RPSBLAST alignment for GI: 254780432 and conserved domain: TIGR03251

>gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase. Characterized members of this protein family are L-lysine 6-transaminase, also called lysine epsilon-aminotransferase (LAT). The immediate product of the reaction of this enzyme on lysine, 2-aminoadipate 6-semialdehyde, becomes 1-piperideine 6-carboxylate, or P6C. This product may be converted subsequently to pipecolate or alpha-aminoadipate, lysine catabolites that may be precursors of certain seconary metabolites. Length = 431
 Score =  193 bits (492), Expect = 7e-50
 Identities = 124/415 (29%), Positives = 191/415 (46%), Gaps = 54/415 (13%)

Query: 19  EKGKGAWLFSEN-GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE 77
           ++ +G+ L     G  +LD  S  A  +LG +HP LV  L  +  +L   + + + +  +
Sbjct: 24  DRSRGSVLVDARDGRRYLDMFSFFASMALGMNHPALVDDLAFR-ARLGAAA-VNKPSNSD 81

Query: 78  IFANHLIH--STFADRV---------FFTNSGAESVECAIKTA----RRYHYMAGKTNKF 122
           ++   +     TFA RV         FF   GA +VE A+KTA     R++   G     
Sbjct: 82  VYTVAMARFVDTFA-RVLGDPALPHLFFIEGGALAVENALKTAFDWKSRHNQARGIPAAL 140

Query: 123 --RIVTFEGAFHGRTLATISAGG----KLQYLEGFG-PKI-----------EGFDQAKFC 164
             +++    AFHGR+  T+S       K      F  P+I              DQ    
Sbjct: 141 GTQVLHLRQAFHGRSGYTLSLTNTDPRKTARFPKFDWPRIDNPKLTFPLDAPNLDQVIAL 200

Query: 165 DLQSLKNQI-------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDE 217
           + ++L+ Q         +D A  + EPIQGEGG      EFL+ +R +CD+ DALLIFDE
Sbjct: 201 EEEALR-QARAAFAERPHDIACFIAEPIQGEGGDNHFRPEFLRAMRALCDEHDALLIFDE 259

Query: 218 VQTGYGRTGKLFAYEWANVKPDIMTIAKG--MGGGFPIGACLATNEVAACMNQGSH--GS 273
           VQTG G TG  +AY+   V+PDI+   K   + G   I A    +EVA  +        S
Sbjct: 260 VQTGVGLTGTAWAYQQLGVQPDIVAFGKKTQVCG---IMAGRRVDEVADNVFAVPSRLNS 316

Query: 274 TYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLL- 332
           T+GGN++ MV   ++L II+ +  ++N       L   L  +   FP++    RG+GL+ 
Sbjct: 317 TWGGNLVDMVRATRILEIIEEERLVDNARVQGAHLLARLHELAAEFPHLVSNPRGRGLMC 376

Query: 333 -IGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
              L +      +  +   E +L     +  +R  PPLT+T EEI   ++ I R 
Sbjct: 377 AFDLPSTADRDEVIRQLYREGVLLLGCGERSIRFRPPLTVTREEIDAAIDAIRRV 431