RPSBLAST alignment for GI: 254780432 and conserved domain: PRK04260

>gnl|CDD|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional. Length = 375
 Score =  324 bits (833), Expect = 2e-89
 Identities = 155/379 (40%), Positives = 224/379 (59%), Gaps = 15/379 (3%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +LF  Y ++ I F K +G +L   +G  +LDF+SGI V +LG  HP++   L+ Q+  +W
Sbjct: 3   YLFQNYKRAAIEFVKAEGNYLIDTDGKKYLDFSSGIGVTNLGF-HPQVQQALQKQAGLIW 61

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADR---VFFTNSGAESVECAIKTARRYHYMAGKTNKF 122
           H  NLY ++ QE  A  LI     D+    FF NSGAE+ E AIK AR+       T K 
Sbjct: 62  HSPNLYLNSLQEEVAQKLI----GDKDYLAFFCNSGAEANEAAIKIARK------ATGKQ 111

Query: 123 RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI 182
            I+TF+ +FHGRT  ++SA G+ +  +GFG  +  F  A F DL S+K  ++ +TAA+++
Sbjct: 112 EIITFQNSFHGRTFGSMSATGQDKIKDGFGDGVPHFSYAIFNDLNSVKALVNKNTAAVML 171

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           E +QGE GV    ++F++ L   C +   LLI DEVQTG GRTGKL+A+E   ++PDI T
Sbjct: 172 ELVQGESGVLPADKDFVKALADYCQETGILLIVDEVQTGMGRTGKLYAFEHYGIEPDIFT 231

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
           +AKG+  G P+GA LA + +      GSHGST+GGN L+M      L+I+ + GFLE  +
Sbjct: 232 LAKGLANGVPVGAMLAKSSLGGAFGYGSHGSTFGGNKLSMAAASATLDIMLTAGFLEQAL 291

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNV 362
                L E L         +   VRG G +IG++T    + L    RD+ L+   +  NV
Sbjct: 292 ENGNYLQEQLQKALQDKETV-TTVRGLGYMIGIETTADLSQLVEAARDKGLIVLTAGTNV 350

Query: 363 VRILPPLTITAEEIHEGLE 381
           +R+LPPLT+T EEI +G+ 
Sbjct: 351 IRLLPPLTLTKEEIEQGIA 369