RPSBLAST alignment for GI: 254780432 and conserved domain: TIGR00709

>gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases. This family consists of L-diaminobutyric acid transaminases. This general designation covers both 2.6.1.76 (diaminobutyrate-2-oxoglutarate transaminase, which uses glutamate as the amino donor in DABA biosynthesis), and 2.6.1.46 (diaminobutyrate--pyruvate transaminase, which uses alanine as the amino donor). Most members with known function are 2.6.1.76, and at least some annotations as 2.6.1.46 in current databases at time of model revision are incorrect. A distinct branch of this family contains examples of 2.6.1.76 nearly all of which are involved in ectoine biosynthesis. A related enzyme is 4-aminobutyrate aminotransferase (EC 2.6.1.19), also called GABA transaminase. These enzymes all are pyridoxal phosphate-containing class III aminotransferase. Length = 442
 Score =  198 bits (505), Expect = 2e-51
 Identities = 125/416 (30%), Positives = 189/416 (45%), Gaps = 55/416 (13%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKS--QSEKLWHVSNLYQSTQ 75
           F K +G W+    G  +LDF +G    +LGH+HP +   +    QS    H  +L    +
Sbjct: 25  FAKAQGCWVTDVEGKEYLDFLAGAGTLALGHNHPNMKQKILDYLQSGLPLHTLDLTTPLK 84

Query: 76  QEI---FANHLIHSTFADRVFFTN-SGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAF 131
                   N +       ++ F   SGA++VE AIK A+ Y    G+TN   +++F G F
Sbjct: 85  DAFIEALLNIIPKRKMDYKLQFPGPSGADAVEAAIKLAKTY---TGRTN---VISFSGGF 138

Query: 132 HGRTLATISAGGKLQYLEGFGPKIEG-----FDQAKFCDL------------QSLKNQIS 174
           HG T+  ++  G L      G  + G     +     C              +  +N I 
Sbjct: 139 HGMTIGALAVTGNLFAKNAVGMLMPGVQFMPYPHEYRCPFGIGGEAGSNASIEYFENFIE 198

Query: 175 N------DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL 228
           +        AA+++E IQGEGGV   P E+LQ++R++    D  LI DEVQ G+GR+G +
Sbjct: 199 DVESGVDKPAAVILEAIQGEGGVVAAPSEWLQKIREVTRKHDIKLILDEVQAGFGRSGTM 258

Query: 229 FAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKV 288
           FA+E A ++PD + ++K +GGG P+   L   E  A      H  T+ GN LAMV G + 
Sbjct: 259 FAFEHAGIEPDFVVMSKAVGGGLPLAVLLIAPEFDA-WQPAGHTGTFRGNQLAMVTGTEA 317

Query: 289 LNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV---------- 338
           LN  + D   +N     + +   L  +    P +   VRG+GL+ G+  V          
Sbjct: 318 LNYWKDDNLAQNAQERGERITSFLDDMIKEHPCI-GNVRGRGLMQGIMIVDERQSKDATG 376

Query: 339 --FSPALLAAKFRDEC------LLTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
                  LAA  +  C      L T      V R+L P+TI  EE  EG+ R ++ 
Sbjct: 377 AYPRDCELAAAIQGACFENGLLLETGGREGEVFRLLCPITIDQEECEEGISRFKQA 432