRTGKLFSYMHYGITPDILTTAKALGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G HG+TYGGN LA  + E  L+II +   L  V +        L  I  ++
Sbjct: 270 EEIASVMTVGVHGTTYGGNPLACAVAEAALDIINTPEVLSGVADRHDRFVSELDKINQQY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNVVRILPPLTITAEE 375
             +F +VRG GLL+G +        A +F      + L+   +  NV+R +P L I  ++
Sbjct: 330 -GVFDQVRGMGLLLGAELKPQWHGRAGEFLAAAAAQGLMVLMAGPNVIRFVPSLIIDEDD 388

Query: 376 IHEGLERIERTAIKL 390
           I +G+E+  +   ++
Sbjct: 389 IAQGMEKFAKAVAQV 403


>gi|332532773|ref|ZP_08408647.1| acetylornithine aminotransferase / N-succinyl-L,L-diaminopimelate
           aminotransferase / succinylornithine transaminase
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037800|gb|EGI74250.1| acetylornithine aminotransferase / N-succinyl-L,L-diaminopimelate
           aminotransferase / succinylornithine transaminase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 401

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 166/394 (42%), Positives = 236/394 (59%), Gaps = 10/394 (2%)

Query: 1   MNKNDFLFN-----TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVA 55
           M  N  LF+      Y  S +   +G+G+ ++ + G  F+DFA GIAVN LGH HP LV 
Sbjct: 1   MTVNRELFDHVMVPNYAPSSVIPVRGEGSRVWDQQGREFIDFAGGIAVNCLGHCHPALVG 60

Query: 56  ILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYM 115
            LK Q EK+WH+SN+  +      A  ++ +TFA++V+F NSGAE+ E A+K ARR+   
Sbjct: 61  ALKEQGEKIWHLSNVMTNEPALRLAKKMVDATFAEKVYFANSGAEANEAALKLARRFALD 120

Query: 116 AGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN 175
                K +I+ F   FHGRT  T++ GG+  Y +GFGPK        + DL + +  IS+
Sbjct: 121 KFGAEKSQIIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGDIVHCDYNDLAAFEALISD 180

Query: 176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN 235
            T A+++EP+QGEGG+    +EF Q +R +C   +ALLIFDEVQTG GRTG L+AY+  N
Sbjct: 181 KTCAVMMEPLQGEGGIVSPTDEFAQGVRDLCTKHNALLIFDEVQTGVGRTGDLYAYQGLN 240

Query: 236 VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD 295
           V PDI+T AK +GGGFPIGA + T E+A  +  G+HGSTYGGN LA  + E   + + + 
Sbjct: 241 VVPDILTSAKALGGGFPIGAMITTTEIAQHLKVGTHGSTYGGNPLACAVAEAAFDTVNTP 300

Query: 296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDE 351
             L  V   A +  E L+A+  ++ N+F E+RGQGLLIG          A +F     ++
Sbjct: 301 EVLAGVKEKAALFNELLSAVNEKY-NVFSEIRGQGLLIGAVVNEQYKGRAKEFLVAGTEQ 359

Query: 352 CLLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
            L++  +  +VVR  P L I   +I EG+ R E+
Sbjct: 360 GLMSLVAGADVVRFTPSLVIPEADIREGMARFEK 393


>gi|16129702|ref|NP_416262.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           str. K-12 substr. MG1655]
 gi|89108587|ref|AP_002367.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           str. K-12 substr. W3110]
 gi|157158020|ref|YP_001463045.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli E24377A]
 gi|170019905|ref|YP_001724859.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli ATCC 8739]
 gi|170081405|ref|YP_001730725.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           str. K-12 substr. DH10B]
 gi|193065797|ref|ZP_03046860.1| succinylornithine transaminase [Escherichia coli E22]
 gi|194438530|ref|ZP_03070619.1| succinylornithine transaminase [Escherichia coli 101-1]
 gi|209919109|ref|YP_002293193.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli SE11]
 gi|218554314|ref|YP_002387227.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli IAI1]
 gi|238900962|ref|YP_002926758.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           BW2952]
 gi|256018059|ref|ZP_05431924.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Shigella sp. D9]
 gi|256022588|ref|ZP_05436453.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia sp. 4_1_40B]
 gi|260844098|ref|YP_003221876.1| succinylornithine transaminase AstC, PLP-dependent [Escherichia
           coli O103:H2 str. 12009]
 gi|260868273|ref|YP_003234675.1| succinylornithine transaminase AstC, PLP-dependent [Escherichia
           coli O111:H- str. 11128]
 gi|293446120|ref|ZP_06662542.1| succinylornithine aminotransferase [Escherichia coli B088]
 gi|300818389|ref|ZP_07098599.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 107-1]
 gi|300823195|ref|ZP_07103328.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 119-7]
 gi|300904606|ref|ZP_07122442.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 84-1]
 gi|300917687|ref|ZP_07134336.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 115-1]
 gi|300924795|ref|ZP_07140735.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 182-1]
 gi|300930772|ref|ZP_07146145.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 187-1]
 gi|300951352|ref|ZP_07165194.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 116-1]
 gi|300958641|ref|ZP_07170765.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 175-1]
 gi|301303960|ref|ZP_07210078.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 124-1]
 gi|301327483|ref|ZP_07220716.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 78-1]
 gi|301647943|ref|ZP_07247718.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 146-1]
 gi|307138407|ref|ZP_07497763.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli H736]
 gi|307310680|ref|ZP_07590326.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli W]
 gi|331642349|ref|ZP_08343484.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           (Carbon starvation protein C) [Escherichia coli H736]
 gi|331668436|ref|ZP_08369284.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           (Carbon starvation protein C) [Escherichia coli TA271]
 gi|331677627|ref|ZP_08378302.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           (Carbon starvation protein C) [Escherichia coli H591]
 gi|332279099|ref|ZP_08391512.1| succinylornithine transaminase [Shigella sp. D9]
 gi|2492855|sp|P77581|ASTC_ECOLI RecName: Full=Succinylornithine transaminase; Short=SOAT; AltName:
           Full=Carbon starvation protein C; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807544|sp|A7ZML6|ASTC_ECO24 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807551|sp|B7M1G0|ASTC_ECO8A RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807552|sp|B1XGK9|ASTC_ECODH RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807555|sp|B1IPI2|ASTC_ECOLC RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807557|sp|B6IBG8|ASTC_ECOSE RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|259585381|sp|C4ZZA4|ASTC_ECOBW RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|1742857|dbj|BAA15539.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           str. K12 substr. W3110]
 gi|1788044|gb|AAC74818.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           str. K-12 substr. MG1655]
 gi|157080050|gb|ABV19758.1| succinylornithine transaminase [Escherichia coli E24377A]
 gi|169754833|gb|ACA77532.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli ATCC 8739]
 gi|169889240|gb|ACB02947.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           str. K-12 substr. DH10B]
 gi|192926569|gb|EDV81200.1| succinylornithine transaminase [Escherichia coli E22]
 gi|194422540|gb|EDX38538.1| succinylornithine transaminase [Escherichia coli 101-1]
 gi|209912368|dbj|BAG77442.1| succinylornithine transaminase [Escherichia coli SE11]
 gi|218361082|emb|CAQ98665.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           IAI1]
 gi|238863596|gb|ACR65594.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           BW2952]
 gi|257759245|dbj|BAI30742.1| succinylornithine transaminase AstC, PLP-dependent [Escherichia
           coli O103:H2 str. 12009]
 gi|257764629|dbj|BAI36124.1| succinylornithine transaminase AstC, PLP-dependent [Escherichia
           coli O111:H- str. 11128]
 gi|260449130|gb|ACX39552.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli DH1]
 gi|291322950|gb|EFE62378.1| succinylornithine aminotransferase [Escherichia coli B088]
 gi|300314692|gb|EFJ64476.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 175-1]
 gi|300403437|gb|EFJ86975.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 84-1]
 gi|300415088|gb|EFJ98398.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 115-1]
 gi|300419002|gb|EFK02313.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 182-1]
 gi|300449342|gb|EFK12962.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 116-1]
 gi|300461405|gb|EFK24898.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 187-1]
 gi|300524349|gb|EFK45418.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 119-7]
 gi|300529029|gb|EFK50091.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 107-1]
 gi|300840757|gb|EFK68517.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 124-1]
 gi|300845914|gb|EFK73674.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 78-1]
 gi|301073914|gb|EFK88720.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 146-1]
 gi|306908858|gb|EFN39354.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli W]
 gi|315061051|gb|ADT75378.1| succinylornithine transaminase, PLP-dependent [Escherichia coli W]
 gi|315136389|dbj|BAJ43548.1| bifunctional succinylornithinetransaminase/acetylornithine
           transaminase [Escherichia coli DH1]
 gi|315257445|gb|EFU37413.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 85-1]
 gi|320197932|gb|EFW72540.1| Succinylornithine transaminase [Escherichia coli EC4100B]
 gi|323180527|gb|EFZ66072.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli 1180]
 gi|323186235|gb|EFZ71587.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli 1357]
 gi|323378376|gb|ADX50644.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli KO11]
 gi|323940587|gb|EGB36778.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli E482]
 gi|323948125|gb|EGB44115.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli H120]
 gi|323962058|gb|EGB57655.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli H489]
 gi|323974009|gb|EGB69180.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli TA007]
 gi|324016421|gb|EGB85640.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 117-3]
 gi|331039147|gb|EGI11367.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           (Carbon starvation protein C) [Escherichia coli H736]
 gi|331063630|gb|EGI35541.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           (Carbon starvation protein C) [Escherichia coli TA271]
 gi|331074087|gb|EGI45407.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           (Carbon starvation protein C) [Escherichia coli H591]
 gi|332101451|gb|EGJ04797.1| succinylornithine transaminase [Shigella sp. D9]
          Length = 406

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|315125318|ref|YP_004067321.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas sp. SM9913]
 gi|315013831|gb|ADT67169.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas sp. SM9913]
          Length = 401

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 237/394 (60%), Gaps = 10/394 (2%)

Query: 1   MNKNDFLFN-----TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVA 55
           M  N  LF+      Y  S +   +G+G+ ++ + G  F+DFA GIAVN LGH HP LV 
Sbjct: 1   MTVNRELFDHVMVPNYAPSSVIPVRGEGSRVWDQQGREFIDFAGGIAVNCLGHCHPALVG 60

Query: 56  ILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYM 115
            LK Q EK+WH+SN+  +      A  ++ +TFA++V+F NSGAE+ E A+K ARR+   
Sbjct: 61  ALKEQGEKIWHLSNVMTNEPALRLAKKMVDATFAEKVYFANSGAEANEAALKLARRFALD 120

Query: 116 AGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN 175
                K +I+ F   FHGRT  T++ GG+  Y +GFGPK        + DL + +  IS+
Sbjct: 121 KFGAEKSQIIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGDIVHCDYNDLAAFEALISD 180

Query: 176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN 235
           +T A+++EPIQGEGG+    +EF Q +R +C   +ALLIFDEVQ+G GRTG+L+AY+  N
Sbjct: 181 NTCAVMMEPIQGEGGIISPTDEFAQGVRDLCTKHNALLIFDEVQSGVGRTGELYAYQGLN 240

Query: 236 VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD 295
           V PDI+T AK +GGGFPIGA L T E+A  +  G+HGSTYGGN LA  + E   + + + 
Sbjct: 241 VVPDILTSAKALGGGFPIGAMLTTTEIAQHLKVGTHGSTYGGNPLACAVAEAAFDTVNNP 300

Query: 296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDE 351
             L  V   + +  E L AI +++ N+F E+RGQGLLIG          A +F     + 
Sbjct: 301 EVLAGVKAKSALFTELLNAINDKY-NVFSEIRGQGLLIGAVVNEQYKGRAKEFLVAGTEH 359

Query: 352 CLLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
            L++  +  +VVR  P L I   +I EG+ R E+
Sbjct: 360 GLMSLVAGADVVRFTPSLVIPEADIREGMARFEK 393


>gi|191169030|ref|ZP_03030794.1| succinylornithine transaminase [Escherichia coli B7A]
 gi|190900912|gb|EDV60697.1| succinylornithine transaminase [Escherichia coli B7A]
          Length = 406

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIGATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|325497094|gb|EGC94953.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia fergusonii ECD227]
          Length = 406

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMLPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + DL S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDLNSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT   A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEGCASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R   +F E+RG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRC-GLFSEIRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|325526835|gb|EGD04326.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Burkholderia sp. TJI49]
          Length = 410

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 228/378 (60%), Gaps = 19/378 (5%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++ +G+ ++   G  ++DFA GIAV SLGH HPEL+ +L  QS KLWH+ N Y +     
Sbjct: 27  DRAEGSRVWDTAGREYIDFACGIAVTSLGHGHPELLKVLDEQSRKLWHIGNGYTNEPVLR 86

Query: 79  FANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLAT 138
            A  L   TFADR FF NSGAE+ E A+K ARR  +     +KF I++F  +FHGRT  T
Sbjct: 87  LAKRLESLTFADRAFFANSGAEANEAALKLARRVAFDRHGADKFEIISFVQSFHGRTFFT 146

Query: 139 ISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEF 198
           +S GG+ +Y EGFGP   G     + D+++ K  I   T A+++EP+QGEGGV      F
Sbjct: 147 VSVGGQPKYSEGFGPVPAGIKHLPYNDIEAAKAAIGPQTCAVIVEPVQGEGGVIPADPAF 206

Query: 199 LQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLA 258
           L+ LR+ CD  DALLIFDEVQTG GRTG+ +AY    V PDI+T AK +G GFPIGA L 
Sbjct: 207 LKALREACDANDALLIFDEVQTGVGRTGQFYAYMDTGVTPDILTTAKALGNGFPIGAMLT 266

Query: 259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR 318
           TNE+AA    G HG+TYGGN LA  + +KV+ +I +   LE V   +  L   L  I  R
Sbjct: 267 TNELAAHFKVGVHGTTYGGNPLASAIADKVVELIGNPELLEGVRERSVRLKGALERINAR 326

Query: 319 FPNMFLEVRGQGLLIGLKTVFSPALLAAKF--RDECLLTAPSS---------DNVVRILP 367
           F  +F EVRG+GLL+G       A L A F  R +  +TA +           NV+R +P
Sbjct: 327 F-GIFKEVRGKGLLVG-------AELTAAFDGRAKDFVTAAAEHGVIMLIAGPNVLRFVP 378

Query: 368 PLTITAEEIHEGLERIER 385
            L I  +E+ EG++R E+
Sbjct: 379 SLVIPFDELDEGMKRFEK 396


>gi|1916298|gb|AAB51148.1| N-(alpha)-acetylornithine-(delta)-aminotransferase [Escherichia
           coli]
          Length = 406

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKRGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|323968516|gb|EGB63922.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli M863]
 gi|327252865|gb|EGE64519.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli STEC_7v]
          Length = 406

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRFGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ+LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQELRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVMPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLVTEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I  R   +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINYRC-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|238792523|ref|ZP_04636156.1| Succinylornithine transaminase [Yersinia intermedia ATCC 29909]
 gi|238728158|gb|EEQ19679.1| Succinylornithine transaminase [Yersinia intermedia ATCC 29909]
          Length = 434

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 173/395 (43%), Positives = 239/395 (60%), Gaps = 21/395 (5%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  +D    +G+GA L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 33  DEWIVPTYAPADFIIVRGEGATLWDQQGKSYIDFAGGIAVNALGHGHPAVKASLIEQADK 92

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHY--------M 115
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y          +
Sbjct: 93  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALNNFGNKPGL 152

Query: 116 AGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN 175
           AG+ N+  IV F  AFHGRTL T+SAGG+ +Y + F P   G     F D+ S +  I++
Sbjct: 153 AGEKNQ--IVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDIASAEELIND 210

Query: 176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN 235
            T A+++EPIQGEGGV     EFL  LR +CD  +ALLIFDEVQTG GRTG+L+AY    
Sbjct: 211 QTCAVIVEPIQGEGGVLPADSEFLHGLRALCDRHNALLIFDEVQTGVGRTGELYAYMHYG 270

Query: 236 VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD 295
           V PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I + 
Sbjct: 271 VIPDVLTSAKALGGGFPIAAMLTTTKYASALNVGSHGTTYGGNPLACAVAGTVLSLINTP 330

Query: 296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL-------KTVFSPALLAAKF 348
             L  V    +    GL  I  R+  +F E+RG+GLLIG        +        AA++
Sbjct: 331 ELLAGVKERHQWFLAGLAEINARY-KIFSEIRGRGLLIGCVLHKDYDEKAKEIVQAAAQY 389

Query: 349 RDECLLTAPSSDNVVRILPPLTITAEEIHEGLERI 383
               L+  P   NVVR  P L I+ ++I EGL R+
Sbjct: 390 GLIALIAGP---NVVRFAPSLIISQQDIKEGLARL 421


>gi|261823263|ref|YP_003261369.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pectobacterium wasabiae WPP163]
 gi|261607276|gb|ACX89762.1| succinylornithine transaminase family [Pectobacterium wasabiae
           WPP163]
          Length = 408

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 165/368 (44%), Positives = 228/368 (61%), Gaps = 7/368 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ ++G  ++DF+ GIAV +LGH HP LV  L+ Q EKLWH SN++ +      
Sbjct: 30  KGKGSRVWDQDGREYIDFSGGIAVTALGHCHPALVNALQQQGEKLWHTSNIFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI +TFADRVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 90  ASKLIDATFADRVFFVNSGAEANEAAFKLARHYAVKRHSPYKTKIIAFYNAFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 150 SVGGQPKYADGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITPATPEFL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R++CD   ALL+FDEVQ+G GRTGKLF+Y    + PDI+T AK +GGGFPI A L T
Sbjct: 210 QGVRELCDQHKALLVFDEVQSGMGRTGKLFSYMHYGITPDILTTAKALGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G HG+TYGGN LA  + E  L+II +   L  V +        L  I  ++
Sbjct: 270 EEIASAMTVGVHGTTYGGNPLACAVAEAALDIINTPEVLSGVADRHDRFVSELEKINQQY 329

Query: 320 PNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRDECLLTAPSSDNVVRILPPLTITAE 374
             +F +VRG GLL+G  LK  +   +   LAA    + L+   +  NV+R +P L I  +
Sbjct: 330 -GVFDQVRGMGLLLGAELKPQWHGRAGEFLAAA-TAQGLMVLMAGPNVIRFVPSLIIDED 387

Query: 375 EIHEGLER 382
           +I +G+ +
Sbjct: 388 DIAQGMAK 395


>gi|148546674|ref|YP_001266776.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas putida F1]
 gi|148510732|gb|ABQ77592.1| acetylornithine aminotransferase / succinylornithine
           aminotransferase [Pseudomonas putida F1]
          Length = 406

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 233/379 (61%), Gaps = 11/379 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAVN+LGH HP LV  L  Q+  LWHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANTLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ L+ +TFADR FF NSGAES E A K ARR  +      K  I+    +FHGRTL T+
Sbjct: 90  AHKLVDATFADRAFFCNSGAESNEAAFKLARRVAHDRFGPQKHEIIATVNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPKI G     + DL++LK QIS+ T A++IEPIQGE GV    + +L
Sbjct: 150 SVGGQPKYSDGFGPKITGISHVPYNDLEALKAQISDKTCAVVIEPIQGESGVVPADKAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALLIFDEVQTG GRTG L+AY+   V PDI+T AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLIFDEVQTGVGRTGSLYAYQHYGVTPDILTSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HG+TYGGN L   +   VL+++ +   L  +    +     L  I  ++
Sbjct: 270 TELAKHLAVGTHGTTYGGNPLGCAVACAVLDVVNTPETLAGIKAKHERFKTRLEQIGQQY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
            N+F +VRG GLL+G   V + A    K +D       E ++   +  +VVR  P L + 
Sbjct: 330 -NLFSQVRGVGLLLG--CVLTEA-WQGKAKDVLNAAEKEGVMVLQAGPDVVRFAPSLVVE 385

Query: 373 AEEIHEGLERIERTAIKLS 391
             +I EGL+R ER    L+
Sbjct: 386 DADIDEGLDRFERAVATLT 404


>gi|318605456|emb|CBY26954.1| succinylornithine transaminase [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 438

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/395 (43%), Positives = 239/395 (60%), Gaps = 21/395 (5%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  +D    +G+GA L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 37  DEWIVPTYAPADFIVVRGEGATLWDQQGKSYIDFAGGIAVNALGHGHPAVKAALIEQADK 96

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY------HYMAG 117
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y      +    
Sbjct: 97  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKPGQ 156

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
           +  K +IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S +  I++ T
Sbjct: 157 QGEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDLASAEALITDQT 216

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV     EFL  LR +CD  +A+LIFDEVQTG GRTG+L+AY    V 
Sbjct: 217 CAVIVEPIQGEGGVLPADSEFLHGLRALCDRHNAVLIFDEVQTGVGRTGELYAYMHYGVT 276

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I +   
Sbjct: 277 PDVLTSAKALGGGFPIAAMLTTTKYASALNVGSHGTTYGGNPLACAVAGTVLSLINTPAV 336

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD----- 350
           L  V    +   EGL  I  R+  +F E+RG+GLLIG  L + +     A K +D     
Sbjct: 337 LSGVKERHQWFLEGLADINARY-KVFAEIRGRGLLIGCVLNSDY-----AGKSKDIIQAA 390

Query: 351 --ECLLTAPSSDNVVRILPPLTITAEEIHEGLERI 383
               L+   +  +VVR  P L I+  +I EGL R+
Sbjct: 391 AQHGLIALIAGPDVVRFAPSLIISQHDIKEGLTRL 425


>gi|332161475|ref|YP_004298052.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325665705|gb|ADZ42349.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 414

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/395 (43%), Positives = 239/395 (60%), Gaps = 21/395 (5%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  +D    +G+GA L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 13  DEWIVPTYAPADFIVVRGEGATLWDQQGKSYIDFAGGIAVNALGHGHPAVKAALIEQADK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY------HYMAG 117
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y      +    
Sbjct: 73  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKPGQ 132

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
           +  K +IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S +  I++ T
Sbjct: 133 QGEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDLASAEALITDQT 192

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV     EFL  LR +CD  +A+LIFDEVQTG GRTG+L+AY    V 
Sbjct: 193 CAVIVEPIQGEGGVLPADSEFLHGLRALCDRHNAVLIFDEVQTGVGRTGELYAYMHYGVT 252

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I +   
Sbjct: 253 PDVLTSAKALGGGFPIAAMLTTTKYASALNVGSHGTTYGGNPLACAVAGTVLSLINTPAV 312

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD----- 350
           L  V    +   EGL  I  R+  +F E+RG+GLLIG  L + +     A K +D     
Sbjct: 313 LSGVKERHQWFLEGLADINARY-KVFAEIRGRGLLIGCVLNSDY-----AGKSKDIIQAA 366

Query: 351 --ECLLTAPSSDNVVRILPPLTITAEEIHEGLERI 383
               L+   +  +VVR  P L I+  +I EGL R+
Sbjct: 367 AQHGLIALIAGPDVVRFAPSLIISQHDIKEGLTRL 401


>gi|77460506|ref|YP_350013.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas fluorescens Pf0-1]
 gi|77384509|gb|ABA76022.1| succinylornithine aminotransferase apoenzyme / acetylornithine
           aminotransferase apoenzyme [Pseudomonas fluorescens
           Pf0-1]
          Length = 406

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 230/383 (60%), Gaps = 17/383 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G G+ ++ + G   +DFA GIAVN LGH+HP LV  L  Q+ KLWHVSN++ +      
Sbjct: 30  RGAGSRVWDQAGRELIDFAGGIAVNVLGHAHPALVGALTEQANKLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI +TFA+RVFF NSGAE+ E A K ARR  +    T K+ I+    +FHGRTL T+
Sbjct: 90  AHKLIDATFAERVFFCNSGAEANEAAFKLARRVAFDRFGTEKYEIIAALNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPKI G     + DL +LK  +S+ T A+++EPIQGEGGV      +L
Sbjct: 150 NVGGQSKYSDGFGPKITGITHVPYNDLAALKAAVSDKTCAVVLEPIQGEGGVLPAELAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q  R++CD  +ALL+FDEVQTG GRTG LFAY+   V PDI+T AK +GGGFPI A L T
Sbjct: 210 QGARELCDANNALLVFDEVQTGMGRTGNLFAYQHYGVTPDILTSAKSLGGGFPIAAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
             +A  +  G+HG+TYGGN LA  + E V+++I +   L  V          L  I  ++
Sbjct: 270 EALAKHLVVGTHGTTYGGNPLACAVAEAVIDVINTPEVLNGVHAKHDKFKTRLQQIGEKY 329

Query: 320 PNMFLEVRGQGLLIGL----------KTVFSPALLAAKFRDECLLTAPSSDNVVRILPPL 369
             +F +VRG GLLIG           K +F+ A        E L+   +  +V+R  P L
Sbjct: 330 -GLFTQVRGLGLLIGCVLSDAWKGKAKDIFNAA------EQEGLMILQAGPDVIRFAPSL 382

Query: 370 TITAEEIHEGLERIERTAIKLSH 392
            +   +I  GL+R ER A KL+ 
Sbjct: 383 VVEDADIDAGLDRFERAAAKLTQ 405


>gi|90413584|ref|ZP_01221574.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Photobacterium profundum 3TCK]
 gi|90325357|gb|EAS41846.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Photobacterium profundum 3TCK]
          Length = 405

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 168/393 (42%), Positives = 234/393 (59%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y    I   KG+GA ++ +    ++DFA GIAV+ LGH HP +V  LKSQ+EK
Sbjct: 13  DEVMVPCYSPMQIIPVKGQGARIWDQEDREYIDFAGGIAVSCLGHCHPVMVNALKSQAEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   +FA++VFF NSGAE+ E A+K ARRY        K  
Sbjct: 73  LWHLSNVMTNEPALRLAKKLTEHSFAEKVFFANSGAEANEAALKLARRYAVDKFGPEKSE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK +      + DL +L   +S+ T AI++E
Sbjct: 133 IIAFNQGFHGRTFFTVTVGGQAAYSDGFGPKPQAISHIPYNDLSALAEIMSDRTCAIMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF+Q +R++CD  +ALLIFDEVQTG GRTG  +AY+   V PDI++ 
Sbjct: 193 PLQGEGGIISPTSEFVQGVRELCDKHNALLIFDEVQTGNGRTGNFYAYQGLGVTPDILST 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++A  M  G+HGSTYGGN LA  + E V++ +     L  V  
Sbjct: 253 AKSLGGGFPIGAMLTTAKLAEHMKVGTHGSTYGGNPLACAVAEAVVDEVSKPEVLAGVKE 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
             +   + L  I  ++P +F EVRG+GLL+G       +      LLAA   +E L+   
Sbjct: 313 REQWFRDALEQINAKYP-IFSEVRGKGLLLGAALNEEWQGRARDVLLAAV--EEGLMVLV 369

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L I   ++ EG+ R+ER   KL
Sbjct: 370 AGTNVVRFTPSLVIDKADVDEGMARLERAIAKL 402


>gi|309793521|ref|ZP_07687948.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 145-7]
 gi|308123108|gb|EFO60370.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 145-7]
          Length = 406

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFACGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIGATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|270264403|ref|ZP_06192669.1| acetylornithine/succinyldiaminopimelate aminotransferase [Serratia
           odorifera 4Rx13]
 gi|270041539|gb|EFA14637.1| acetylornithine/succinyldiaminopimelate aminotransferase [Serratia
           odorifera 4Rx13]
          Length = 405

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/373 (43%), Positives = 226/373 (60%), Gaps = 13/373 (3%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV  LK Q E LWH SN++ +      
Sbjct: 29  KGKGSRVWDQQGKEYIDFSGGIAVTALGHCHPALVEALKQQGETLWHTSNVFTNEPALRL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 89  AGKLIDATFADRVFFANSGAEANEAAFKLARHYAISRHSPYKTKIIAFYNAFHGRTLFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+  V  EFL
Sbjct: 149 SVGGQAKYSDGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVMEPIQGEGGITPVDAEFL 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           + +R++CD   ALL+FDEVQ+G GR+GKLFAY    V PDI+T AK +GGGFP+ A L T
Sbjct: 209 KGVRELCDKHQALLVFDEVQSGMGRSGKLFAYMHYGVTPDILTTAKALGGGFPVSAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G+HG+TYGGN LA  + E  L++I +   L  +     +  + L  I  ++
Sbjct: 269 EEIASVMQVGTHGTTYGGNPLACAVAEAALDVINTPEVLNGIEQRHHLYVQALRNIGEKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPA--------LLAAKFRDECLLTAPSSDNVVRILPPLTI 371
             +F ++RG GLLIG +   +P         L AA  R   +L A    NV+R  P L +
Sbjct: 329 -GIFSDIRGMGLLIGAE--LTPQYQGKARDFLTAAAARGLMILNA--GPNVIRFAPSLVV 383

Query: 372 TAEEIHEGLERIE 384
             ++I +G+   E
Sbjct: 384 ELKDIDDGMALFE 396


>gi|218705246|ref|YP_002412765.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli UMN026]
 gi|293405246|ref|ZP_06649238.1| argD [Escherichia coli FVEC1412]
 gi|298380889|ref|ZP_06990488.1| succinylornithine transaminase [Escherichia coli FVEC1302]
 gi|300898980|ref|ZP_07117269.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 198-1]
 gi|254807556|sp|B7N584|ASTC_ECOLU RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|218432343|emb|CAR13233.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           UMN026]
 gi|291427454|gb|EFF00481.1| argD [Escherichia coli FVEC1412]
 gi|298278331|gb|EFI19845.1| succinylornithine transaminase [Escherichia coli FVEC1302]
 gi|300357377|gb|EFJ73247.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 198-1]
          Length = 406

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FL  LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLHGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  + +R   +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTVNHRC-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|227326794|ref|ZP_03830818.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 408

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/376 (43%), Positives = 229/376 (60%), Gaps = 7/376 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ + G  ++DF+ GIAV +LGH HP LV+ L+ Q E LWH SN++ +      
Sbjct: 30  KGKGSRVWDQEGSEYIDFSGGIAVTALGHCHPALVSALQQQGETLWHTSNIFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI +TFADRVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 90  ASKLIDATFADRVFFVNSGAEANEAAFKLARHYAVKRHSPYKTKIIAFYNAFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 150 SVGGQPKYADGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITPATPEFL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD   ALL+FDEVQ+G GRTGKLF+Y    + PDI+T AK +GGGFPI A L T
Sbjct: 210 QGVRDLCDQHKALLVFDEVQSGMGRTGKLFSYMHYGITPDILTTAKALGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G HG+TYGGN LA  + E  L+II +   L  V +        L  I  ++
Sbjct: 270 EEIASAMTVGVHGTTYGGNPLACAVAEAALDIINTPDVLSGVADRHDRFVSELEKINQQY 329

Query: 320 PNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRDECLLTAPSSDNVVRILPPLTITAE 374
             +F +VRG GLL+G  LK  +   +   LAA    + L+   +  NV+R +P L I  +
Sbjct: 330 -GVFEQVRGMGLLLGAELKPQWHGRAGEFLAAA-TAQGLMVLMAGPNVIRFVPSLIIDED 387

Query: 375 EIHEGLERIERTAIKL 390
           +I +G+ +  +   ++
Sbjct: 388 DIAQGMAKFAKAVAQV 403


>gi|119468204|ref|ZP_01611330.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Alteromonadales bacterium TW-7]
 gi|119448197|gb|EAW29461.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Alteromonadales bacterium TW-7]
          Length = 401

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 165/394 (41%), Positives = 235/394 (59%), Gaps = 10/394 (2%)

Query: 1   MNKNDFLFN-----TYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVA 55
           M  N  LF+      Y  S +   +G+G+ ++ + G  F+DFA GIAVN LGH HP LV 
Sbjct: 1   MTVNRELFDHVMVPNYAPSSVIPVRGEGSRVWDQQGKEFIDFAGGIAVNCLGHCHPALVG 60

Query: 56  ILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYM 115
            LK Q EK+WH+SN+  +      A  ++ +TF ++V+F NSGAE+ E A+K ARR+   
Sbjct: 61  ALKEQGEKIWHLSNVMTNEPALRLAKKMVDATFGEKVYFANSGAEANEAALKLARRFALD 120

Query: 116 AGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN 175
                K +I+ F   FHGRT  T++ GG+  Y +GFGPK        + DL + +  IS+
Sbjct: 121 KFGPEKSQIIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGDIVHCDYNDLAAFEALISD 180

Query: 176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN 235
            T A+++EP+QGEGG+    +EF QQ+R +C   +ALLIFDEVQTG GRTG L+AY+  N
Sbjct: 181 QTCAVMMEPLQGEGGIVSPTDEFAQQVRDLCTKHNALLIFDEVQTGVGRTGDLYAYQGLN 240

Query: 236 VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD 295
           V PDI+T AK +GGGFPIGA L T ++A  +  G+HGSTYGGN LA  + E   + + + 
Sbjct: 241 VVPDILTSAKALGGGFPIGAMLTTTDIAQHLKVGTHGSTYGGNPLACAVAEAAFDTVNTP 300

Query: 296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDE 351
             L  V   A +  E L A+  ++ N+F E+RG+GLLIG          A +F     ++
Sbjct: 301 DVLAGVKEKAALFNELLAAVNEKY-NVFSEIRGKGLLIGAVVNEQYKGRAKEFLVAGTEQ 359

Query: 352 CLLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
            L++  +  +VVR  P L I   +I EG+ R E+
Sbjct: 360 GLMSLVAGADVVRFTPSLVIPEADIREGMARFEK 393


>gi|238756907|ref|ZP_04618095.1| Succinylornithine transaminase [Yersinia aldovae ATCC 35236]
 gi|238704737|gb|EEP97266.1| Succinylornithine transaminase [Yersinia aldovae ATCC 35236]
          Length = 438

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 233/390 (59%), Gaps = 11/390 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  +D    +G+G+ L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 37  DEWIVPTYAPADFIIVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVKATLIEQADK 96

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHY--MAGKTN- 120
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y     A K   
Sbjct: 97  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKPGQ 156

Query: 121 ---KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S +  I++ T
Sbjct: 157 PGEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDLSSAQALINDQT 216

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV     EFL  LR +CD   ALLIFDEVQTG GRTG L+AY    V 
Sbjct: 217 CAVIVEPIQGEGGVLPAEREFLHGLRALCDRHHALLIFDEVQTGMGRTGALYAYMHYGVT 276

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I     
Sbjct: 277 PDVLTSAKALGGGFPIAAMLTTTKYASALNVGSHGTTYGGNPLACAVAGTVLSLINQPAL 336

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----L 353
           L  V +  +   +GL  I  R+  +F E+RG+GLLIG       A  A K         L
Sbjct: 337 LAGVKDRNQWFLDGLAEINARY-KVFAEIRGRGLLIGCALNSDYAGKAKKIVQAAAQHGL 395

Query: 354 LTAPSSDNVVRILPPLTITAEEIHEGLERI 383
           +   +  +VVR  P L I+  +I EGL R+
Sbjct: 396 IALIAGPDVVRFAPSLIISQHDIKEGLARL 425


>gi|262280282|ref|ZP_06058066.1| succinylornithine transaminase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258060|gb|EEY76794.1| succinylornithine transaminase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 404

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 173/399 (43%), Positives = 239/399 (59%), Gaps = 15/399 (3%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ND++   +  ++    +G+G+ ++ +    ++DFA GIAVN+LGH+HP  V  L  Q+
Sbjct: 11  NFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYIDFAGGIAVNALGHAHPVAVNALTEQA 70

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            KLWHV N Y +      A  L  +TFAD+VFF NSGAE+ E A+K AR+    +G   K
Sbjct: 71  TKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFCNSGAEANEAALKLARKVGLDSGVAGK 130

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+ +Y + F P   G +   F DL++ K  I+  T A++
Sbjct: 131 SGIVAFKNAFHGRTLFTVSAGGQPKYSQDFAPLPNGINHVAFNDLEAAKAVINEQTCAVI 190

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV     EFL+ LR +CD+  ALLIFDEVQTG GRTG L+AY    V PD++
Sbjct: 191 VEPIQGEGGVIPADIEFLKGLRALCDEFGALLIFDEVQTGVGRTGALYAYMNTGVIPDVL 250

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T++ A   + G+HG+TYGGN LA  +   V   I +   LE V
Sbjct: 251 TTAKALGGGFPVGAMLTTDKFAPHFSVGTHGTTYGGNPLASAVAGAVFEFINTPEVLEGV 310

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------EC 352
            +  +   + L  + N    +F E+RGQGLLIG  LK  +     A K +D       E 
Sbjct: 311 KHRHQYFLDALNTL-NAEHQIFEEIRGQGLLIGCVLKAEY-----AGKAKDITTWAGEEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           LL   +  +VVR  P L I  ++I EG+ R++R   KL+
Sbjct: 365 LLALIAGPDVVRFTPSLIIPEQDIDEGIARLKRALAKLA 403


>gi|167034981|ref|YP_001670212.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas putida GB-1]
 gi|166861469|gb|ABY99876.1| succinylornithine transaminase family [Pseudomonas putida GB-1]
          Length = 406

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 232/380 (61%), Gaps = 11/380 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAVN+LGH HP LV  L  Q+  LWHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANTLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ L+ +TFADR FF NSGAES E A K ARR  +      K  I+    +FHGRTL T+
Sbjct: 90  AHKLVDATFADRAFFCNSGAESNEAAFKLARRVAHDRFGPEKHEIIATVNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPKI G     + DL++LK QIS+ T A++IEPIQGE GV    + +L
Sbjct: 150 SVGGQPKYSDGFGPKITGISHVPYNDLEALKAQISDKTCAVVIEPIQGESGVVPADKAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALLIFDEVQTG GRTG L+AY+   V PDI+T AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLIFDEVQTGVGRTGSLYAYQHYGVTPDILTSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HG+TYGGN L   +   VL++I +   L  +    +     L  I  ++
Sbjct: 270 TELAKHLAVGTHGTTYGGNPLGCAVACAVLDVINTPQTLAGIKAKHERFKTRLEQIGQKY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
            N+F +VRG GLL+G   V + A    K +D       E ++   +  +VVR  P L + 
Sbjct: 330 -NLFTQVRGVGLLLG--CVLTEA-WQGKAKDVLNAAEKEGVMVLQAGPDVVRFAPSLVVE 385

Query: 373 AEEIHEGLERIERTAIKLSH 392
             +I  GL+R ER    L+ 
Sbjct: 386 DADIDAGLDRFERAVATLTQ 405


>gi|84488867|ref|YP_447099.1| acetylornithine aminotransferase [Methanosphaera stadtmanae DSM
           3091]
 gi|84372186|gb|ABC56456.1| ArgD [Methanosphaera stadtmanae DSM 3091]
          Length = 388

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 156/382 (40%), Positives = 239/382 (62%), Gaps = 7/382 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           + ++ +TY + D+  + G G+ ++ + G  ++D  +GIAVNS+GH+H ++   L  Q++K
Sbjct: 11  DKYVMHTYGRYDLVLDHGHGSIVYDKEGNKYIDCVAGIAVNSIGHTHEKIAQTLTQQAKK 70

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           L HVSNLY + +Q  +A  L+  +  ++VFF NSGAE+ E AIK AR+Y      T K  
Sbjct: 71  LIHVSNLYYTEEQAEYAKRLVELSPHEKVFFANSGAEANEGAIKLARKY------TGKSE 124

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+  + +FHGRTLATI+A G+ +Y +G  P  +GF    + D+  +K+ I+ +TAAIL+E
Sbjct: 125 IIAMKNSFHGRTLATITATGQPKYQKGLDPLPQGFIHVDYNDIDQVKDAITENTAAILVE 184

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGE GVR   +++L QLRKICD+   LLIFDEVQTG+GRTGK FA E  N  PDI T 
Sbjct: 185 PIQGESGVRVPDDDYLPQLRKICDENGILLIFDEVQTGFGRTGKFFASELTNTVPDITTC 244

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK + GG P+G  L++ +VA+  N G H ST+GG  L   +   VL+I + +  +     
Sbjct: 245 AKAIAGGLPMGVVLSSAKVASGFNPGDHASTFGGTALVTAVASCVLDIYEEEDLVNKSKE 304

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVV 363
             +   E L  +K +  +  ++VRG GL++G++  +    L  K +++ +L   ++ NV+
Sbjct: 305 NGEYFMEKLANLKEKH-DCIVDVRGHGLMVGVELNYDCGNLVEKAQEKGVLINVANGNVI 363

Query: 364 RILPPLTITAEEIHEGLERIER 385
           R +PPL IT EE+ E +E I+ 
Sbjct: 364 RFVPPLVITKEELDEVVEVIDE 385


>gi|238797799|ref|ZP_04641292.1| Succinylornithine transaminase [Yersinia mollaretii ATCC 43969]
 gi|238718327|gb|EEQ10150.1| Succinylornithine transaminase [Yersinia mollaretii ATCC 43969]
          Length = 437

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 171/393 (43%), Positives = 242/393 (61%), Gaps = 17/393 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  +D    +G+GA L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 36  DEWIVPTYAPADFIIVRGEGATLWDQQGKSYIDFAGGIAVNALGHGHPAVKAALIEQADK 95

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHY--------M 115
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y          +
Sbjct: 96  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKPGL 155

Query: 116 AGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN 175
            G+ N+  IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S +  I++
Sbjct: 156 QGEKNQ--IVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDLASAEALITD 213

Query: 176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN 235
            T A+++EPIQGEGGV     EFL  LR +CD  +ALLIFDEVQTG GRTG+L+AY    
Sbjct: 214 QTCAVIVEPIQGEGGVLPADREFLHGLRALCDRHNALLIFDEVQTGVGRTGELYAYMHYG 273

Query: 236 VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD 295
           V PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I + 
Sbjct: 274 VTPDVLTSAKALGGGFPIAAMLTTTQFASALNVGSHGTTYGGNPLACAVAGTVLSLINTP 333

Query: 296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRD 350
             L  V    +   +GL  I  R+  +F E+RG+GLLIG  L + +   S  ++ A   +
Sbjct: 334 AVLAGVKERHQWFLDGLAEINARY-KVFAEIRGRGLLIGCALNSDYAGKSKEIIQAA-AE 391

Query: 351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERI 383
             L+   +  +VVR  P L I+ ++I +GL R+
Sbjct: 392 HGLIALIAGPDVVRFAPSLIISRQDIKDGLARL 424


>gi|169794540|ref|YP_001712333.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Acinetobacter baumannii AYE]
 gi|184159652|ref|YP_001847991.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Acinetobacter baumannii ACICU]
 gi|213158888|ref|YP_002320886.1| succinylornithine transaminase [Acinetobacter baumannii AB0057]
 gi|215482128|ref|YP_002324310.1| Succinylornithine transaminase [Acinetobacter baumannii AB307-0294]
 gi|260556974|ref|ZP_05829191.1| ornithine-oxo-acid transaminase [Acinetobacter baumannii ATCC
           19606]
 gi|169147467|emb|CAM85328.1| succinylornithine transaminase (also has acetylornitine
           transaminase activity, PLP-dependent) (carbon starvation
           protein C) [Acinetobacter baumannii AYE]
 gi|183211246|gb|ACC58644.1| Ornithine/acetylornithine aminotransferase [Acinetobacter baumannii
           ACICU]
 gi|213058048|gb|ACJ42950.1| succinylornithine transaminase [Acinetobacter baumannii AB0057]
 gi|213988487|gb|ACJ58786.1| Succinylornithine transaminase [Acinetobacter baumannii AB307-0294]
 gi|260409580|gb|EEX02881.1| ornithine-oxo-acid transaminase [Acinetobacter baumannii ATCC
           19606]
 gi|322509562|gb|ADX05016.1| astC [Acinetobacter baumannii 1656-2]
          Length = 404

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 171/399 (42%), Positives = 238/399 (59%), Gaps = 15/399 (3%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ND++   +  ++    +G+G+ ++ +    ++DFA GIAVN+LGH+HP  V  L  Q+
Sbjct: 11  NFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYIDFAGGIAVNALGHAHPVAVNALTEQA 70

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           +KLWHV N Y +      A  L  +TFAD+VFF NSGAE+ E A+K AR+    +G   K
Sbjct: 71  KKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFCNSGAEANEAALKLARKVGLDSGVAGK 130

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F  AFHGRTL T+SAGG+ +Y + F P   G     + DL++ K  I+  T A++
Sbjct: 131 SGIVAFNNAFHGRTLFTVSAGGQPKYSQDFAPLPNGISHVAYNDLEAAKAVINEQTCAVI 190

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGGV     EFL+ LR++CD   ALLIFDEVQTG GRTG L+AY    V PD++
Sbjct: 191 VEPVQGEGGVIPADIEFLKGLRELCDQFGALLIFDEVQTGVGRTGALYAYMNYGVIPDVL 250

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T++ A   + G+HG+TYGGN LA  +   V   I +   LE V
Sbjct: 251 TTAKALGGGFPVGAMLTTDKFAPHFSVGTHGTTYGGNPLASAVAGAVFEFINTPEVLEGV 310

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD-------EC 352
            +  +   + L  +   +  +F E+RGQGLLIG  LK  +     A K +D       E 
Sbjct: 311 KHRHQYFLDALNTLNAEY-QVFDEIRGQGLLIGCVLKAEY-----AGKAKDITTWAGEEG 364

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
           LL   +  NVVR  P L I  ++I EG+ R++R   KL+
Sbjct: 365 LLALIAGPNVVRFTPSLIIPEQDIDEGIARLKRALAKLA 403


>gi|156972459|ref|YP_001443366.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Vibrio harveyi ATCC BAA-1116]
 gi|156524053|gb|ABU69139.1| hypothetical protein VIBHAR_00079 [Vibrio harveyi ATCC BAA-1116]
          Length = 403

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 165/393 (41%), Positives = 239/393 (60%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y+  ++   KG+G+ ++ +NG  ++DFA GIAV+ LGH HP +V  L  Q  K
Sbjct: 13  DEVMVPCYNPMEMIPVKGEGSRIWDQNGNEYIDFAGGIAVSCLGHCHPVMVNALTEQGSK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   +FA+RVFF NSGAE+ E A+K ARRY      T K  
Sbjct: 73  LWHLSNVMTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVHGTEKSE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+  FHGRT  T++ GG+  Y +GFGPK        + D+++L+  +S+ T A+++E
Sbjct: 133 IIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHMSDRTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF Q +R++CD  +ALLIFDEVQTG GRTG  +AY+   + PDI++ 
Sbjct: 193 PLQGEGGIIPPTPEFAQAVRELCDKHNALLIFDEVQTGNGRTGHFYAYQGLGITPDILST 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++A  M  G+HGSTYGGN LA  + E V++ +     L  V+ 
Sbjct: 253 AKSLGGGFPIGAMLTTAKLAEHMKVGTHGSTYGGNPLACAVAEAVVDEVTKPEVLAGVLE 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
              +  EGL  I  ++ N+F EVRG+GLL+G       +      L+AA  +   +L A 
Sbjct: 313 REAMFREGLEKINAKY-NIFSEVRGKGLLLGAALNEEWQGRARDVLVAAGKQGLMVLVAG 371

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L IT +EI EGL ++++    L
Sbjct: 372 A--NVVRFTPSLVITQQEIEEGLAKLDKAIATL 402


>gi|26991167|ref|NP_746592.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas putida KT2440]
 gi|28376894|sp|P59319|ARGD_PSEPK RecName: Full=Acetylornithine aminotransferase; Short=ACOAT
 gi|24986212|gb|AAN70056.1|AE016645_2 acetylornithine aminotransferase [Pseudomonas putida KT2440]
          Length = 406

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 233/379 (61%), Gaps = 11/379 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAVN+LGH HP LV  L  Q+  LWHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANTLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ L+ +TFADR FF NSGAES E A K ARR  +      K  I+    +FHGRTL T+
Sbjct: 90  AHKLVDATFADRAFFCNSGAESNEAAFKLARRVAHDRFGPQKHEIIATVNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPKI G     + DL++LK QIS+ T A++IEPIQGE GV    + +L
Sbjct: 150 SVGGQPKYSDGFGPKITGISHVPYNDLEALKAQISDKTCAVVIEPIQGESGVVPADKAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALLIFDEVQTG GRTG L+AY+   V PDI+T AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLIFDEVQTGVGRTGSLYAYQHYGVIPDILTSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HG+TYGGN L   +   VL+++ +   L  +    +     L  I  ++
Sbjct: 270 TELAKHLAVGTHGTTYGGNPLGCAVACAVLDVVNTPETLAGIKAKHERFKTRLEQIGQQY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
            N+F +VRG GLL+G   V + A    K +D       E ++   +  +VVR  P L + 
Sbjct: 330 -NLFSQVRGVGLLLG--CVLTEA-WKGKAKDVLNAAEKEGVMVLQAGPDVVRFAPSLVVE 385

Query: 373 AEEIHEGLERIERTAIKLS 391
             +I EGL+R ER    L+
Sbjct: 386 DADIDEGLDRFERAVATLT 404


>gi|167036656|ref|YP_001664234.1| acetylornithine aminotransferase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115083|ref|YP_004185242.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166855490|gb|ABY93898.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319928174|gb|ADV78859.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 394

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 164/372 (44%), Positives = 234/372 (62%), Gaps = 3/372 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +  I   +GKG  ++ + G  +LDF +GIAVNSLGH HP LV  LK+QSEKL 
Sbjct: 9   YLMNTYSRYPITLVEGKGTKVWDDKGNVYLDFIAGIAVNSLGHCHPALVNALKNQSEKLI 68

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY +  Q   A  +  ++F  +VFF NSGAE+ E AIK AR+Y  +     + +++
Sbjct: 69  HCSNLYWNENQIELAKIIAENSFGGKVFFANSGAEANEGAIKLARKYASLKHGDKRHKVI 128

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           + + +FHGRT   ++A G+ +Y +GFGP + GF    F D+ +L   I ++  AI++E +
Sbjct: 129 SAKNSFHGRTFGALTATGQEKYHKGFGPLLSGFKYVPFNDIDALYEAIDDEVCAIMLEVV 188

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+ +   E+++ +R+ICD+ D L I DEVQTG GRTGKLF YE   + PDIMT+AK
Sbjct: 189 QGEGGIHEATPEYIKAVREICDENDILFIIDEVQTGIGRTGKLFGYEHYGITPDIMTLAK 248

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFPIGA +A  E  +  + G H ST+GGN LA   G  V+  I  +GFL++V    
Sbjct: 249 GLGGGFPIGAIVA-KEDKSVFSPGDHASTFGGNPLACAAGIAVMKEITKEGFLDSVAQKG 307

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL-LAAKFRDECLLTAPSSDNVVR 364
           +     L ++K +  ++  EVRG+GL+IG +     A  +  K   + LL    S NV+R
Sbjct: 308 EYFKGKLESLKEKH-SVIKEVRGKGLMIGCEMDMEEASDIVTKAMGKGLLINCISHNVLR 366

Query: 365 ILPPLTITAEEI 376
            +PPLT+T EEI
Sbjct: 367 FVPPLTVTEEEI 378


>gi|260855613|ref|YP_003229504.1| succinylornithine transaminase AstC, PLP-dependent [Escherichia
           coli O26:H11 str. 11368]
 gi|257754262|dbj|BAI25764.1| succinylornithine transaminase AstC, PLP-dependent [Escherichia
           coli O26:H11 str. 11368]
 gi|323153008|gb|EFZ39277.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli EPECa14]
          Length = 406

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQLGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|167039319|ref|YP_001662304.1| acetylornithine aminotransferase [Thermoanaerobacter sp. X514]
 gi|300913959|ref|ZP_07131276.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter sp. X561]
 gi|307725356|ref|YP_003905107.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter sp. X513]
 gi|166853559|gb|ABY91968.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter sp. X514]
 gi|300890644|gb|EFK85789.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter sp. X561]
 gi|307582417|gb|ADN55816.1| acetylornithine and succinylornithine aminotransferase
           [Thermoanaerobacter sp. X513]
          Length = 394

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 164/372 (44%), Positives = 234/372 (62%), Gaps = 3/372 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +  I   +GKG  ++ + G  +LDF +GIAVNSLGH HP LV  LK+QSEKL 
Sbjct: 9   YLMNTYSRYPITLVEGKGTKVWDDKGNVYLDFIAGIAVNSLGHCHPALVNALKNQSEKLI 68

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY +  Q   A  +  ++F  +VFF NSGAE+ E AIK AR+Y  +     + +++
Sbjct: 69  HCSNLYWNENQIELAKIIAENSFGGKVFFANSGAEANEGAIKLARKYASLKYGDKRHKVI 128

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           + + +FHGRT   ++A G+ +Y +GFGP + GF    F D+ +L   I ++  AI++E +
Sbjct: 129 SAKNSFHGRTFGALTATGQEKYHKGFGPLLSGFKYVPFNDIDALYEAIDDEVCAIMLEVV 188

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGG+ +   E+++ +R+ICD+ D L I DEVQTG GRTGKLF YE   + PDIMT+AK
Sbjct: 189 QGEGGIHEATPEYIKAVREICDENDILFIIDEVQTGIGRTGKLFGYEHYGITPDIMTLAK 248

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGGFPIGA +A  E  +  + G H ST+GGN LA   G  V+  I  +GFL++V    
Sbjct: 249 GLGGGFPIGAIVA-KEDKSVFSPGDHASTFGGNPLACAAGIAVMKEITKEGFLDSVAQKG 307

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL-LAAKFRDECLLTAPSSDNVVR 364
           +     L ++K +  ++  EVRG+GL+IG +     A  +  K   + LL    S NV+R
Sbjct: 308 EYFKGKLESLKEKH-SVIKEVRGKGLMIGCEMDMEEASDIVTKAMGKGLLINCISHNVLR 366

Query: 365 ILPPLTITAEEI 376
            +PPLT+T EEI
Sbjct: 367 FVPPLTVTEEEI 378


>gi|313497728|gb|ADR59094.1| ArgD [Pseudomonas putida BIRD-1]
          Length = 406

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 232/378 (61%), Gaps = 9/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAVN+LGH HP LV  L  Q+  LWHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANTLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ L+ +TFADR FF NSGAE+ E A K ARR  +      K  I+    +FHGRTL T+
Sbjct: 90  AHKLVDATFADRAFFCNSGAEANEAAFKLARRVAHDRFGPQKHEIIATLNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPKI G     + DL++LK QIS+ T A++IEPIQGE GV    + +L
Sbjct: 150 SVGGQPKYSDGFGPKITGISHVPYNDLEALKAQISDKTCAVVIEPIQGESGVVPADKAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALLIFDEVQTG GRTG L+AY+   V PDI+T AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLIFDEVQTGVGRTGSLYAYQHYGVTPDILTSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HG+TYGGN L   +   VL+++ +   L  +    +     L  I  ++
Sbjct: 270 TELATHLAVGTHGTTYGGNPLGCAVACAVLDVVNTPETLAGIKAKHERFKTRLEQIGQQY 329

Query: 320 PNMFLEVRGQGLLIGL------KTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITA 373
            N+F +VRG GLL+G       K      L AA+   E ++   +  +VVR  P L +  
Sbjct: 330 -NLFSQVRGVGLLLGCVLTEAWKGKAKDVLNAAE--KEGVMVLQAGPDVVRFAPSLVVED 386

Query: 374 EEIHEGLERIERTAIKLS 391
            +I EGL+R ER    L+
Sbjct: 387 ADIDEGLDRFERAVATLT 404


>gi|323525634|ref|YP_004227787.1| acetylornithine and succinylornithine aminotransferase
           [Burkholderia sp. CCGE1001]
 gi|323382636|gb|ADX54727.1| acetylornithine and succinylornithine aminotransferase
           [Burkholderia sp. CCGE1001]
          Length = 411

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 165/376 (43%), Positives = 227/376 (60%), Gaps = 15/376 (3%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++G G+ ++   G  ++DFA GIAV +LGH+HPEL+ +L  Q  KLWH+ N Y +     
Sbjct: 27  DRGLGSRVWDTQGRDYIDFAGGIAVTALGHAHPELLKVLHEQGGKLWHIGNGYTNEPVLR 86

Query: 79  FANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLAT 138
            A  L   TFADR FF NSGAE+ E A+K ARR  +     +KF IV+F  +FHGRT  T
Sbjct: 87  LAKRLEDLTFADRAFFANSGAEANEAALKLARRVAFDRHGADKFEIVSFTQSFHGRTFFT 146

Query: 139 ISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEF 198
           +S GG+ +Y EGFGP  +G     + D+++ K  I   T A+++EPIQGEGGV      F
Sbjct: 147 VSVGGQSKYSEGFGPVPQGIVHLPYNDIEAAKQAIGAKTCAVIVEPIQGEGGVIPADPAF 206

Query: 199 LQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLA 258
           L+ LR+ CD  DALLIFDEVQTG GR+G  +AY+   V PDI+T AK +G GFPIGA L 
Sbjct: 207 LKALREACDQHDALLIFDEVQTGVGRSGYFYAYQDTGVTPDILTTAKALGNGFPIGAMLT 266

Query: 259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR 318
           TNE+AA    G HG+TYGGN L   + EKV+ ++     LE V   + +L   L  +  R
Sbjct: 267 TNELAAHFKVGVHGTTYGGNPLGSAIAEKVVELVSDPKLLEGVRTRSDVLKGHLAKLNER 326

Query: 319 FPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAP---------SSDNVVRILPPL 369
           F  +F EVRG+GLLIG +        A K R +  +TA          +  +V+R +P L
Sbjct: 327 F-GLFKEVRGKGLLIGAELT-----DAYKGRAKDFVTAAGQHGVIMLMAGPDVLRFVPSL 380

Query: 370 TITAEEIHEGLERIER 385
            +  ++++EG ER+ +
Sbjct: 381 IMPLDDMNEGFERLAK 396


>gi|317130878|ref|YP_004097160.1| acetylornithine and succinylornithine aminotransferase [Bacillus
           cellulosilyticus DSM 2522]
 gi|315475826|gb|ADU32429.1| acetylornithine and succinylornithine aminotransferase [Bacillus
           cellulosilyticus DSM 2522]
          Length = 398

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 237/381 (62%), Gaps = 3/381 (0%)

Query: 3   KNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSE 62
           K + +  TY +  +   KGKG++++ + G  +LDF SGI   +LGH + E+   +++Q +
Sbjct: 6   KTETIMPTYARFPLTIVKGKGSYVWDDKGNKYLDFTSGIGTCNLGHVNDEVKNKVEAQLQ 65

Query: 63  KLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKF 122
            LWH SNL+    Q+  A+ L  ++F D+VFF NSGAE+ E AIK ARRY       + F
Sbjct: 66  ALWHCSNLFHIPSQQELADLLTDNSFGDKVFFCNSGAEANEGAIKLARRYAQKVKGNDAF 125

Query: 123 RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI 182
            +VTF+ +FHGRTLAT++A G+ +  +GF P   GF    + D++SLK    + T A+L+
Sbjct: 126 EVVTFKQSFHGRTLATLTATGQSKIQDGFAPLAPGFRYLPYNDIESLKEVAKSTTCAVLL 185

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           E IQGEGGV    +E+L++L KIC + D LLIFDEVQTG GRTG LFAYE   + PD+MT
Sbjct: 186 EVIQGEGGVIPANKEWLEELSKICKEHDILLIFDEVQTGIGRTGSLFAYEQYGITPDVMT 245

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
           +AKG+G G PIGA +AT E A  +  G+HG+T+GGN +    G  V  + +   +L +  
Sbjct: 246 LAKGLGSGLPIGAIVATEEAAKALEAGTHGTTFGGNPIVTTAG--VATMREVTKWLPHAT 303

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNV 362
           NI   L E L  +KN+F  +   VRG GL+ G+        + AK RD+ +L   +  NV
Sbjct: 304 NIGAYLTEKLNELKNQFVEIE-AVRGIGLMQGIVLKGPANDIIAKARDKNILVLLAGPNV 362

Query: 363 VRILPPLTITAEEIHEGLERI 383
           +R+LPPLT T EE+ E ++ +
Sbjct: 363 IRLLPPLTTTKEEVDEVIDSL 383


>gi|330447067|ref|ZP_08310717.1| succinylornithine transaminase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491258|dbj|GAA05214.1| succinylornithine transaminase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 406

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 166/378 (43%), Positives = 227/378 (60%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G GA ++ ++   ++DFA GIAV+ LGH HP +V  LK Q++KLWH+SN+  +      
Sbjct: 29  RGSGARVWDQHDREYVDFAGGIAVSCLGHCHPIMVNALKEQADKLWHLSNVLTNEPALRL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L    FAD+VFF NSGAE+ E A+K ARRY      + K +I+ F   FHGRT  T+
Sbjct: 89  AKKLTELCFADKVFFANSGAEANEAALKLARRYAVDKFGSEKDQIIAFHQGFHGRTFFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+  Y +GFGPK +      + DL +L   +S  T A+++EP+QGEGG+     EF+
Sbjct: 149 TVGGQEAYSDGFGPKPQAVTHIPYNDLSALAEIMSEKTCAVMMEPLQGEGGLVSPSVEFV 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R++CD   ALLIFDEVQTG GRTG  +AY+   V PDI+T AK +GGGFPIGA L T
Sbjct: 209 QGVRELCDKHQALLIFDEVQTGNGRTGDFYAYQGLGVTPDILTTAKSLGGGFPIGAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+AA +  G+HGSTYGGN LA  + E V++ +     L  V    +   EGLTAI  ++
Sbjct: 269 TELAAHLKVGTHGSTYGGNPLACAVAEAVIDEVSKPEVLAGVKQREQWFREGLTAINAKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
           P +F E+RG+GLL+G            + RD       E L+   +  NVVR  P L I 
Sbjct: 329 P-IFAEIRGKGLLLGASLTDE---WQGRARDILVQAGKEGLMMLVAGTNVVRFTPSLVIE 384

Query: 373 AEEIHEGLERIERTAIKL 390
             +I EG+ R+ER    L
Sbjct: 385 KADIDEGMARLERAIATL 402


>gi|157161209|ref|YP_001458527.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli HS]
 gi|188494774|ref|ZP_03002044.1| succinylornithine transaminase [Escherichia coli 53638]
 gi|254807553|sp|A8A0U0|ASTC_ECOHS RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|157066889|gb|ABV06144.1| succinylornithine transaminase [Escherichia coli HS]
 gi|188489973|gb|EDU65076.1| succinylornithine transaminase [Escherichia coli 53638]
 gi|309701970|emb|CBJ01284.1| succinylornithine transaminase [Escherichia coli ETEC H10407]
 gi|323937005|gb|EGB33285.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli E1520]
 gi|332343468|gb|AEE56802.1| acetylornithine/succinyldiaminopimelate aminotransferase AstC
           [Escherichia coli UMNK88]
          Length = 406

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 168/385 (43%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  + +R+  +F E+RG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTLNHRY-GLFSEIRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|123442699|ref|YP_001006676.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|254807570|sp|A1JS45|ASTC_YERE8 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|122089660|emb|CAL12512.1| succinylornithine aminotransferase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 414

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 171/395 (43%), Positives = 239/395 (60%), Gaps = 21/395 (5%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  +D    +G+GA L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 13  DEWIVPTYAPADFIVVRGEGATLWDQQGKSYIDFAGGIAVNALGHGHPAVKAALIEQADK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY------HYMAG 117
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y      +    
Sbjct: 73  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKPGQ 132

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
           +  K +IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S +  I++ T
Sbjct: 133 QGEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDLASAEALITDQT 192

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV     EFL  LR +CD  +A+LIFDEVQTG GRTG+L+AY    V 
Sbjct: 193 CAVIVEPIQGEGGVLPADSEFLHGLRALCDRHNAVLIFDEVQTGVGRTGELYAYMHYGVT 252

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I +   
Sbjct: 253 PDVLTSAKALGGGFPIAAMLTTTKYASALNVGSHGTTYGGNPLACAVAGTVLSLINTPAV 312

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRD----- 350
           L  V    +   EGL  I  R+  +F E+RG+GLLIG  L + +     A K +D     
Sbjct: 313 LSGVKERHQWFLEGLADINARY-KVFAEIRGRGLLIGCVLNSDY-----AGKSKDIIQAA 366

Query: 351 --ECLLTAPSSDNVVRILPPLTITAEEIHEGLERI 383
               ++   +  +VVR  P L I+  +I EGL R+
Sbjct: 367 AQHGIIALIAGPDVVRFAPSLIISQHDIKEGLARL 401


>gi|153834968|ref|ZP_01987635.1| acetylornithine/succinyldiaminopimelate aminotransferase [Vibrio
           harveyi HY01]
 gi|148868598|gb|EDL67686.1| acetylornithine/succinyldiaminopimelate aminotransferase [Vibrio
           harveyi HY01]
          Length = 403

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 165/393 (41%), Positives = 239/393 (60%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y+  ++   KG+G+ ++ +NG  ++DFA GIAV+ LGH HP +V  L  Q  K
Sbjct: 13  DEVMVPCYNPMEMIPVKGEGSRIWDQNGNEYIDFAGGIAVSCLGHCHPVMVNALTEQGNK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   +FA+RVFF NSGAE+ E A+K ARRY      T K  
Sbjct: 73  LWHLSNVMTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVHGTEKSE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+  FHGRT  T++ GG+  Y +GFGPK        + D+++L+  +S+ T A+++E
Sbjct: 133 IIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHMSDRTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF Q +R++CD  +ALLIFDEVQTG GRTG  +AY+   + PDI++ 
Sbjct: 193 PLQGEGGIIPPTPEFAQAVRELCDKHNALLIFDEVQTGNGRTGHFYAYQGLGITPDILST 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++A  M  G+HGSTYGGN LA  + E V++ +     L  V+ 
Sbjct: 253 AKSLGGGFPIGAMLTTAKLAEHMKVGTHGSTYGGNPLACAVAEAVVDEVTKPEVLAGVLE 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
              +  EGL  I  ++ N+F EVRG+GLL+G       +      L+AA  +   +L A 
Sbjct: 313 REAMFREGLEKINAKY-NIFSEVRGKGLLLGAALNEEWQGRARDVLVAAGKQGLMVLVAG 371

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L IT +EI EGL ++++    L
Sbjct: 372 A--NVVRFTPSLVITQQEIEEGLAKLDKAIATL 402


>gi|26248002|ref|NP_754042.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli CFT073]
 gi|91210964|ref|YP_540950.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli UTI89]
 gi|110641868|ref|YP_669598.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli 536]
 gi|117623920|ref|YP_852833.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli APEC O1]
 gi|191171696|ref|ZP_03033243.1| succinylornithine transaminase [Escherichia coli F11]
 gi|218558616|ref|YP_002391529.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli S88]
 gi|218689689|ref|YP_002397901.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli ED1a]
 gi|227885827|ref|ZP_04003632.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli 83972]
 gi|237705698|ref|ZP_04536179.1| succinylornithine transaminase [Escherichia sp. 3_2_53FAA]
 gi|300987547|ref|ZP_07178254.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 200-1]
 gi|300994388|ref|ZP_07180893.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 45-1]
 gi|301050912|ref|ZP_07197763.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 185-1]
 gi|30172853|sp|Q8FGZ9|ASTC_ECOL6 RecName: Full=Succinylornithine transaminase; Short=SOAT; AltName:
           Full=Succinylornithine aminotransferase
 gi|118572869|sp|Q0TH82|ASTC_ECOL5 RecName: Full=Succinylornithine transaminase; Short=SOAT; AltName:
           Full=Succinylornithine aminotransferase
 gi|118572870|sp|Q1RB45|ASTC_ECOUT RecName: Full=Succinylornithine transaminase; Short=SOAT; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807546|sp|B7MAV9|ASTC_ECO45 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807550|sp|B7MVM7|ASTC_ECO81 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807554|sp|A1ABS9|ASTC_ECOK1 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|26108405|gb|AAN80607.1|AE016761_182 Succinylornithine transaminase [Escherichia coli CFT073]
 gi|91072538|gb|ABE07419.1| succinylornithine transaminase [Escherichia coli UTI89]
 gi|110343460|gb|ABG69697.1| succinylornithine transaminase [Escherichia coli 536]
 gi|115513044|gb|ABJ01119.1| succinylornithine transaminase [Escherichia coli APEC O1]
 gi|190908026|gb|EDV67618.1| succinylornithine transaminase [Escherichia coli F11]
 gi|218365385|emb|CAR03108.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           S88]
 gi|218427253|emb|CAR08143.2| succinylornithine transaminase, PLP-dependent [Escherichia coli
           ED1a]
 gi|226900455|gb|EEH86714.1| succinylornithine transaminase [Escherichia sp. 3_2_53FAA]
 gi|227837400|gb|EEJ47866.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli 83972]
 gi|294493363|gb|ADE92119.1| succinylornithine transaminase [Escherichia coli IHE3034]
 gi|300297431|gb|EFJ53816.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 185-1]
 gi|300306117|gb|EFJ60637.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 200-1]
 gi|300406234|gb|EFJ89772.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 45-1]
 gi|307553767|gb|ADN46542.1| acetylornithine delta-aminotransferase [Escherichia coli ABU 83972]
 gi|307626766|gb|ADN71070.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli UM146]
 gi|315286458|gb|EFU45893.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 110-3]
 gi|315290450|gb|EFU49825.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 153-1]
 gi|320194543|gb|EFW69174.1| Succinylornithine transaminase [Escherichia coli WV_060327]
 gi|323952254|gb|EGB48127.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           coli H252]
 gi|324011530|gb|EGB80749.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 60-1]
          Length = 406

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 232/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+A     V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYACMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|237756944|ref|ZP_04585412.1| acetylornithine aminotransferase [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237690895|gb|EEP60035.1| acetylornithine aminotransferase [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 387

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 168/385 (43%), Positives = 238/385 (61%), Gaps = 10/385 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           + +LF  Y +    F KG+G +L+ E+G  +LD  SGIAVN LG++HP+L   +  Q+++
Sbjct: 7   DKYLFPNYARLPYSFVKGEGCYLYDEDGKKYLDMLSGIAVNQLGYNHPKLTESICRQAKE 66

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           + HVSNL+    Q   A  L+ ++  D+VFF NSGAE+ E  IK  RRY Y   K N++ 
Sbjct: 67  IIHVSNLFYIKPQYEVAKILVENSCGDKVFFCNSGAEANEALIKLIRRYFY-DKKENRYE 125

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+TFEG+FHGRTLATI+A  + +Y EGF P  EGF  AKF D+ S+K  I++ TAA+LIE
Sbjct: 126 IITFEGSFHGRTLATITATAQPKYQEGFQPLPEGFKYAKFNDIDSVKQLINDKTAAVLIE 185

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
            +QGEGGV    +EF+++L  +C +   L   DEVQTG GRTGKLFAY+  +++PDI+++
Sbjct: 186 LVQGEGGVNPADKEFIKELYSLCRENGILFTVDEVQTGIGRTGKLFAYQHYDIEPDIISL 245

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGG PIGA +A +E+A     G+H ST+GGN LA    + VL  I SDGFL+ VI 
Sbjct: 246 AKGLGGGVPIGAIIAKDEIAKSFVPGTHASTFGGNYLAAAAAKVVLEEILSDGFLDKVIE 305

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDN 361
             + L       K R       V+G GL+IG  L    S   +  K  +  L+   +  N
Sbjct: 306 NGEYL-------KERLKTFGYPVKGLGLMIGMDLPEEISAKEIMKKALENGLIIGTAGKN 358

Query: 362 VVRILPPLTITAEEIHEGLERIERT 386
            +R +PPL I  ++I   +  +E+ 
Sbjct: 359 TLRFVPPLIIRKDDIDLAVNILEKV 383


>gi|315299865|gb|EFU59105.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 16-3]
          Length = 406

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 232/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSANALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+A     V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYACMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|238783238|ref|ZP_04627263.1| Succinylornithine transaminase [Yersinia bercovieri ATCC 43970]
 gi|238715831|gb|EEQ07818.1| Succinylornithine transaminase [Yersinia bercovieri ATCC 43970]
          Length = 438

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 172/393 (43%), Positives = 239/393 (60%), Gaps = 17/393 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  +D    +G+GA L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 37  DEWIVPTYAPADFIIVRGEGATLWDQQGKSYIDFAGGIAVNALGHGHPAVKAALIEQADK 96

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY------HYMAG 117
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y      +    
Sbjct: 97  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKPGQ 156

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
           +  K +IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S +  I++ T
Sbjct: 157 QGEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDLASAQALITDQT 216

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV     EFL  LR +CD  +ALLIFDEVQTG GRTG+L+AY    V 
Sbjct: 217 CAVIVEPIQGEGGVLPADREFLHGLRALCDRHNALLIFDEVQTGVGRTGELYAYMHYGVT 276

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I +   
Sbjct: 277 PDVLTSAKALGGGFPIAAMLTTTKYASALNVGSHGTTYGGNPLACAVAGTVLSLINTPAV 336

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSP-----ALLAAKFRD 350
           L  V    +   +GL  I  R   +F E+RG+GLLIG  L + ++         AA+   
Sbjct: 337 LAGVKERHQWFLDGLAEINARH-RVFAEIRGRGLLIGCVLHSDYAGKSKEIVQAAAQHGV 395

Query: 351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERI 383
             L+  P   +VVR  P L I+ ++I EGL R+
Sbjct: 396 IALIAGP---DVVRFAPSLIISQQDIKEGLARL 425


>gi|254230070|ref|ZP_04923468.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Vibrio sp. Ex25]
 gi|262393048|ref|YP_003284902.1| acetylornithine aminotransferase/N-succinyl-L,L-diaminopimelate
           aminotransferase/succinylornithine transaminase [Vibrio
           sp. Ex25]
 gi|151937404|gb|EDN56264.1| acetylornithine and succinylornithine aminotransferases subfamily
           [Vibrio sp. Ex25]
 gi|262336642|gb|ACY50437.1| acetylornithine aminotransferase/N-succinyl-L,L-diaminopimelate
           aminotransferase/succinylornithine transaminase [Vibrio
           sp. Ex25]
          Length = 403

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 165/393 (41%), Positives = 238/393 (60%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y+  ++   KG+G+ ++ + G  ++DFA GIAV+ LGH HP +V  L  Q+ K
Sbjct: 13  DEVMVPCYNPMEMIPVKGEGSRVWDQEGNEYIDFAGGIAVSCLGHCHPVMVNALTEQANK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   +FA+RVFF NSGAE+ E A+K ARRY        K  
Sbjct: 73  LWHLSNVMTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVHGAEKSE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+  FHGRT  T++ GG+  Y +GFGPK        + D+++L+  +S+ T A+++E
Sbjct: 133 IIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHMSDRTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF Q +R++CD  +ALLIFDEVQTG GRTG  +AY+   + PDI++ 
Sbjct: 193 PLQGEGGIVPPTPEFAQAVRELCDKHNALLIFDEVQTGNGRTGNFYAYQGLGITPDILST 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++A  M  G+HGSTYGGN LA  + E V+N +     L  V+ 
Sbjct: 253 AKSLGGGFPIGAMLTTAKLAEHMKVGTHGSTYGGNPLACAVAEAVVNEVTKPEVLAGVLE 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
              +  EGL  I  ++ N+F EVRGQGLL+G       +      L+AA  +   +L A 
Sbjct: 313 REAMFREGLEKINAKY-NIFSEVRGQGLLLGAALNEEWQGRARDVLVAAGKQGLMVLVAG 371

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L IT +EI EGL ++++    L
Sbjct: 372 A--NVVRFTPSLVITQQEIEEGLAKLDKAIATL 402


>gi|54307510|ref|YP_128530.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Photobacterium profundum SS9]
 gi|46911930|emb|CAG18728.1| putative acetylornithine aminotransferase [Photobacterium profundum
           SS9]
          Length = 405

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 167/393 (42%), Positives = 233/393 (59%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y    I   KG+G+ ++ +    ++DFA GIAV+ LGH HP +V  LKSQ+EK
Sbjct: 13  DEVMVPCYSPMQIIPVKGQGSRIWDQADREYIDFAGGIAVSCLGHCHPVMVNALKSQAEK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   +FA++VFF NSGAE+ E A+K ARRY        K  
Sbjct: 73  LWHLSNVMTNEPALRLAKKLTEHSFAEKVFFANSGAEANEAALKLARRYAVDKFGPEKSE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK +      + DL +L   +S+ T AI++E
Sbjct: 133 IIAFNQGFHGRTFFTVTVGGQAAYSDGFGPKPQAISHIPYNDLSALAEIMSDRTCAIMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF+Q +R++CD  +ALLIFDEVQTG GRTG  +AY+   V PDI++ 
Sbjct: 193 PLQGEGGIISPTSEFVQGVRELCDKHNALLIFDEVQTGNGRTGNFYAYQGLGVTPDILST 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T  +A  M  G+HGSTYGGN LA  + E V++ +     L  V  
Sbjct: 253 AKSLGGGFPIGAMLTTTALAEHMKVGTHGSTYGGNPLACAVAEAVVDEVSKPEVLAGVKE 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
             +   + L  I  ++P +F EVRG+GLL+G       +      LLAA   +E L+   
Sbjct: 313 REQWFRDALEQINAKYP-IFAEVRGKGLLLGAALNEEWQGRARDVLLAAV--EEGLMVLV 369

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L I   ++ EG+ R+ER   KL
Sbjct: 370 AGTNVVRFTPSLVIDKADVDEGMARLERAIAKL 402


>gi|16766756|ref|NP_462371.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|167549335|ref|ZP_02343094.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167994568|ref|ZP_02575659.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|194445123|ref|YP_002042719.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|197262147|ref|ZP_03162221.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|200389242|ref|ZP_03215854.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|224585262|ref|YP_002639061.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|17865696|sp|P40732|ARGD_SALTY RecName: Full=Acetylornithine/succinyldiaminopimelate
           aminotransferase; Short=ACOAT; Short=DapATase;
           Short=Succinyldiaminopimelate transferase
 gi|16422025|gb|AAL22330.1| acetylornithine transaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194403786|gb|ACF64008.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|197240402|gb|EDY23022.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|199606340|gb|EDZ04885.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205325604|gb|EDZ13443.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205327598|gb|EDZ14362.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|224469790|gb|ACN47620.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|261248623|emb|CBG26461.1| Acetylornithine aminotransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|312914492|dbj|BAJ38466.1| bifunctional N-succinyldiaminopimelate-aminotransferase/
           acetylornithine transaminase protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|321226517|gb|EFX51567.1| Acetylornithine aminotransferase / N-succinyl-L,L-diaminopimelate
           aminotransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|332990320|gb|AEF09303.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. UK-1]
          Length = 405

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +D    KGKG+ ++ + G  ++DFA GIAV +LGH HP LV  LKSQ E 
Sbjct: 14  DEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +         LI +TFA+RV F NSG E+ E A K AR Y  +     K +
Sbjct: 74  LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGR+L T+S GG+ +Y +GFGPK        F DL ++K  + + T A+++E
Sbjct: 134 IIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV+    EFL+ LR +CD+  ALL+FDEVQ G GRTG LFAY    V PDI+T 
Sbjct: 194 PIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L T E+A+  + GSHGSTYGGN LA  +     +II +   L+ +  
Sbjct: 254 AKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHT 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----------- 352
             +   + L AI  +F ++F ++RG GLLIG       A L  K++              
Sbjct: 314 KRQQFVQHLQAIDEQF-DIFSDIRGMGLLIG-------AELKPKYKGRARDFLYAGAEAG 365

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           ++   +  +V+R  P L +   +IHEG++R  +   K+
Sbjct: 366 VMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKV 403


>gi|301160011|emb|CBW19530.1| acetylornithine aminotransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|323131827|gb|ADX19257.1| bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
          Length = 405

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +D    KGKG+ ++ + G  ++DFA GIAV +LGH HP LV  LKSQ E 
Sbjct: 14  DEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +         LI +TFA+RV F NSG E+ E A K AR Y  +     K +
Sbjct: 74  LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGR+L T+S GG+ +Y +GFGPK        F DL ++K  + + T A+++E
Sbjct: 134 IIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV+    EFL+ LR +CD+  ALL+FDEVQ G GRTG LFAY    V PDI+T 
Sbjct: 194 PIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L T E+A+  + GSHGSTYGGN LA  +     +II +   L+ +  
Sbjct: 254 AKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHT 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----------- 352
             +   + L AI  +F ++F ++RG GLLIG       A L  K++              
Sbjct: 314 KRQQFVQHLQAIDEQF-DIFSDIRGMGLLIG-------AELKPKYKGRARDFLYAGAEAG 365

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           ++   +  +V+R  P L +   +IHEG++R  +   K+
Sbjct: 366 VMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKV 403


>gi|237731240|ref|ZP_04561721.1| acetylornithine delta-aminotransferase [Citrobacter sp. 30_2]
 gi|226906779|gb|EEH92697.1| acetylornithine delta-aminotransferase [Citrobacter sp. 30_2]
          Length = 406

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 168/385 (43%), Positives = 232/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HP L   L  Q+
Sbjct: 9   NFDEWMMPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNDQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFA+R+FF NSGAE+ E A+K AR+Y +    + K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFAERIFFCNSGAEANEAALKLARKYAHDRFGSQK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + DL S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAVYNDLDSASQLIDDTTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EP+QGEGGV    + FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPVQGEGGVVPATKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFPIGA LAT   A+ M  G+HG+TYGGN LA  +  K+L I+ +   L  V
Sbjct: 249 TTAKALGGGFPIGALLATERCASVMTVGTHGTTYGGNPLAAAVAGKLLEIVNTPEVLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFS--PALLAAKFRDECLLTAP 357
                   E + AI  RF  +F E+RG GLLIG  L   F+    L++ +     ++   
Sbjct: 309 KQRHDWFVERINAINERF-GLFSEIRGLGLLIGCVLNAEFAGKAKLISQEAAVAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGANVVRFAPALNVSEEEVATGLDR 392


>gi|218699685|ref|YP_002407314.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Escherichia coli IAI39]
 gi|254807549|sp|B7NT29|ASTC_ECO7I RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|218369671|emb|CAR17440.1| succinylornithine transaminase, PLP-dependent [Escherichia coli
           IAI39]
          Length = 406

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 168/385 (43%), Positives = 229/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +     +K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGCHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FL  LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLHGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  + +R   +F E+RG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTVNHRC-GLFSEIRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|163930950|pdb|2PB0|A Chain A, Structure Of Biosynthetic N-Acetylornithine
           Aminotransferase From Salmonella Typhimurium: Studies On
           Substrate Specificity And Inhibitor Binding
 gi|163930951|pdb|2PB0|B Chain B, Structure Of Biosynthetic N-Acetylornithine
           Aminotransferase From Salmonella Typhimurium: Studies On
           Substrate Specificity And Inhibitor Binding
 gi|163930952|pdb|2PB2|A Chain A, Structure Of Biosynthetic N-Acetylornithine
           Aminotransferase From Salmonella Typhimurium: Studies On
           Substrate Specificity And Inhibitor Binding
 gi|163930953|pdb|2PB2|B Chain B, Structure Of Biosynthetic N-Acetylornithine
           Aminotransferase From Salmonella Typhimurium: Studies On
           Substrate Specificity And Inhibitor Binding
          Length = 420

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +D    KGKG+ ++ + G  ++DFA GIAV +LGH HP LV  LKSQ E 
Sbjct: 29  DEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET 88

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +         LI +TFA+RV F NSG E+ E A K AR Y  +     K +
Sbjct: 89  LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTK 148

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGR+L T+S GG+ +Y +GFGPK        F DL ++K  + + T A+++E
Sbjct: 149 IIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVE 208

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV+    EFL+ LR +CD+  ALL+FDEVQ G GRTG LFAY    V PDI+T 
Sbjct: 209 PIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTS 268

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L T E+A+  + GSHGSTYGGN LA  +     +II +   L+ +  
Sbjct: 269 AKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHT 328

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----------- 352
             +   + L AI  +F ++F ++RG GLLIG       A L  K++              
Sbjct: 329 KRQQFVQHLQAIDEQF-DIFSDIRGMGLLIG-------AELKPKYKGRARDFLYAGAEAG 380

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           ++   +  +V+R  P L +   +IHEG++R  +   K+
Sbjct: 381 VMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKV 418


>gi|150399179|ref|YP_001322946.1| acetylornithine aminotransferase [Methanococcus vannielii SB]
 gi|150011882|gb|ABR54334.1| acetylornithine and succinylornithine aminotransferase
           [Methanococcus vannielii SB]
          Length = 396

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 162/376 (43%), Positives = 233/376 (61%), Gaps = 5/376 (1%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           + ++ ++ NTY +      KG G  ++  NG  ++DF SGI+VN++GH HP++V  +K Q
Sbjct: 12  LEESKYVINTYGRVPAVLVKGDGMNVYDINGNSYVDFLSGISVNNVGHCHPKIVETIKKQ 71

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           +E L HVSN+Y +  Q   A  L++ +  D+ FF NSGAE+ E AIK +R+Y    GK  
Sbjct: 72  AETLIHVSNIYYNIPQVNLAKKLVNISGLDKAFFCNSGAEANEAAIKLSRKYSKAFGKEG 131

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +  I+T E AFHGRTL TI+A  K +Y EG+ P   GF    F D++ LK  ISN TAAI
Sbjct: 132 E--IITMEHAFHGRTLTTITATPKPKYQEGYDPLPTGFKHVPFNDIEKLKESISNKTAAI 189

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           +IEP+QGEGG+    +E+L+ +R++CDD + +LIFDEVQ G GRTGK+FA+E   VKPDI
Sbjct: 190 MIEPVQGEGGIHIADQEYLKAVRELCDDKNIVLIFDEVQCGLGRTGKMFAFEHYGVKPDI 249

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           +T+AK +G G PIGA +A +EV+     GSHG+T+GGN LA       +N+I     L N
Sbjct: 250 ITLAKALGSGIPIGAMIAKDEVSNAFTPGSHGTTFGGNPLACATAITSINLISE--LLNN 307

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
              +     + L  I+ ++ +   EVR  GL+ GL+  F+ + +  +   +  L   +SD
Sbjct: 308 TNEMGVYFTDKLKKIEEKY-DFVREVRSIGLMTGLELSFNGSNIVQEMFKQGYLINCTSD 366

Query: 361 NVVRILPPLTITAEEI 376
            V+R LPPL I  E I
Sbjct: 367 TVLRFLPPLIIQKEHI 382


>gi|224825873|ref|ZP_03698977.1| succinylornithine transaminase family [Lutiella nitroferrum 2002]
 gi|224602097|gb|EEG08276.1| succinylornithine transaminase family [Lutiella nitroferrum 2002]
          Length = 404

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 228/369 (61%), Gaps = 5/369 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KG G+ ++ + G  ++DFA GIAVNSLGH HPELVA L  Q  KLWH+SN++ +      
Sbjct: 27  KGLGSRVWDQQGNEYIDFAGGIAVNSLGHCHPELVAALTEQGNKLWHLSNVFTNEPALQL 86

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L   TFA+RVF  NSGAE+ E A K AR+Y       +K+ I++ + +FHGRT+ T+
Sbjct: 87  ATRLTELTFAERVFLCNSGAEANEAAFKLARKYATDHFGADKYEIISCKNSFHGRTVFTV 146

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y EGFGP   G    +F  +++LK  IS+ T A++IEP+QGEGGV    + +L
Sbjct: 147 NVGGQPKYSEGFGPNPAGITHVEFNSIEALKAAISDKTCAVVIEPVQGEGGVLPADKAYL 206

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  R++C+  +ALLIFDEVQTG GR G L+AY+   V PDI++ AKG+GGGFP+GA L T
Sbjct: 207 EAARELCNQHNALLIFDEVQTGVGRCGTLYAYQSYGVTPDILSSAKGLGGGFPVGAILTT 266

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
             +A  +  G+HG+TYGGN LA  +  KV+ I+     LE V         GL AI  ++
Sbjct: 267 AAIAKSLGVGTHGTTYGGNPLASAIAGKVVEIVSRPEVLEGVRVKHDRFVAGLNAINAKY 326

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNVVRILPPLTITAEE 375
            ++F  VRG GLLIG       A  A  F      E L+   +  NVVR+ P L +  ++
Sbjct: 327 -HVFKTVRGMGLLIGCVLADEYAGRAKDFLKAAEKERLMVLVAGLNVVRLAPSLVVEDKD 385

Query: 376 IHEGLERIE 384
           I EGL R++
Sbjct: 386 IDEGLARLD 394


>gi|45358664|ref|NP_988221.1| acetylornithine aminotransferase [Methanococcus maripaludis S2]
 gi|45047530|emb|CAF30657.1| Aminotransferase (subgroup II) similar to Acetylornithine
           aminotransferase [Methanococcus maripaludis S2]
          Length = 395

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 162/375 (43%), Positives = 236/375 (62%), Gaps = 5/375 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           ++  ++  TY +  +   KG G  +F  +G  +LDF +GI VN++GH HP++V  +K+Q+
Sbjct: 12  DEKKYVIGTYGRVPVVLVKGNGMSVFDTDGKEYLDFLAGIGVNNVGHCHPKVVEAIKNQA 71

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
           E L HVSN+Y +  Q   A  L++ +  D+ FF NSGAE+ E AIK AR+Y    GK  +
Sbjct: 72  ETLIHVSNIYYNVPQIELAKKLVNLSGLDKAFFCNSGAEANEAAIKLARKYAKANGKEGE 131

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             I+T E AFHGRTL TI+A  K +Y EGF P   GF    F D+ +LK  IS  T+AI+
Sbjct: 132 --IITMEHAFHGRTLTTITATPKAKYQEGFEPLPTGFKYIPFNDIDALKAGISEKTSAIM 189

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           IEP+QGEGG+     E+L+ +RK+CD+ + +LIFDEVQ G GRTG LFAYE   V PDI+
Sbjct: 190 IEPVQGEGGIHPADNEYLKAVRKLCDENNIVLIFDEVQCGMGRTGTLFAYEQYGVVPDIV 249

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T+AKG+GGGFPIGA +A +E+A+    GSHG+T+GGN LA       L++I     L+N 
Sbjct: 250 TLAKGLGGGFPIGAMVAKSEIASAFTPGSHGTTFGGNPLACASSAAALDVISE--LLDNA 307

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDN 361
           + + +     L  ++ ++     EVR  GL++G++  F+ + + +K  ++  L   +SD 
Sbjct: 308 VEMGEYFKNSLKTLEEKY-EFVKEVRSLGLMVGIELTFNGSDIVSKMFEKGFLINCTSDT 366

Query: 362 VVRILPPLTITAEEI 376
           V+R LPPL +  E I
Sbjct: 367 VLRFLPPLIVEKEHI 381


>gi|198244442|ref|YP_002217429.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205354906|ref|YP_002228707.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|197938958|gb|ACH76291.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205274687|emb|CAR39742.1| acetylornithine aminotransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326625210|gb|EGE31555.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           3246]
 gi|326630052|gb|EGE36395.1| bifunctional N-succinyldiaminopimelate-aminotransferase/
           acetylornithine transaminase protein [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 405

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 233/398 (58%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +D    KGKG+ ++ + G  ++DFA GIAV +LGH HP LV  LKSQ E 
Sbjct: 14  DEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +         LI +TFA+RV F NSG E+ E A K AR Y  +     K +
Sbjct: 74  LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGR+L T+S GG+ +Y +GFGPK        F DL ++K  + + T A+++E
Sbjct: 134 IIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV+    EFL+ LR +CD+  ALL+FDEVQ G GRTG LFAY    V PDI+T 
Sbjct: 194 PIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L T E+A+  + GSHGSTYGGN LA  +     +II +   L+ +  
Sbjct: 254 AKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHT 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----------- 352
             +   + L AI  +F ++F ++RG GLLIG       A L  K++D             
Sbjct: 314 KRQQFVQHLQAIDEQF-DIFSDIRGMGLLIG-------AELKPKYKDRARDFLYAGAEAG 365

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           ++   +  +V+R  P L +   +I+EG++R  +   K+
Sbjct: 366 VMVLNAGADVMRFAPSLVVEDADINEGMQRFAQAVGKV 403


>gi|300716436|ref|YP_003741239.1| succinylornithine transaminase [Erwinia billingiae Eb661]
 gi|299062272|emb|CAX59389.1| Succinylornithine transaminase [Erwinia billingiae Eb661]
          Length = 406

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 231/387 (59%), Gaps = 5/387 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N + ++  TY  +     + +G+ L+ + G  ++DFA GIAVN+LGH+HP+L   L+ Q+
Sbjct: 9   NFDQWIVPTYAPASFVPVRAEGSTLWDQQGKSYIDFAGGIAVNALGHAHPDLQKALQQQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            KLWH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR+  +      K
Sbjct: 69  AKLWHTGNGYTNEPILRLAKQLIDATFADRVFFCNSGAEANEAALKLARKVAHDKVGEQK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T++AGG+  Y + F P   G D A + DL S    I++ T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVTAGGQPAYSKDFAPLPGGIDHAVYNDLASAAALITDQTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FL+ LR++CD   A+LIFDEVQ+G GRTG L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPAEPAFLRGLRELCDQHQAVLIFDEVQSGVGRTGSLYAYMHYGVTPDVL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA L T  +A+ M  G+HG+TYGGN LA  +G KV+ +I +   +  V
Sbjct: 249 TTAKALGGGFPMGAMLTTETLASAMGVGTHGTTYGGNPLAGAVGGKVMELINTPEVMSGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRD----ECLLTAP 357
               +   +GL  I  R  ++F E+RG GLLIG          A +F      E L+   
Sbjct: 309 ALRHQWFVDGLNEINQRL-HLFSEIRGLGLLIGCVLNQDYNGQAKQFNQAAAVEGLMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIE 384
           +  NV+R  P L I+  E+ EGL R E
Sbjct: 368 AGANVIRFAPSLIISQAEVKEGLARFE 394


>gi|253690215|ref|YP_003019405.1| succinylornithine transaminase family [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251756793|gb|ACT14869.1| succinylornithine transaminase family [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 408

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 164/368 (44%), Positives = 227/368 (61%), Gaps = 7/368 (1%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           KGKG+ ++ ++G  ++DF+ GIAV +LGH HP LV  L+ Q EKLWH SN++ +      
Sbjct: 30  KGKGSRVWDQDGREYIDFSGGIAVTALGHCHPALVNALQQQGEKLWHTSNIFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ LI +TFADRVFF NSGAE+ E A K AR Y        K +I+ F  AFHGRTL T+
Sbjct: 90  ASKLIDATFADRVFFVNSGAEANEAAFKLARHYAVKRHSPYKTKIIAFYNAFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPIQGEGG+     EFL
Sbjct: 150 SVGGQPKYADGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITPATPEFL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R +CD   ALL+FDEVQ+G GRTGKLF+Y    + PDI+T AK +GGGFPI A L T
Sbjct: 210 QGVRDLCDQHKALLVFDEVQSGMGRTGKLFSYMHYGITPDILTTAKALGGGFPISAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+ M  G HG+TYGGN LA  + E  L+II +   L  V +        L  I  ++
Sbjct: 270 EEIASVMTVGVHGTTYGGNPLACAVAEAALDIINTPEVLSGVADRHDRFVSELEKINQQY 329

Query: 320 PNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRDECLLTAPSSDNVVRILPPLTITAE 374
             +F ++RG GLL+G  LK  +   +   LAA    + L+   +  NV+R +P L I  +
Sbjct: 330 -GVFEQIRGMGLLLGAELKPQWHGRAGEFLAAA-TAQGLMVLMAGPNVIRFVPSLIIDED 387

Query: 375 EIHEGLER 382
           +I +G+ +
Sbjct: 388 DIVQGMAK 395


>gi|238787003|ref|ZP_04630803.1| Succinylornithine transaminase [Yersinia frederiksenii ATCC 33641]
 gi|238724791|gb|EEQ16431.1| Succinylornithine transaminase [Yersinia frederiksenii ATCC 33641]
          Length = 438

 Score =  308 bits (790), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 171/393 (43%), Positives = 240/393 (61%), Gaps = 17/393 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  ++    +G+GA L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 37  DEWIVPTYAPAEFIVVRGEGATLWDQQGKSYIDFAGGIAVNALGHGHPAVKAALVEQADK 96

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY------HYMAG 117
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y      +    
Sbjct: 97  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKPGQ 156

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
           +  K +IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S +  I++ T
Sbjct: 157 QGEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDLASAQALITDQT 216

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV     EFL  LR +CD  +ALLIFDEVQTG GRTG+L+AY    V 
Sbjct: 217 CAVIVEPIQGEGGVLPADREFLHGLRALCDRHNALLIFDEVQTGVGRTGELYAYMHYGVT 276

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I +   
Sbjct: 277 PDVLTSAKALGGGFPIAAMLTTTKYASALNVGSHGTTYGGNPLACAVAGTVLSLINTPEV 336

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSP-----ALLAAKFRD 350
           L  V    +   +GL  I  R+  +F E+RG+GLLIG  L + ++         AA+   
Sbjct: 337 LTGVKERHQWFLDGLAEINARY-KVFAEIRGRGLLIGCVLNSDYAGKSKEIVQAAAQHGL 395

Query: 351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERI 383
             L+  P   +VVR  P L I+ ++I EGL R+
Sbjct: 396 MALIAGP---DVVRFAPSLIISQQDIKEGLARL 425


>gi|324113496|gb|EGC07471.1| acetylornithine and succinylornithine aminotransferase [Escherichia
           fergusonii B253]
          Length = 406

 Score =  308 bits (790), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 229/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMLPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRFGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT   A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEGCASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R   +F E+RG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRC-GLFSEIRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|331683255|ref|ZP_08383856.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli H299]
 gi|331079470|gb|EGI50667.1| succinylornithine transaminase (Succinylornithineaminotransferase)
           [Escherichia coli H299]
          Length = 406

 Score =  308 bits (790), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 230/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFA RVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFAYRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R   +F E+RG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRC-GLFSEIRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|323186928|gb|EFZ72246.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli RN587/1]
          Length = 406

 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 168/385 (43%), Positives = 231/385 (60%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FL  LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLHGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVMPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A+ M  G+HG+TYGGN LA  +  KVL++I +   L   
Sbjct: 249 TTAKALGGGFPVGALLATKECASVMTVGTHGTTYGGNPLASAVAGKVLDLINTPEMLNGG 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L +I + + ++F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNSINHHY-SLFSEVRGLGLLIGCVLNADYAGQAKQISQEAVKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|221133679|ref|ZP_03559984.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Glaciecola sp. HTCC2999]
          Length = 409

 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 170/387 (43%), Positives = 232/387 (59%), Gaps = 9/387 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ND +   Y+ + +   +G G+ ++ ++   ++DFA GIAVN LGH HPELV +LK Q EK
Sbjct: 9   NDVMVPNYNPAAMIPVRGVGSKIWDQDDKEYIDFAGGIAVNVLGHCHPELVNVLKEQGEK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+Y +      A  L  +TFAD V+F NSGAE  E A+K ARR+        K +
Sbjct: 69  LWHLSNVYTNEPALRLAKKLTDATFADMVYFANSGAEVNEAALKLARRWALDHYGPEKDQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK        + DL +L+  IS+ T AI++E
Sbjct: 129 IIAFNQGFHGRTFFTVTVGGQAAYSDGFGPKPGAITHTAYNDLAALEAIISDKTCAIMME 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF++ +R +CD  +ALLIFDEVQ+G GRTG LFAY   +V PDI+T 
Sbjct: 189 PLQGEGGIIVPDPEFVKGVRALCDKHNALLIFDEVQSGVGRTGDLFAYMGLDVVPDILTS 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGG PIGA L T  + + +  G+HGSTYGGN LA  + EK L+II     L  V  
Sbjct: 249 AKSLGGGIPIGAMLTTKAIGSHLKVGTHGSTYGGNPLACAIAEKALDIINDPTILAGVKA 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL------KTVFSPALLAAKFRDECLLTAP 357
              +  E LT I +++  +F EVRG+G+L+G       +      ++AA  +    L A 
Sbjct: 309 KEALFREHLTRINDKY-QVFSEVRGKGMLLGCAMNEKYQGRARDFMVAATEKGTMCLIA- 366

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIE 384
              NVVR  P L I  E+I EGL R E
Sbjct: 367 -GINVVRFAPSLVIPDEDIIEGLRRFE 392


>gi|330811269|ref|YP_004355731.1| bifunctional protein: acetylornithine transaminase;
           succinyldiaminopimelate transaminase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379377|gb|AEA70727.1| Bifunctional protein: Acetylornithine transaminase;
           Succinyldiaminopimelate transaminase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 406

 Score =  308 bits (789), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 165/383 (43%), Positives = 230/383 (60%), Gaps = 17/383 (4%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G G+ ++ ++G   +DFA GIAVN LGH+HP LV  L  Q+ KLWHVSN++ +      
Sbjct: 30  RGAGSRVWDQSGRELIDFAGGIAVNVLGHAHPALVGALTEQANKLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ L+++TFA+R FF NSGAE+ E A K ARR  +    + K+ I+    +FHGRTL T+
Sbjct: 90  AHKLVNATFAERAFFCNSGAEANEAAFKLARRVAFDRFGSEKYEIIAALNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+ +Y +GFGPKI G     + DL +LK  IS+ T A+++EPIQGEGGV    + +L
Sbjct: 150 NVGGQSKYSDGFGPKITGITHVPYNDLAALKAAISDKTCAVVLEPIQGEGGVLPAEQAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q  R +CD  DALL+FDEVQTG GR+G LFAY    V PDI+T AK +GGGFPI A L T
Sbjct: 210 QGARDLCDAHDALLVFDEVQTGMGRSGHLFAYMHYGVVPDILTSAKSLGGGFPIAAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
             +A  +  G+HG+TYGGN LA  + E V++++ +   L  V          L  I  ++
Sbjct: 270 EALAKHLVVGTHGTTYGGNPLACAVAEAVIDVVNTPEVLAGVKAKHHKFKARLEQIGEKY 329

Query: 320 PNMFLEVRGQGLLIGL----------KTVFSPALLAAKFRDECLLTAPSSDNVVRILPPL 369
             +F +VRG GLLIG           K +F+ A        E L+   +  +V+R  P L
Sbjct: 330 -GLFTQVRGLGLLIGCVLNDAWKGKAKDIFNAA------EQEGLMILQAGPDVIRFAPSL 382

Query: 370 TITAEEIHEGLERIERTAIKLSH 392
            +   +I EGL+R ER   KL+ 
Sbjct: 383 VVEDADIDEGLDRFERAVAKLTQ 405


>gi|134045526|ref|YP_001097012.1| acetylornithine aminotransferase [Methanococcus maripaludis C5]
 gi|132663151|gb|ABO34797.1| acetylornithine aminotransferase apoenzyme [Methanococcus
           maripaludis C5]
          Length = 395

 Score =  308 bits (789), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 157/376 (41%), Positives = 239/376 (63%), Gaps = 5/376 (1%)

Query: 1   MNKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ 60
           +++  ++ NTY +  +   KGKG  +F   G  + DF +GI VN++GH HP++V  +K+Q
Sbjct: 11  LDEKKYVINTYGRVPVVLVKGKGMSVFDTEGKEYFDFLAGIGVNNVGHCHPKVVETIKNQ 70

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTN 120
           ++ L H+SN+Y +  Q   A  L++ +  D+ FF NSGAE+ E AIK AR+Y        
Sbjct: 71  AQTLIHISNIYYNVPQIELAKKLVNLSGLDKAFFCNSGAEANEAAIKLARKYGKKK--GK 128

Query: 121 KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAI 180
           +  I+T E AFHGRTL T++A  K +Y EGF P  +GF+   F D+++L   IS  TAAI
Sbjct: 129 EGEIITMEHAFHGRTLTTVTATPKAKYQEGFEPLPQGFNYIPFNDIEALNAGISEKTAAI 188

Query: 181 LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDI 240
           +IEP+QGEGG+    +E+L+ +RK+CD+ + +LIFDEVQ G GRTG +F+YE   V PDI
Sbjct: 189 MIEPVQGEGGIHPADKEYLKAVRKLCDENNIVLIFDEVQCGMGRTGTMFSYEQYGVVPDI 248

Query: 241 MTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLEN 300
           +T+AKG+GGGFPIGA +A +E+A     GSHG+T+GGN LA       +++I   G LEN
Sbjct: 249 VTLAKGLGGGFPIGAMVAKSEIADAFTPGSHGTTFGGNPLACASSNAAIDVIS--GLLEN 306

Query: 301 VINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSD 360
            + + +     L  ++ ++ +   EVR  GL++G++  F+ + + +K  ++  L   +SD
Sbjct: 307 TLEMGEYFRSELKKLEEKY-DFIKEVRSLGLMVGVELTFNGSDIVSKMFEKGFLINCTSD 365

Query: 361 NVVRILPPLTITAEEI 376
            V+R LPPL +  E I
Sbjct: 366 TVLRFLPPLIVEKEHI 381


>gi|226945501|ref|YP_002800574.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Azotobacter vinelandii DJ]
 gi|226720428|gb|ACO79599.1| Acetylornithine and succinylornithine aminotransferase [Azotobacter
           vinelandii DJ]
          Length = 406

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 167/393 (42%), Positives = 235/393 (59%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           + F+   Y  +     +G+G+ ++ +NG   +DF  GIAVNSLGH HP LVA L  Q+ K
Sbjct: 14  DQFMVPNYAPAAFIPVRGQGSRVWDQNGRELIDFTGGIAVNSLGHCHPRLVAALTEQAGK 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWHVSN++ +      A  L  +TFADR FF NSGAE+ E A K ARR  +      K  
Sbjct: 74  LWHVSNIFTNEPTLRLAKKLEEATFADRAFFCNSGAEANEAAFKLARRVAHDRFGPQKCE 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++   +FHGRT  T+S  G+ +Y +GFGPK EG     + DL +L+  IS  T A+++E
Sbjct: 134 IISALDSFHGRTFFTVSVTGQPKYSDGFGPKPEGITHVPYNDLAALEAAISERTCAVVLE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGE G+    + +L+  R++CD  DALLI DEVQTG GRTG+LFAY    V PDI++ 
Sbjct: 194 PIQGESGILPAQQAYLEGARRLCDQYDALLILDEVQTGVGRTGELFAYMHYGVVPDILST 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFPIGA L  +++A   + G HG+T+GGN LA  + E V++++ +   L+ +  
Sbjct: 254 AKGLGGGFPIGAMLTRSDLAKHFSAGVHGTTFGGNPLACAVAEAVIDVVNTPEVLQGIKA 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
             +     L AI  ++  +F +VRG G+LIG       K      L+AA+   E L+   
Sbjct: 314 KHQRFKTRLEAIGRQY-GIFSQVRGMGMLIGSVLSEPWKGKARDVLVAAE--QEALMVLQ 370

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  +VVR  P L I   +I EGLER ER  ++L
Sbjct: 371 AGADVVRFAPSLVIEDADIDEGLERFERAIVRL 403


>gi|62181972|ref|YP_218389.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62129605|gb|AAX67308.1| acetylornithine transaminase (NAcOATase and DapATase) [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|322716460|gb|EFZ08031.1| bifunctional N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 405

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +D    KGKG+ ++ + G  ++DFA GIAV +LGH HP LV  LKSQ E 
Sbjct: 14  DEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +         LI +TFA+RV F NSG E+ E A K AR Y  +     K +
Sbjct: 74  LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGR+L T+S GG+ +Y +GFGPK        F DL ++K  + + T A+++E
Sbjct: 134 IIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVLFNDLHAVKAVMDDHTCAVVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV+    EFL+ LR +CD+  ALL+FDEVQ G GRTG LFAY    V PDI+T 
Sbjct: 194 PIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L T E+A+  + GSHGSTYGGN LA  +     +II +   L+ +  
Sbjct: 254 AKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHT 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----------- 352
             +   + L AI  +F ++F ++RG GLLIG       A L  K++              
Sbjct: 314 KRQQFVQHLQAIDEQF-DIFSDIRGMGLLIG-------AELKPKYKGRARDFLYAGAEAG 365

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           ++   +  +V+R  P L +   +IHEG++R  +   K+
Sbjct: 366 VMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKV 403


>gi|88861000|ref|ZP_01135635.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas tunicata D2]
 gi|88816928|gb|EAR26748.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudoalteromonas tunicata D2]
          Length = 402

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 162/398 (40%), Positives = 239/398 (60%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  S +   +G+G+ ++ +    ++DFA GIAVN LGH HP LV  LK QSEK
Sbjct: 9   DEVMVPNYAPSAVIPVRGEGSHVWDQADNEYIDFAGGIAVNCLGHCHPALVNALKVQSEK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWHV+N+  +      A  L+ +TFAD+V+F NSGAE+ E A+K ARR+       +K +
Sbjct: 69  LWHVANVMANEPAIRLAKKLVDATFADKVYFANSGAEANEAALKLARRFALDNYGEHKSQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F   FHGRT  T++ GG+  Y +GFGPK    D   + DL + +  IS++T A+++E
Sbjct: 129 IIAFNQGFHGRTFFTVTVGGQAAYSDGFGPKPGNIDHCNYNDLAAFEALISDNTCAVMLE 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF+Q +R +CD  +ALLIFDEVQTG GRTG L+AY+   V PDI+T 
Sbjct: 189 PLQGEGGIISPTVEFIQGVRALCDKHNALLIFDEVQTGVGRTGHLYAYQGLAVTPDILTT 248

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++A  +  G+HGSTYGGN LA  + E   + + +   L  V  
Sbjct: 249 AKALGGGFPIGAMLTTTDIAKHLKVGTHGSTYGGNPLACAVAEAAFDTVNTPEVLNGVKE 308

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR-----------DEC 352
              +  +  T I +++ ++F E+RG+GLL+G       A++A +++           D  
Sbjct: 309 KEALFRQLFTQINDKY-HVFKEMRGEGLLLG-------AVVAEQYQGKARDFMLASIDNG 360

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           L+   +  NVVR  P L I   +I EG+ R E+   ++
Sbjct: 361 LMALVAGVNVVRFAPSLVIPEADIREGMARFEKAVAQV 398


>gi|325271436|ref|ZP_08137961.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas sp. TJI-51]
 gi|324103418|gb|EGC00740.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Pseudomonas sp. TJI-51]
          Length = 406

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/380 (43%), Positives = 232/380 (61%), Gaps = 11/380 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ ++G   +DFA GIAVN+LGH HP LV  L  Q+  LWHVSN++ +      
Sbjct: 30  RGEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANTLWHVSNVFTNEPALRL 89

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A+ L+++TFADR FF NSGAE+ E A K ARR  +      K  I+    +FHGRTL T+
Sbjct: 90  AHKLVNATFADRAFFCNSGAEANEAAFKLARRVAHDRFGPEKHEIIATVNSFHGRTLFTV 149

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPKI G     + DL++LK QIS+ T A++IEPIQGE GV    + +L
Sbjct: 150 SVGGQPKYSDGFGPKITGISHVPYNDLEALKAQISDKTCAVVIEPIQGESGVVPADKAYL 209

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           +  RK+CD+ +ALLIFDEVQTG GRTG L+AY+   V PDI+T AK +GGGFPIGA L T
Sbjct: 210 EGARKLCDEHNALLIFDEVQTGVGRTGSLYAYQHYGVTPDILTSAKSLGGGFPIGAMLTT 269

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A  +  G+HG+TYGGN L   +   VL+++ +   L  +          L  I  ++
Sbjct: 270 TELAKHLTVGTHGTTYGGNPLGCAVACAVLDVVNTPETLAGIKAKHARFKARLEQIGQKY 329

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
            N+F +VRG GLL+G   V + A    K +D       E ++   +  +VVR  P L + 
Sbjct: 330 -NLFSQVRGVGLLLG--CVLAEA-WQGKAKDVLNAAEKEGVMVLQAGPDVVRFAPSLVVE 385

Query: 373 AEEIHEGLERIERTAIKLSH 392
             +I  GL+R ER    L+ 
Sbjct: 386 DADIDAGLDRFERAVATLTQ 405


>gi|315182017|gb|ADT88930.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Vibrio furnissii NCTC 11218]
          Length = 404

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 172/398 (43%), Positives = 236/398 (59%), Gaps = 8/398 (2%)

Query: 2   NKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILK 58
           N+ DF   +   +  +     +G+G+ ++ + G  ++DFA GIAVN+LGH+ P L A+L 
Sbjct: 6   NRTDFDQYMIPMFSPAPFIPVRGEGSTVYDQQGKQYIDFAGGIAVNALGHASPLLKAVLT 65

Query: 59  SQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGK 118
            Q++KLWH+ N Y +      A  L+ STFAD+VFF NSGAE+ E A+K AR+Y      
Sbjct: 66  EQADKLWHLGNGYTNEPVLALARTLVESTFADKVFFCNSGAEANEAALKLARKYALDKHG 125

Query: 119 TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTA 178
           ++K  IV F  AFHGRTL T++AGG+ +Y + F P   G     F DL + K  I   T 
Sbjct: 126 SDKNEIVAFRNAFHGRTLFTVTAGGQPKYSQDFAPLPGGIHHVDFNDLNAAKQVIGPQTC 185

Query: 179 AILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP 238
           A+++EP+QGEGGV     EFLQ LR +CD+ DA+LIFDEVQTG GRTG L+AY    V P
Sbjct: 186 AVIVEPMQGEGGVVPATPEFLQGLRALCDEHDAVLIFDEVQTGVGRTGHLYAYMHYGVAP 245

Query: 239 DIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFL 298
           D+++ AK +GGGFPIG  L TN+ A  ++ G+HG+TYGGN LA  +   VL+ I  D FL
Sbjct: 246 DVLSTAKALGGGFPIGGILTTNQFAPALSVGTHGTTYGGNPLAAAVAGAVLSEINQDAFL 305

Query: 299 ENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR----DECLL 354
           + V          L +I  +   +F +VRG GLLIG +     A  A        +  L+
Sbjct: 306 QGVKAKHDHFVTRLESINAKL-GVFKQVRGLGLLIGCELTAEHAGQAKTISNMAAEHGLM 364

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH 392
           T  +  NVVR  P L IT  EI  GL+R+E+     +H
Sbjct: 365 TLIAGPNVVRFAPALNITTHEIDAGLDRLEQALEAFTH 402


>gi|260769487|ref|ZP_05878420.1| succinylornithine transaminase [Vibrio furnissii CIP 102972]
 gi|260614825|gb|EEX40011.1| succinylornithine transaminase [Vibrio furnissii CIP 102972]
          Length = 404

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 172/398 (43%), Positives = 236/398 (59%), Gaps = 8/398 (2%)

Query: 2   NKNDF---LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILK 58
           N+ DF   +   +  +     +G+G+ ++ + G  ++DFA GIAVN+LGH+ P L A+L 
Sbjct: 6   NRTDFDQYMIPMFSPAPFIPVRGEGSTVYDQQGKQYIDFAGGIAVNALGHASPLLKAVLT 65

Query: 59  SQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGK 118
            Q++KLWH+ N Y +      A  L+ STFAD+VFF NSGAE+ E A+K AR+Y      
Sbjct: 66  EQADKLWHLGNGYTNEPVLALARTLVESTFADKVFFCNSGAEANEAALKLARKYALDKHG 125

Query: 119 TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTA 178
           ++K  IV F  AFHGRTL T++AGG+ +Y + F P   G     F DL + K  I   T 
Sbjct: 126 SDKNEIVAFRNAFHGRTLFTVTAGGQPKYSQDFAPLPGGIHHVDFNDLDAAKQVIGPQTC 185

Query: 179 AILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP 238
           A+++EP+QGEGGV     EFLQ LR +CD+ DA+LIFDEVQTG GRTG L+AY    V P
Sbjct: 186 AVIVEPMQGEGGVVPATPEFLQGLRALCDEHDAVLIFDEVQTGVGRTGHLYAYMHYGVAP 245

Query: 239 DIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFL 298
           D+++ AK +GGGFPIG  L TN+ A  ++ G+HG+TYGGN LA  +   VL+ I  D FL
Sbjct: 246 DVLSTAKALGGGFPIGGILTTNQFAPALSVGTHGTTYGGNPLAAAVAGAVLSEINQDAFL 305

Query: 299 ENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFR----DECLL 354
           + V          L +I  +   +F +VRG GLLIG +     A  A        +  L+
Sbjct: 306 QGVKAKHDHFVTRLESINAKL-GVFKQVRGLGLLIGCELTAEHAGQAKTISNMAAEHGLM 364

Query: 355 TAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH 392
           T  +  NVVR  P L IT  EI  GL+R+E+     +H
Sbjct: 365 TLIAGPNVVRFAPALNITTHEIDTGLDRLEQALEAFTH 402


>gi|301020972|ref|ZP_07185024.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 196-1]
 gi|299881727|gb|EFI89938.1| N-succinyldiaminopimelate-aminotransferase/acetylornithine
           transaminase protein [Escherichia coli MS 196-1]
          Length = 406

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 229/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQG GGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGVGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|170732507|ref|YP_001764454.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Burkholderia cenocepacia MC0-3]
 gi|254245857|ref|ZP_04939178.1| Acetylornithine and succinylornithine aminotransferase
           [Burkholderia cenocepacia PC184]
 gi|124870633|gb|EAY62349.1| Acetylornithine and succinylornithine aminotransferase
           [Burkholderia cenocepacia PC184]
 gi|169815749|gb|ACA90332.1| succinylornithine transaminase family [Burkholderia cenocepacia
           MC0-3]
          Length = 410

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 169/378 (44%), Positives = 227/378 (60%), Gaps = 19/378 (5%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++ +G+ ++   G  ++DFA GIAV SLGH HPEL+ +L  Q  KLWH+ N Y +     
Sbjct: 27  DRAEGSRVWDTAGREYIDFACGIAVTSLGHGHPELLKVLDEQGRKLWHIGNGYTNEPVLR 86

Query: 79  FANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLAT 138
            A  L   TFADR FF NSGAE+ E A+K ARR  +     +K+ IV+F  +FHGRT  T
Sbjct: 87  LAKRLESLTFADRAFFANSGAEANEAALKLARRVAFDRHGADKYEIVSFVQSFHGRTFFT 146

Query: 139 ISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEF 198
           +S GG+ +Y EGFGP  EG     F D+++ K  I   T A+++EP+QGEGGV      F
Sbjct: 147 VSVGGQPKYSEGFGPVPEGIKHLPFNDIEAAKAAIGPKTCAVIVEPVQGEGGVIPADPAF 206

Query: 199 LQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLA 258
           L+ LR+ CD  DALLIFDEVQTG GRTG+ +AY    V PDI+T AK +G GFPIGA L 
Sbjct: 207 LKALREACDANDALLIFDEVQTGVGRTGQFYAYMDTGVTPDILTTAKALGNGFPIGAMLT 266

Query: 259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR 318
           TNE+AA    G HG+TYGGN LA  + +KV+ +I     LE V   +  L   L  I  R
Sbjct: 267 TNELAAHFKVGVHGTTYGGNPLASAIADKVVELIGDPALLEGVRERSVRLKGALERINAR 326

Query: 319 FPNMFLEVRGQGLLIGLKTVFSPALLAAKF--RDECLLTAPSSD---------NVVRILP 367
           F  +F ++RG+GLL+G       A L A F  R +  +TA + +         NV+R +P
Sbjct: 327 F-GIFKDIRGKGLLVG-------AELTAAFDGRAKDFVTAAAENGLIMLIAGPNVLRFVP 378

Query: 368 PLTITAEEIHEGLERIER 385
            L I  + + EG++R E+
Sbjct: 379 SLVIPFDLLDEGVKRFEK 396


>gi|82543849|ref|YP_407796.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Shigella boydii Sb227]
 gi|187733826|ref|YP_001880542.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Shigella boydii CDC 3083-94]
 gi|118572871|sp|Q321P0|ASTC_SHIBS RecName: Full=Succinylornithine transaminase; Short=SOAT; AltName:
           Full=Succinylornithine aminotransferase
 gi|254807569|sp|B2U3D0|ASTC_SHIB3 RecName: Full=Succinylornithine transaminase; AltName:
           Full=Succinylornithine aminotransferase
 gi|81245260|gb|ABB65968.1| acetylornithine delta-aminotransferase [Shigella boydii Sb227]
 gi|187430818|gb|ACD10092.1| succinylornithine transaminase [Shigella boydii CDC 3083-94]
 gi|320184214|gb|EFW59029.1| Succinylornithine transaminase [Shigella flexneri CDC 796-83]
 gi|332096366|gb|EGJ01367.1| acetylornithine/succinyldiaminopimelate aminotransferase [Shigella
           boydii 3594-74]
          Length = 406

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 168/385 (43%), Positives = 229/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             I+ F+ AFHGRTL T+SAGG+  Y + F P       A + D+ S    I + T A++
Sbjct: 129 SGIMAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GG FP+GA L T E A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGDFPVGALLTTEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|207858709|ref|YP_002245360.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|206710512|emb|CAR34870.1| acetylornithine aminotransferase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 405

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 164/398 (41%), Positives = 232/398 (58%), Gaps = 19/398 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y  +D    KGKG+ ++ + G  ++DFA GIAV  LGH HP LV  LKSQ E 
Sbjct: 14  DEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTVLGHCHPALVEALKSQGET 73

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH SN++ +         LI +TFA+RV F NSG E+ E A K AR Y  +     K +
Sbjct: 74  LWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTK 133

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F  AFHGR+L T+S GG+ +Y +GFGPK        F DL ++K  + + T A+++E
Sbjct: 134 IIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVE 193

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV+    EFL+ LR +CD+  ALL+FDEVQ G GRTG LFAY    V PDI+T 
Sbjct: 194 PIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTS 253

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFP+ A L T E+A+  + GSHGSTYGGN LA  +     +II +   L+ +  
Sbjct: 254 AKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHT 313

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----------- 352
             +   + L AI  +F ++F ++RG GLLIG       A L  K++D             
Sbjct: 314 KRQQFVQHLQAIDEQF-DIFSDIRGMGLLIG-------AELKPKYKDRARDFLYAGAEAG 365

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           ++   +  +V+R  P L +   +I+EG++R  +   K+
Sbjct: 366 VMVLNAGADVMRFAPSLVVEDADINEGMQRFAQAVGKV 403


>gi|330721141|gb|EGG99266.1| Acetylornithine aminotransferase [gamma proteobacterium IMCC2047]
          Length = 415

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/379 (42%), Positives = 232/379 (61%), Gaps = 4/379 (1%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L +TY ++D  FE G+GAWLF  NG  +LD  SGIAV  LGHSHP +   ++ Q+ +L H
Sbjct: 6   LMDTYKRADTAFEMGQGAWLFDTNGNKYLDLLSGIAVCGLGHSHPAVTHAIRDQAGRLLH 65

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNLY+   Q   AN L   +  D+VFF NSGAE+ E AIK AR Y +  G  N   I+ 
Sbjct: 66  TSNLYEIPLQTELANRLTKVSGMDKVFFCNSGAEANEAAIKLARLYGHKQG-INTPNIIV 124

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN--DTAAILIEP 184
            + AFHGRT+AT++A G  +   GF P + GF +A + D+ ++K    N  D  AI +EP
Sbjct: 125 VDSAFHGRTMATLTATGNRKAQAGFEPLVNGFIRAPYDDIDAIKTIAGNTPDVVAIFVEP 184

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQGEGGV    E +L +LR +CD+ + LL+ DEVQTG GRTGK FAY+  N+ PD++T A
Sbjct: 185 IQGEGGVHVPAENYLNELRTLCDENNWLLMLDEVQTGNGRTGKYFAYQHNNILPDVVTTA 244

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           KG+G G PIGACLA  + A+ +  G+HGST+GGN L        ++ +  D  +E   ++
Sbjct: 245 KGLGNGVPIGACLAQGKAASVLQAGTHGSTFGGNPLVCAAALATVDTLIHDKLIERAESL 304

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
            + + +GL A +    +   ++RG+GL+IG++       L    + + LL   ++++V+R
Sbjct: 305 GQRMLDGLKA-RLADADYITDIRGKGLMIGIELNEPCTELVMLAKAKGLLINVTANSVIR 363

Query: 365 ILPPLTITAEEIHEGLERI 383
           +LPPL +T EE    +E I
Sbjct: 364 LLPPLILTDEEADLAVEAI 382


>gi|256005551|ref|ZP_05430511.1| acetylornithine and succinylornithine aminotransferase [Clostridium
           thermocellum DSM 2360]
 gi|281418916|ref|ZP_06249934.1| acetylornithine and succinylornithine aminotransferase [Clostridium
           thermocellum JW20]
 gi|255990459|gb|EEU00581.1| acetylornithine and succinylornithine aminotransferase [Clostridium
           thermocellum DSM 2360]
 gi|281407373|gb|EFB37633.1| acetylornithine and succinylornithine aminotransferase [Clostridium
           thermocellum JW20]
 gi|316941528|gb|ADU75562.1| acetylornithine and succinylornithine aminotransferase [Clostridium
           thermocellum DSM 1313]
          Length = 400

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 165/376 (43%), Positives = 236/376 (62%), Gaps = 9/376 (2%)

Query: 6   FLFNTY-DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL 64
           +  NT+ +++ + F  GKG  L+  NG  + DF +GIAVN+LGHSHP+LV  +K Q+EKL
Sbjct: 13  YFMNTFGNRTPVCFSHGKGINLWDINGKKYYDFLAGIAVNALGHSHPKLVNAIKQQAEKL 72

Query: 65  WHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRI 124
            H SNLY    Q   A  L+  + AD+VFF NSGAE+ E AIK AR Y    G   K+ I
Sbjct: 73  IHCSNLYYIESQAKLAEKLVSISCADKVFFANSGAEANEGAIKLARIYFKKKGMPEKYEI 132

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEP 184
           +T E +FHGRTLATI+A G+ +Y + + P    F +    DL++L+  I++ T A++IEP
Sbjct: 133 ITLEKSFHGRTLATIAATGQDKYQKPYCPLTPKFLKVPINDLEALEKAINSSTCAVMIEP 192

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           IQGE GV     E+++ +RK+CD+   LLIFDEVQ G GRTGKLFAYE   V+PDI T+A
Sbjct: 193 IQGESGVNLTSVEYMKGVRKLCDEKGILLIFDEVQCGLGRTGKLFAYEHFGVEPDIFTLA 252

Query: 245 KGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
           K +GGGFPIGA  A   VA+    G HGST+GGN LA       L++I  +G +EN   +
Sbjct: 253 KALGGGFPIGALCAKEHVASAFEPGDHGSTFGGNPLACTAALAALDVIIEEGLVENSAKM 312

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECL----LTAPSSD 360
                  L+ +  ++ ++  EVRG+GL+IG++     A+   + +++C     L     +
Sbjct: 313 GTYFMSKLSELAEKY-SIIQEVRGKGLMIGVQLSIDAAV---EIKNKCFEKGYLIGSIGN 368

Query: 361 NVVRILPPLTITAEEI 376
           N++R+LPPL +T ++I
Sbjct: 369 NILRMLPPLIVTEQDI 384


>gi|226314886|ref|YP_002774782.1| acetylornithine aminotransferase [Brevibacillus brevis NBRC 100599]
 gi|226097836|dbj|BAH46278.1| acetylornithine aminotransferase [Brevibacillus brevis NBRC 100599]
          Length = 393

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/374 (41%), Positives = 229/374 (61%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           L N Y +  I   KG+G  ++   G  +LDF SGIAV SLGH  P++ A L  Q + LWH
Sbjct: 10  LMNNYARWPISLVKGQGNQVWDNQGRQYLDFTSGIAVTSLGHVPPKVTAKLHEQLDTLWH 69

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            SNL    QQEI A  L   +  D+ FF NSGAE+ E  IK ARRY      T+++ I++
Sbjct: 70  CSNLVHVPQQEILAEKLSRLSGLDQAFFCNSGAEANEGLIKLARRYAQKIKGTDRYEIIS 129

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FE +FHGRTLAT++A G+ +  +GF P  +GF    + DL ++K+ I++ T AI++E +Q
Sbjct: 130 FEQSFHGRTLATLTATGQEKVKDGFAPLPQGFVTVPYNDLDAVKSAITDKTCAIMLELVQ 189

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGV    E +++ LR++CD    LL+ DE+QTG GRTG  FA++  +VKPD +++AKG
Sbjct: 190 GEGGVHPAEEAWVKALRELCDAHGLLLLIDEIQTGIGRTGTWFAFQHYDVKPDAISLAKG 249

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G GFPIGA +AT EVA     G+HG+T+GGN LA   G   L  ++ +  LE V +I  
Sbjct: 250 LGSGFPIGAVVATKEVAEAFAPGTHGTTFGGNPLAATAGIATLATMEEEQILERVAHIHD 309

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRIL 366
           +L + L  +K   P+  + VRG+GLL+G++         A  R++ ++   +   VVR+L
Sbjct: 310 VLIKELEKLKAEHPDKVVTVRGKGLLLGVELTIPAGEPVAYAREKGVILLMAGPQVVRLL 369

Query: 367 PPLTITAEEIHEGL 380
           P    T EE+ + +
Sbjct: 370 PSFVTTDEEVKQAI 383


>gi|290512901|ref|ZP_06552265.1| succinylornithine aminotransferase [Klebsiella sp. 1_1_55]
 gi|289774514|gb|EFD82518.1| succinylornithine aminotransferase [Klebsiella sp. 1_1_55]
          Length = 406

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 167/391 (42%), Positives = 234/391 (59%), Gaps = 5/391 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++   Y  +     +G G+ L+ + G  ++DFA GIAVN+LGH+HP LV  L  Q+ K
Sbjct: 11  DEWMMPVYAPAAFIPVRGAGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVQALTDQASK 70

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
            WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR+Y +    + K  
Sbjct: 71  FWHTGNGYTNEPILRLAKMLIDATFADRVFFCNSGAEANEAALKLARKYAHDRFGSEKSG 130

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           IV F+ AFHGRTL T+SAGG+  Y   F P       A F DL+S K  I++ T A+++E
Sbjct: 131 IVAFQNAFHGRTLFTVSAGGQPAYSRDFAPLPPQIQHAVFNDLESAKALINDQTCAVIVE 190

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGGV     EFL+ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++T 
Sbjct: 191 PVQGEGGVVPASGEFLRGLRQLCDQHNALLIFDEVQTGVGRTGELYAYMHYGVTPDVLTT 250

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA LAT   A+ M  G+HG+TYGGN LA  +  ++L+I+ +   L  V  
Sbjct: 251 AKALGGGFPIGALLATEACASVMTVGTHGTTYGGNPLAGAVAGELLSIVNTPEVLSGVRQ 310

Query: 304 IAKILFEGLTAIKNRFPNMFLEVR----GQGLLIGLKTVFSPALLAAKFRDECLLTAPSS 359
             +   E L AI  R+  +F E+R      G ++          L+    +E ++   + 
Sbjct: 311 RHQWFCERLQAINARY-GLFKEIRGLGLLLGCVLNDAWAGKAKTLSNLAAEEGVMILIAG 369

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKL 390
            NVVR  P L ++ EE++ GL+R+ER   + 
Sbjct: 370 ANVVRFAPALNVSEEEVNSGLDRVERACARF 400


>gi|221214036|ref|ZP_03587009.1| succinylornithine transaminase [Burkholderia multivorans CGD1]
 gi|221166213|gb|EED98686.1| succinylornithine transaminase [Burkholderia multivorans CGD1]
          Length = 410

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 225/371 (60%), Gaps = 5/371 (1%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++ +G+ ++  +G  ++DFA GIAV SLGH HPEL+ +L  QS KLWH+ N Y +     
Sbjct: 27  DRAEGSRVWDTDGREYIDFACGIAVTSLGHGHPELLKVLDEQSRKLWHIGNGYTNEPVLR 86

Query: 79  FANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLAT 138
            A  L   TFADR FF NSGAE+ E A+K ARR  +     +KF IV+F  +FHGRT  T
Sbjct: 87  LAKRLESLTFADRAFFANSGAEANEAALKLARRVAFDRHGADKFEIVSFVQSFHGRTFFT 146

Query: 139 ISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEF 198
           +S GG+ +Y EGFGP   G     + D+++ K  I   T A+++EP+QGEGGV      F
Sbjct: 147 VSVGGQPKYSEGFGPVPAGIKHLPYNDIEAAKAAIGPQTCAVIVEPVQGEGGVIPADPAF 206

Query: 199 LQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLA 258
           L+ LR+ CD  DALLIFDEVQTG GRTG+ +AY    V PDI+T AK +G GFPIGA L 
Sbjct: 207 LKALREACDANDALLIFDEVQTGVGRTGQFYAYMDTGVTPDILTTAKALGNGFPIGAMLT 266

Query: 259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR 318
           TN +AA    G HG+TYGGN LA  + +KV+ +I     LE V   +  L   L  +  R
Sbjct: 267 TNALAAHFKVGVHGTTYGGNPLASAIADKVVELISEPALLEGVRERSVRLKGALERVNAR 326

Query: 319 FPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNVVRILPPLTITAE 374
           F  +F +VRG+GLL+G +   +    A  F     ++ L+   +  NV+R +P L I  +
Sbjct: 327 F-GIFKDVRGKGLLVGAELTAAFEGRAKDFVNAAAEQGLIMLIAGPNVLRFVPSLVIPFD 385

Query: 375 EIHEGLERIER 385
            + EG++R E+
Sbjct: 386 LLDEGVKRFEK 396


>gi|161525294|ref|YP_001580306.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Burkholderia multivorans ATCC 17616]
 gi|189349968|ref|YP_001945596.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Burkholderia multivorans ATCC 17616]
 gi|160342723|gb|ABX15809.1| succinylornithine transaminase family [Burkholderia multivorans
           ATCC 17616]
 gi|189333990|dbj|BAG43060.1| acetylornithine aminotransferase [Burkholderia multivorans ATCC
           17616]
          Length = 410

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 225/371 (60%), Gaps = 5/371 (1%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++ +G+ ++  +G  ++DFA GIAV SLGH HPEL+ +L  QS KLWH+ N Y +     
Sbjct: 27  DRAEGSRVWDTDGREYIDFACGIAVTSLGHGHPELLKVLDKQSRKLWHIGNGYTNEPVLR 86

Query: 79  FANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLAT 138
            A  L   TFADR FF NSGAE+ E A+K ARR  +     +KF I++F  +FHGRT  T
Sbjct: 87  LAKRLESLTFADRAFFANSGAEANEAALKLARRVAFDRHGADKFEIISFVQSFHGRTFFT 146

Query: 139 ISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEF 198
           +S GG+ +Y EGFGP   G     + D+++ K  I   T A+++EP+QGEGGV      F
Sbjct: 147 VSVGGQPKYSEGFGPVPAGIKHLPYNDIEAAKAAIGPQTCAVIVEPVQGEGGVIPADPAF 206

Query: 199 LQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLA 258
           L+ LR+ CD  DALLIFDEVQTG GRTG+ +AY    V PDI+T AK +G GFPIGA L 
Sbjct: 207 LKALREACDAHDALLIFDEVQTGVGRTGQFYAYMDTGVTPDILTTAKALGNGFPIGAMLT 266

Query: 259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR 318
           T E+AA    G HG+TYGGN LA  + +KV+ +I     LE V   +  L   L  I  R
Sbjct: 267 TKELAAHFKVGVHGTTYGGNPLASAIADKVVELISEPALLEGVRERSVRLKGALERINAR 326

Query: 319 FPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNVVRILPPLTITAE 374
           F  +F +VRG+GLL+G +   +    A  F     ++ L+   +  NV+R +P L I  +
Sbjct: 327 F-GIFKDVRGKGLLVGAELTAAFEGRAKDFVNAAAEQGLIMLIAGPNVLRFVPSLVIPFD 385

Query: 375 EIHEGLERIER 385
            + EG++R E+
Sbjct: 386 LLDEGVKRFEK 396


>gi|51596285|ref|YP_070476.1| bifunctional succinylornithine transaminase/acetylornithine
           transaminase [Yersinia pseudotuberculosis IP 32953]
 gi|81691785|sp|Q66B21|ASTC_YERPS RecName: Full=Succinylornithine transaminase; Short=SOAT; AltName:
           Full=Succinylornithine aminotransferase
 gi|51589567|emb|CAH21197.1| succinylornithine aminotransferase [Yersinia pseudotuberculosis IP
           32953]
          Length = 414

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 173/393 (44%), Positives = 242/393 (61%), Gaps = 17/393 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +++L  TY  +D    +G+G+ L+ + G  ++DFA GIAVN+LGH HP + A L  Q++K
Sbjct: 13  DEWLVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHY-----MAGK 118
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y        AG+
Sbjct: 73  VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKAGQ 132

Query: 119 TN-KFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
              K +IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S ++ I++ T
Sbjct: 133 QGEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGIHHGIFNDLASAEHLITDQT 192

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV    +EFL  LR +CD  +ALLIFDE+QTG GRTG+L+AY    V 
Sbjct: 193 CAVIVEPIQGEGGVLPADKEFLHGLRALCDRHNALLIFDEIQTGVGRTGELYAYMHYGVS 252

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPIGA L T + A+ ++ GSHG+T+GGN LA  +   VL++I     
Sbjct: 253 PDVLTSAKALGGGFPIGAMLTTTKYASALSVGSHGTTFGGNPLACAVAGTVLSLINQPTL 312

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSP-----ALLAAKFRD 350
           L  V    +   + L  I  R  N+F E+RG+GLLIG  L   ++         AA++  
Sbjct: 313 LAGVKARHQWFIDELAEINARH-NVFAEIRGRGLLIGCVLNAQYAGKSKEIVQAAAQYGL 371

Query: 351 ECLLTAPSSDNVVRILPPLTITAEEIHEGLERI 383
             L+  P   +VVR  P L I+ +EI EGL R+
Sbjct: 372 IALIAGP---DVVRFAPSLIISPKEIKEGLARL 401


>gi|167581201|ref|ZP_02374075.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Burkholderia thailandensis TXDOH]
          Length = 411

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 167/387 (43%), Positives = 225/387 (58%), Gaps = 5/387 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   +  +    ++G+G+ ++   G  ++DFA GIAV +LGH HPEL+ +L  QS K
Sbjct: 12  DEVMVPVFSPAPFVPDRGEGSRVWDTEGRDYVDFAGGIAVTALGHGHPELLKVLDEQSRK 71

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+ N Y +      A  L   TFADR FF NSGAE+ E A+K ARR  +     +K+ 
Sbjct: 72  LWHIGNGYTNEPVLRLAKRLESLTFADRAFFANSGAEANEAALKLARRVAFERHGADKYE 131

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           IV+F  +FHGRT  T+S GG+ +Y EGFGP  EG     F D+ + +  I   T A+++E
Sbjct: 132 IVSFLQSFHGRTFFTVSVGGQPKYSEGFGPVPEGIKHLPFNDIAAARAAIGPKTCAVIVE 191

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV      FL+ LR+ CD   ALLIFDEVQTG GRTG  +AY    V PDI+T 
Sbjct: 192 PIQGEGGVIPADPAFLKALREACDAHGALLIFDEVQTGVGRTGHFYAYMGTGVTPDILTT 251

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +G GFPIGA L T  +AA    G HG+TYGGN LA  + EKV+ ++     LE V  
Sbjct: 252 AKALGNGFPIGAMLTTEALAAHFKVGVHGTTYGGNPLASAIAEKVVELVSDPALLEGVNE 311

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSS 359
            +  L   L  I  RF  +F EVRG+GLLIG + V +    A  F     +  ++   + 
Sbjct: 312 RSARLTATLEKINARF-KLFKEVRGKGLLIGAELVGALDGRAKDFVSAAAEHGVIMLIAG 370

Query: 360 DNVVRILPPLTITAEEIHEGLERIERT 386
            NV+R  P L I  + + EGL R E+ 
Sbjct: 371 PNVLRFAPSLVIPLDVLDEGLARFEKA 397


>gi|241954800|ref|XP_002420121.1| acetylornithine aminotransferase, mitochondrial precursor, putative
           [Candida dubliniensis CD36]
 gi|223643462|emb|CAX42341.1| acetylornithine aminotransferase, mitochondrial precursor, putative
           [Candida dubliniensis CD36]
          Length = 456

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/393 (42%), Positives = 237/393 (60%), Gaps = 13/393 (3%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +   TY + ++    GKG++++      ++DF SGIAV  LGHS+  +  ++K QSEKL 
Sbjct: 60  YSVTTYARPNLVLTHGKGSYIYDLEDRKYIDFTSGIAVTCLGHSYEPITELIKQQSEKLI 119

Query: 66  HVSNLYQSTQQEIFANHLIHSTF-------ADRVFFTNSGAESVECAIKTARRYHYMAGK 118
           H SNLY +      +N LI+ T        A RVF  NSG E+ E A+K AR+Y     K
Sbjct: 120 HCSNLYYNLPAGELSNKLINKTKEFEGMKDASRVFLCNSGTEANEAALKFARKYGKTINK 179

Query: 119 TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND-T 177
             K+  +TFE +FHGR++  +S     +Y E F P I G   AK  D++S+K  I+ D T
Sbjct: 180 -EKYEFITFENSFHGRSMGALSVTPNPKYQEPFSPLIPGVKIAKPNDIESVKQVINKDKT 238

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW--AN 235
            A++IEP+QGEGGV  + E FL +LRK+CD+ + LLI+DE+Q G GRTGKL+A+ W    
Sbjct: 239 CAVIIEPLQGEGGVNLIDESFLIELRKLCDENNVLLIYDEIQCGLGRTGKLWAHSWLSPQ 298

Query: 236 VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSD 295
             PDI+TIAK +G GFPIGA + T +V + +N G HG+TYGGN LA  +G  +++ I   
Sbjct: 299 AHPDIVTIAKALGNGFPIGATMITEKVESSLNVGDHGTTYGGNPLASSVGSFIVDHIADK 358

Query: 296 GFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL--KTVFSPALLAAKFRDECL 353
            FL  V N +KI  EGL  I N +PN+  +V+G+GLL+GL  K       + AK R   L
Sbjct: 359 EFLTQVGNKSKIFLEGLNKISNEYPNLIEKVKGKGLLLGLQFKQNVDIGEIVAKCRQHGL 418

Query: 354 LTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
           L   +  N +R++P L I  + I +GLE + ++
Sbjct: 419 LIITAGMNTIRLVPALNIPDQTIKDGLEILTQS 451


>gi|194428553|ref|ZP_03061092.1| succinylornithine transaminase [Escherichia coli B171]
 gi|194413431|gb|EDX29714.1| succinylornithine transaminase [Escherichia coli B171]
 gi|323158545|gb|EFZ44560.1| acetylornithine/succinyldiaminopimelate aminotransferase
           [Escherichia coli E128010]
          Length = 406

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 169/385 (43%), Positives = 229/385 (59%), Gaps = 5/385 (1%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
           N ++++   Y  +     +G+G+ L+ + G  ++DFA GIAVN+LGH+HPEL   L  Q+
Sbjct: 9   NFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK 121
            K WH  N Y +      A  LI +TFADRVFF NSGAE+ E A+K AR++ +    ++K
Sbjct: 69  SKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHK 128

Query: 122 FRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAIL 181
             IV F+ AFHGRTL T+SAGG+    + F P       A + D+ S    I + T A++
Sbjct: 129 SGIVAFKNAFHGRTLFTVSAGGQPACSQDFAPLPADIRHAAYNDINSASALIDDSTCAVI 188

Query: 182 IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           +EPIQGEGGV      FLQ LR++C+  +ALLIFDEVQTG GRTG+L+AY    V PD++
Sbjct: 189 VEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248

Query: 242 TIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENV 301
           T AK +GGGFP+GA LAT E A  M  G+HG+TYGGN LA  +  KVL +I +   L  V
Sbjct: 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308

Query: 302 INIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC----LLTAP 357
                   E L  I +R+  +F EVRG GLLIG       A  A +   E     ++   
Sbjct: 309 KQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLI 367

Query: 358 SSDNVVRILPPLTITAEEIHEGLER 382
           +  NVVR  P L ++ EE+  GL+R
Sbjct: 368 AGGNVVRFAPALNVSEEEVTTGLDR 392


>gi|92114925|ref|YP_574853.1| acetylornithine aminotransferase [Chromohalobacter salexigens DSM
           3043]
 gi|91798015|gb|ABE60154.1| acetylornithine aminotransferase apoenzyme [Chromohalobacter
           salexigens DSM 3043]
          Length = 404

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 235/373 (63%), Gaps = 9/373 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ L+ ++G  ++DFA GIAVN+LGH HP LV+ LK Q++KLWH+SN+Y +      
Sbjct: 27  RGEGSRLWDQDGREYIDFAGGIAVNALGHCHPALVSALKGQADKLWHLSNVYTNEPALAL 86

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L+  TFAD+ +F +SG E+ E A K ARR+ +     +K +I++F  +FHGRTL T+
Sbjct: 87  AKSLVERTFADKAYFCSSGGEANEAAFKLARRWAHDTHGAHKDKIISFRQSFHGRTLFTV 146

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y EGFGP     + A + DL S++  I + T A+++EP+QGEGGV     +FL
Sbjct: 147 SVGGQPKYSEGFGPIPGRIEHAVYNDLDSVRELIDDATCAVVVEPMQGEGGVVPAEADFL 206

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
             LR +CD+  ALL+FDEVQ+G GR+G L+AY    V PDI+T AK +GGGFP+GA L T
Sbjct: 207 HGLRALCDEHQALLVFDEVQSGVGRSGYLYAYMHYGVTPDILTTAKALGGGFPVGAMLTT 266

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
           + VA  +  G+HGSTYGGN LA  +    +  I +   L  V+    +  E L AI NR 
Sbjct: 267 DRVAPSLAVGTHGSTYGGNPLACAVALAAVETIDTPEVLSGVMRRHALFKEHLEAI-NRR 325

Query: 320 PNMFLEVRGQGLLIGLKTVFSPAL------LAAKFRDECLLTAPSSDNVVRILPPLTITA 373
             +F EVRG GLL+G +   +PA       +     +E L+   +  NV+R+ P L I+ 
Sbjct: 326 HGVFKEVRGLGLLLGAE--MAPAYEGRAKEILPLAMEEGLMALVAGPNVLRMAPSLVISD 383

Query: 374 EEIHEGLERIERT 386
            +++EG+ R+ER 
Sbjct: 384 TDVNEGMARLERA 396


>gi|134295210|ref|YP_001118945.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Burkholderia vietnamiensis G4]
 gi|134138367|gb|ABO54110.1| succinylornithine aminotransferase apoenzyme [Burkholderia
           vietnamiensis G4]
          Length = 410

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 222/371 (59%), Gaps = 5/371 (1%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++ +G+ ++   G  ++DFA GIAV SLGH HPEL+ +L  Q  KLWH+ N Y +     
Sbjct: 27  DRAEGSRVWDTAGREYVDFACGIAVTSLGHGHPELLKVLDEQGRKLWHIGNGYTNEPVLR 86

Query: 79  FANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLAT 138
            A  L   TFADR FF NSGAE+ E A+K ARR  +     +K+ IV+F  +FHGRTL T
Sbjct: 87  LAKRLESLTFADRAFFANSGAEANEAALKLARRVAFDRHGADKYEIVSFVQSFHGRTLFT 146

Query: 139 ISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEF 198
           +S GG+ +Y EGFGP   G     F D+++ K  I   T A+++EP+QGEGGV      F
Sbjct: 147 VSVGGQPKYSEGFGPVPAGIKHLPFNDIEAAKAAIGPQTCAVIVEPVQGEGGVIPADPAF 206

Query: 199 LQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLA 258
           L+ LR  CD  DALLIFDEVQTG GRTG  +AY    V PDI+T AK +G GFPIGA L 
Sbjct: 207 LKALRDACDANDALLIFDEVQTGVGRTGHFYAYMDTGVTPDILTTAKALGNGFPIGAMLT 266

Query: 259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR 318
           TNE+AA    G HG+TYGGN LA  + +KV+ +I     LE V   +  L   L  I  R
Sbjct: 267 TNELAAHFKVGVHGTTYGGNPLASAIADKVVELIAEPALLEGVRERSVRLKGALERINAR 326

Query: 319 FPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNVVRILPPLTITAE 374
           F  +F ++RG+GLL+G +   +    A  F     D  L+   +  NV+R +P L I  +
Sbjct: 327 F-GIFKDIRGKGLLVGAELTAAFDGRAKDFVNAAADNGLIMLIAGPNVLRFVPSLVIPFD 385

Query: 375 EIHEGLERIER 385
            + EG++R E+
Sbjct: 386 LLDEGVKRFEK 396


>gi|90580848|ref|ZP_01236650.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Vibrio angustum S14]
 gi|90437919|gb|EAS63108.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Vibrio angustum S14]
          Length = 406

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 165/378 (43%), Positives = 224/378 (59%), Gaps = 11/378 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G GA ++ ++   ++DFA GIAV+ LGH HP +V  LK Q++KLWH+SN+  +      
Sbjct: 29  RGSGARVWDQHDREYVDFAGGIAVSCLGHCHPIMVNALKDQADKLWHLSNVLTNEPALRL 88

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  L    FAD+VFF NSGAE+ E A+K ARRY      T K +I+ F   FHGRT  T+
Sbjct: 89  AKKLTELCFADKVFFANSGAEANEAALKLARRYAVDKFSTEKDQIIAFHQGFHGRTFFTV 148

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           + GG+  Y +GFGPK +      + DL +L   +S  T A+++EP+QGEGG+     EF+
Sbjct: 149 TVGGQEAYSDGFGPKPQAVTHIPYNDLSALAEIMSERTCAVMMEPLQGEGGLVSPSVEFV 208

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q +R++CD   ALLIFDEVQTG GRTG  +AY+   V PDI+T AK +GGGFPIGA L T
Sbjct: 209 QGVRELCDKHQALLIFDEVQTGNGRTGDFYAYQGLGVTPDILTTAKSLGGGFPIGAMLTT 268

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
             +A  +  G+HGSTYGGN LA  + E V+N +     L  V        EGLTAI  ++
Sbjct: 269 TALAEHLKVGTHGSTYGGNPLACAVAEAVINEVSKPDVLAGVKEREHWFREGLTAINAKY 328

Query: 320 PNMFLEVRGQGLLIGLKTVFSPALLAAKFRD-------ECLLTAPSSDNVVRILPPLTIT 372
           P +F E+RG+GLL+G            + RD       E L+   +  NVVR  P L I 
Sbjct: 329 P-IFAEIRGKGLLLGASLTEE---WQGRARDILVQAGKEGLMMLVAGTNVVRFTPSLVIE 384

Query: 373 AEEIHEGLERIERTAIKL 390
             ++ EG+ R+ER    L
Sbjct: 385 KADVDEGMARLERAIATL 402


>gi|116689202|ref|YP_834825.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Burkholderia cenocepacia HI2424]
 gi|116647291|gb|ABK07932.1| succinylornithine aminotransferase apoenzyme [Burkholderia
           cenocepacia HI2424]
          Length = 410

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 170/378 (44%), Positives = 227/378 (60%), Gaps = 19/378 (5%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++ +G+ ++   G  ++DFA GIAV SLGH HPEL+ +L  Q  KLWH+ N Y +     
Sbjct: 27  DRAEGSRVWDTAGREYIDFACGIAVTSLGHGHPELLKVLDEQGRKLWHIGNGYTNEPVLR 86

Query: 79  FANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLAT 138
            A  L   TFADR FF NSGAE+ E A+K ARR  +     +K+ IV+F  +FHGRT  T
Sbjct: 87  LAKRLESLTFADRAFFANSGAEANEAALKLARRVAFDRHGADKYEIVSFVQSFHGRTFFT 146

Query: 139 ISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEF 198
           +SAGG+ +Y EGFGP  EG     F D+++ K  I   T A+++EP+QGEGGV      F
Sbjct: 147 VSAGGQPKYSEGFGPVPEGIKHLPFNDIEAAKAAIGPKTCAVIVEPVQGEGGVIPADPAF 206

Query: 199 LQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLA 258
           L+ LR+ CD   ALLIFDEVQTG GRTG+ +AY    V PDI+T AK +G GFPIGA L 
Sbjct: 207 LKALREACDANGALLIFDEVQTGVGRTGQFYAYMDTGVTPDILTTAKALGNGFPIGAMLT 266

Query: 259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR 318
           TNE+AA    G HG+TYGGN LA  + +KV+ +I     LE V   +  L   L  I  R
Sbjct: 267 TNELAAHFKVGVHGTTYGGNPLASAIADKVVELIGDPALLEGVRERSVRLKGALERINAR 326

Query: 319 FPNMFLEVRGQGLLIGLKTVFSPALLAAKF--RDECLLTAPSSD---------NVVRILP 367
           F  +F +VRG+GLL+G       A L A F  R +  +TA + +         NV+R +P
Sbjct: 327 F-GIFKDVRGKGLLVG-------AELTAAFDGRAKDFVTAAAENGLIMLIAGPNVLRFVP 378

Query: 368 PLTITAEEIHEGLERIER 385
            L I  + + EG++R E+
Sbjct: 379 SLVIPFDLLDEGVKRFEK 396


>gi|225175992|ref|ZP_03729984.1| acetylornithine and succinylornithine aminotransferase
           [Dethiobacter alkaliphilus AHT 1]
 gi|225168580|gb|EEG77382.1| acetylornithine and succinylornithine aminotransferase
           [Dethiobacter alkaliphilus AHT 1]
          Length = 395

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 165/392 (42%), Positives = 235/392 (59%), Gaps = 6/392 (1%)

Query: 3   KNDFLFNTYDQ---SDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKS 59
           +  ++ NTY++   + +  ++G+G +++ E G  FLDF SG+AVN+LGH HP +V  +K 
Sbjct: 7   EQKYIINTYNRQPDATLFIKRGEGVYVWDEAGNRFLDFVSGLAVNNLGHCHPTVVEAVKR 66

Query: 60  QSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKT 119
           Q+EKL H SNLY +  Q   A  L+  + AD+VFF NSGAE+ E AIK AR++       
Sbjct: 67  QTEKLMHTSNLYYTEPQIRLAEQLVAQSCADKVFFCNSGAEANEAAIKLARKFGKATRGC 126

Query: 120 NKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAA 179
               I+T + +FHGRTLA I+A  + +Y +GF P + GF  A++ +L S    ++ +T A
Sbjct: 127 GAHEIITAQRSFHGRTLAAITATAQPKYHQGFEPMVAGFHYAEYNNLDSFAALVNENTCA 186

Query: 180 ILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPD 239
           IL+EPIQGEGGV     EFLQ LRK+CD+   LLIFDEVQ+G GRTGKL AYE   V+PD
Sbjct: 187 ILVEPIQGEGGVYPAQPEFLQGLRKLCDEHGLLLIFDEVQSGIGRTGKLLAYENYGVEPD 246

Query: 240 IMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLE 299
           + T+AKG+GGG PIG   A    A  +  G H ST+GGN +       VL ++  DGFLE
Sbjct: 247 VYTLAKGLGGGLPIGVMAARGAAADTLVPGDHASTFGGNPVVCAAAGAVLQVLGEDGFLE 306

Query: 300 NVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSS 359
           +V  + +   + L  +   + N  +E+RG GL IGL+     A +A+  + E LL     
Sbjct: 307 HVQKVGQYFMDRLQELT--YANK-VELRGLGLFIGLEISGDGAKVASDCQKEGLLLNCIG 363

Query: 360 DNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
              +R LPPL +  E I   +  ++R   +L 
Sbjct: 364 GKTLRFLPPLIVEEEHIDAAVNVLQRVLARLD 395


>gi|238763028|ref|ZP_04623995.1| Succinylornithine transaminase [Yersinia kristensenii ATCC 33638]
 gi|238698786|gb|EEP91536.1| Succinylornithine transaminase [Yersinia kristensenii ATCC 33638]
          Length = 474

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 173/391 (44%), Positives = 238/391 (60%), Gaps = 13/391 (3%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++++  TY  +D    +G+GA L+ + G  +LDFA GIAVN+LGH HP + A L  Q++K
Sbjct: 73  DEWIVPTYAPADFIVVRGEGAMLWDQQGKSYLDFAGGIAVNALGHGHPAVKAALIEQADK 132

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY------HYMAG 117
           +WH+ N Y +      A  LI +TFA++VFF NSGAE+ E A+K AR+Y      +    
Sbjct: 133 VWHLGNGYTNEPVLRLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANKPGQ 192

Query: 118 KTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDT 177
           +  K +IV F  AFHGRTL T+SAGG+ +Y + F P   G     F DL S +  I++ T
Sbjct: 193 QGEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDFAPLPGGISHGIFNDLASAEALINDQT 252

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
            A+++EPIQGEGGV     EFL  LR +CD  +ALLIFDEVQTG GRTG+L+AY    V 
Sbjct: 253 CAVIVEPIQGEGGVLPAETEFLHGLRALCDRHNALLIFDEVQTGVGRTGELYAYMHYGVT 312

Query: 238 PDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           PD++T AK +GGGFPI A L T + A+ +N GSHG+TYGGN LA  +   VL++I +   
Sbjct: 313 PDVLTSAKALGGGFPIAAMLTTTQYASALNVGSHGTTYGGNPLACAVAGTVLSLINTPEV 372

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVF---SPALLAAKFRDEC 352
           L  V    +   EGL  I  R   +F E+RG+GLLIG  L   +   S  ++ A  +   
Sbjct: 373 LAGVKERHQWFLEGLADINARH-KVFAEIRGRGLLIGCVLNNDYAGKSKEIIQAAAQ-HG 430

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERI 383
           L+   +  +VVR  P L I+  +I EGL R+
Sbjct: 431 LIALIAGPDVVRFAPSLIISRHDIKEGLARL 461


>gi|161616499|ref|YP_001590464.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Salmonella enterica subsp. enterica serovar Paratyphi B
           str. SPB7]
 gi|161365863|gb|ABX69631.1| hypothetical protein SPAB_04314 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 390

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 163/389 (41%), Positives = 229/389 (58%), Gaps = 5/389 (1%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
            +   Y  +D    KGKG+ ++ + G  ++DFA GIAV +LGH HP LV  LKSQ E LW
Sbjct: 1   MILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLW 60

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SN++ +         LI +TFA+RV F NSG E+ E A K AR Y  +     K +I+
Sbjct: 61  HTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHSPFKTKII 120

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
            F  AFHGR+L T+S GG+ +Y +GFGPK        F DL ++K  + + T A+++EPI
Sbjct: 121 AFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMDDHTCAVVVEPI 180

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGGV+    EFL+ LR +CD+  ALL+FDEVQ G GRTG LFAY    V PDI+T AK
Sbjct: 181 QGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAK 240

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
            +GGGFP+ A L T E+A+  + GSHGSTYGGN LA  +     +II +   L+ +    
Sbjct: 241 ALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFDIINTPEVLQGIHTKR 300

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDN 361
           +   + L AI  +F ++F ++RG GLLIG +        A  F     +  ++   +  +
Sbjct: 301 QQFVQHLQAIDEQF-DIFSDIRGMGLLIGAELKPEYKGRARDFLYAGAEAGVMVLNAGAD 359

Query: 362 VVRILPPLTITAEEIHEGLERIERTAIKL 390
           V+R  P L +   +IHEG++R  +   K+
Sbjct: 360 VMRFAPSLVVEEADIHEGMQRFAQAVGKV 388


>gi|170694563|ref|ZP_02885715.1| succinylornithine transaminase family [Burkholderia graminis C4D1M]
 gi|170140445|gb|EDT08621.1| succinylornithine transaminase family [Burkholderia graminis C4D1M]
          Length = 411

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 162/376 (43%), Positives = 227/376 (60%), Gaps = 15/376 (3%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++G G+ ++   G  ++DFA GIAV +LGH+HPEL+ +L+ Q  KLWH+ N Y +     
Sbjct: 27  DRGLGSRVWDTQGRDYIDFAGGIAVTALGHAHPELLKVLQEQGSKLWHIGNGYTNEPVLR 86

Query: 79  FANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLAT 138
            A  L   TFADR FF NSGAE+ E A+K ARR  +      KF++++F  +FHGRT  T
Sbjct: 87  LAKRLEDLTFADRAFFANSGAEANEAALKLARRVAFDRHGAEKFQVISFTQSFHGRTFFT 146

Query: 139 ISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEF 198
           +S GG+ +Y EGFGP  +G     + D+++ K  I   T A+++EPIQGEGGV      F
Sbjct: 147 VSVGGQPKYSEGFGPVPQGIVHLPYNDIEAAKKAIGAKTCAVIVEPIQGEGGVIPADPAF 206

Query: 199 LQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLA 258
           L+ LR+ CD   ALLIFDEVQTG GR+G  +AY+   V PDI+T AK +G GFPIGA L 
Sbjct: 207 LKALREACDQHGALLIFDEVQTGVGRSGYFYAYQDTGVTPDILTTAKALGNGFPIGAMLT 266

Query: 259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR 318
           TNE+AA    G HG+TYGGN L   + EKV+ ++     LE V   + +L   L  +  R
Sbjct: 267 TNELAAHFKVGVHGTTYGGNPLGSAIAEKVVELVSDPKLLEGVRTRSDVLRGHLAKLNER 326

Query: 319 FPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAP---------SSDNVVRILPPL 369
           F  +F EVRG+GLLIG +        A K R +  +TA          +  +V+R +P L
Sbjct: 327 F-GLFTEVRGKGLLIGAELTD-----AYKGRAKDFVTAAGQHGVIMLMAGPDVLRFVPSL 380

Query: 370 TITAEEIHEGLERIER 385
            +  ++++EG ER+ +
Sbjct: 381 IMPLDDMNEGFERLAK 396


>gi|167586681|ref|ZP_02379069.1| bifunctional N-succinyldiaminopimelate- [Burkholderia ubonensis Bu]
          Length = 386

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 167/372 (44%), Positives = 223/372 (59%), Gaps = 5/372 (1%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++G+G+ ++   G  ++DFA GIAV SLGH HPEL+ +L  QS KLWH+ N Y +     
Sbjct: 3   DRGEGSRVWDTAGREYVDFACGIAVTSLGHGHPELLKVLDEQSRKLWHIGNGYTNEPVLR 62

Query: 79  FANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLAT 138
            A  L   TFADR FF NSGAE+ E A+K ARR  +     +KF I++F  +FHGRT  T
Sbjct: 63  LAKRLESLTFADRAFFANSGAEANEAALKLARRVAFERHGADKFEIISFVQSFHGRTFFT 122

Query: 139 ISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEF 198
           +S GG+ +Y EGFGP  EG     F D+ + K  I   T A+++EP+QGEGGV      F
Sbjct: 123 VSVGGQPKYSEGFGPVPEGIKHLPFNDIAAAKAAIGPKTCAVIVEPVQGEGGVIPADPAF 182

Query: 199 LQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLA 258
           L+ LR+ CD  +ALLIFDEVQTG GRTG  +AY    V PDI+T AK +G GFPIGA L 
Sbjct: 183 LKALREACDANNALLIFDEVQTGVGRTGHFYAYMDTGVTPDILTTAKALGNGFPIGAMLT 242

Query: 259 TNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNR 318
           T E+AA    G HG+TYGGN LA  + +KV+ +I     LE V   +  L   L  I  R
Sbjct: 243 TKELAAHFKVGVHGTTYGGNPLASAIADKVVELIGDPALLEGVRERSVRLKGALERINAR 302

Query: 319 FPNMFLEVRGQGLLIGLKTVFSPALLAAKF----RDECLLTAPSSDNVVRILPPLTITAE 374
           F  +F EVRG+GLL+G +   +    A  F     ++ ++   +  NV+R +P L I  +
Sbjct: 303 F-GIFKEVRGKGLLVGAELTAAFDGRAKDFVNAAAEQGVIMLIAGPNVLRFVPSLVIPFD 361

Query: 375 EIHEGLERIERT 386
            + EGL R E+ 
Sbjct: 362 VLDEGLARFEKA 373


>gi|269120518|ref|YP_003308695.1| acetylornithine and succinylornithine aminotransferase [Sebaldella
           termitidis ATCC 33386]
 gi|268614396|gb|ACZ08764.1| acetylornithine and succinylornithine aminotransferase [Sebaldella
           termitidis ATCC 33386]
          Length = 387

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 158/383 (41%), Positives = 234/383 (61%), Gaps = 6/383 (1%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
            L N Y++ ++ F KGKG +L+ + G  +LDF SGIAVN LGH+HP +   LK Q E L 
Sbjct: 1   MLLNVYNRFNVSFVKGKGVYLYDDQGNEYLDFVSGIAVNCLGHAHPVIANALKKQGETLI 60

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H+SNLY S  Q    + L   +  +RVFF+NSG E++E AIK AR+Y     K NK  I+
Sbjct: 61  HISNLYHSNAQTKLVDKLTGLSEHERVFFSNSGTEAIELAIKIARKYGNNIDK-NKTEII 119

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
             + +FHGR+  +++  G+ +Y E F P +    +  F +++ LK++++ +T A+++EP+
Sbjct: 120 YMKDSFHGRSTGSLAITGQKKYQEPFEPLMPNVTECLFNNIEDLKSKVNQNTCAVILEPV 179

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGE G++    EFL+ L+++C + +ALLIFDE+Q G GR G LFAYE   V PDI+TIAK
Sbjct: 180 QGESGIQTASPEFLKALKELCSENNALLIFDEIQCGMGRMGTLFAYEQLGVVPDIVTIAK 239

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
            +GGG PIGACL   +    M  G HGSTYGGN L   +   VL  +  +  +  V    
Sbjct: 240 ALGGGVPIGACLTKGKANDVMVPGDHGSTYGGNPLVCAVAYDVLTELVDNKVIAGVKAKG 299

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLK---TVFSPALLAAKFRDECLLTAPSSDNV 362
           +   E L  +K ++  +  E+RG GLLIG+K   +V +       F ++ LL  P+ +NV
Sbjct: 300 EYAIEKLNKLKEKY-KLIEEIRGTGLLIGIKLDESVAARDFANTAFENKFLLV-PAGNNV 357

Query: 363 VRILPPLTITAEEIHEGLERIER 385
           +R  PPL +T EEI + +E++E 
Sbjct: 358 LRYFPPLNVTLEEIDKSIEKMEE 380


>gi|163802761|ref|ZP_02196651.1| aminotransferase [Vibrio sp. AND4]
 gi|159173468|gb|EDP58290.1| aminotransferase [Vibrio sp. AND4]
          Length = 403

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 164/393 (41%), Positives = 237/393 (60%), Gaps = 9/393 (2%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           ++ +   Y+  ++   KGKG+ ++ +NG  ++DFA GIAV+ LGH HP +V  L  Q  K
Sbjct: 13  DEVMVPCYNPMEMVPVKGKGSRVWDQNGNEYIDFAGGIAVSCLGHCHPVMVNALTEQGNK 72

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   +FA+RVFF NSGAE+ E A+K ARRY        K  
Sbjct: 73  LWHLSNVMTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVHSNEKSE 132

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+ F+  FHGRT  T++ GG+  Y +GFGPK        + D+++L+  +S  T A+++E
Sbjct: 133 IIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHMSERTCAVMME 192

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QGEGG+     EF Q +R++CD  +ALLIFDEVQTG GRTG  +AY+   + PDI++ 
Sbjct: 193 PLQGEGGIIPPTPEFAQAVRELCDKHNALLIFDEVQTGNGRTGHFYAYQGLGITPDILST 252

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T ++A  M  G+HGSTYGGN LA  + E V++ +     L  V+ 
Sbjct: 253 AKSLGGGFPIGAMLTTAKLAEHMKVGTHGSTYGGNPLACAVAEAVVDEVTKPEVLAGVLE 312

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG------LKTVFSPALLAAKFRDECLLTAP 357
              +  EGL  I  ++ ++F EVRG+GLL+G       +      L+AA  +   +L A 
Sbjct: 313 RETMFREGLEKINAKY-HIFSEVRGKGLLLGAALNEDWQGRARDVLVAAGKQGLMVLVAG 371

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           +  NVVR  P L IT +EI EGL ++++    L
Sbjct: 372 A--NVVRFTPSLVITPQEIEEGLAKLDKAIATL 402


>gi|269103991|ref|ZP_06156688.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163889|gb|EEZ42385.1| bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 406

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 169/406 (41%), Positives = 241/406 (59%), Gaps = 21/406 (5%)

Query: 1   MNKNDFLFNTYDQSDIRFE--------KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPE 52
           M +N    N +DQ  +           +G+G+ ++ ++   ++DFA GIAV+ LGH HP 
Sbjct: 2   MAENKVQRNVFDQVMVPCYSPMAMIPVRGEGSLVWDQDDKEYIDFAGGIAVSCLGHCHPS 61

Query: 53  LVAILKSQSEKLWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRY 112
           LV  L  Q++KLWH+SN+  +      A  L+ +TFAD+VFF NSGAE+ E A+K ARRY
Sbjct: 62  LVQALTEQAQKLWHLSNVMTNEPALELAQLLVANTFADKVFFANSGAEANEAALKLARRY 121

Query: 113 HYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQ 172
                 T+K +I+ F+  FHGRT  T++ GG+  Y +GFGPK +      + +L +L   
Sbjct: 122 AVDHFSTDKDQIIAFKQGFHGRTFFTVTVGGQSSYSDGFGPKPQAVIHLPYNNLDALSQV 181

Query: 173 ISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYE 232
           IS+ T A+++EP+QGEGG+     EF+Q +R++CD   ALLIFDEVQTG GRTG L+AY+
Sbjct: 182 ISDKTCAVMMEPLQGEGGIISPDAEFIQGVRELCDKHQALLIFDEVQTGNGRTGSLYAYQ 241

Query: 233 WANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNII 292
              V PDI+  AK +GGGFPIGA L T  +A  M  G+HGSTYGGN LA  + +  ++ I
Sbjct: 242 QLGVTPDILATAKSLGGGFPIGAMLTTEAIAQSMKVGTHGSTYGGNPLACAVAKAAISEI 301

Query: 293 QSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA--------LL 344
                L  V        +GL  I  R+P +F ++RG GLL+G +   +P         LL
Sbjct: 302 IKPELLAGVKERESWFKKGLADINQRYP-IFQDIRGHGLLLGAE--LAPEWHGRARDILL 358

Query: 345 AAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           AA   ++ LL   +  NVVR  P L I+  E+ +GL R+E+   +L
Sbjct: 359 AAG--EQRLLVLVAGPNVVRFTPSLVISKLEVEQGLARLEQAIAQL 402


>gi|332308485|ref|YP_004436336.1| succinylornithine transaminase family [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175814|gb|AEE25068.1| succinylornithine transaminase family [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 401

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 159/391 (40%), Positives = 238/391 (60%), Gaps = 5/391 (1%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +D +   Y  S I   +G+G+ ++ +N   ++DFA GIAV+ LGH HP LV  L  Q +K
Sbjct: 9   DDVMVPNYAPSAIIPVRGEGSRVWDQNDKEYIDFAGGIAVSCLGHCHPALVQALTEQGQK 68

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+SN+  +      A  L   TFAD+V+F NSGAE+ E A+K ARR+       +K +
Sbjct: 69  LWHLSNVMTNEPALRLAKKLTELTFADKVYFANSGAEANEAALKLARRWALDVHGEHKSQ 128

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I++F  +FHGRT  T++ GG+  Y +GFGPK      A + DL S++  IS++T A+++E
Sbjct: 129 IISFNKSFHGRTFFTVTVGGQTVYSDGFGPKPGDIAHADYNDLASVEALISDNTCAVMLE 188

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P+QG