RPSBLAST alignment for GI: 254780432 and conserved domain: PRK05964

>gnl|CDD|180329 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional. Length = 423
 Score =  227 bits (581), Expect = 4e-60
 Identities = 126/401 (31%), Positives = 197/401 (49%), Gaps = 57/401 (14%)

Query: 16  IRFEKGKGAWLFSENGIPFLDFASGIA---VNSLGHSHPELVAILKSQSEKLWHVSNLYQ 72
           I   + +GA+L+  +G   +D    I+   V + GH+HP +   ++ Q ++L HV     
Sbjct: 26  IPIVRAEGAYLYLADGRELID---AISSWWVATHGHNHPYIDQAIREQLDRLDHV----- 77

Query: 73  STQQEIFANH-----------LIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKT 119
                IFA             L+  T    D VFF++SG+ +VE A+K A +Y    G+ 
Sbjct: 78  -----IFAGFTHEPAERLAQRLVALTPGGLDHVFFSDSGSVAVEVALKMALQYWRNRGEP 132

Query: 120 NKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKI----------EGFDQAKFCDLQSL 169
            + R ++  G +HG T+ T+S G +      + P +          +G++QA    L++L
Sbjct: 133 GRSRFLSLRGGYHGDTIGTMSVGDRGGMHALYTPLLFEQVTAPFPPDGYEQATLDALEAL 192

Query: 170 KNQISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL 228
             + + + AA ++EP +QG GG+      +L +LR+ICD    LLIFDE+ TG+GRTG L
Sbjct: 193 LEKHAGEIAAFIVEPLVQGAGGMLFYDPRYLAELRRICDRHGVLLIFDEIATGFGRTGTL 252

Query: 229 FAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS------HGSTYGGNVLA 281
           FA E A V PDIM ++KG+ GG+ P+ A L T E+              H  +Y  N LA
Sbjct: 253 FACEQAGVSPDIMCLSKGLTGGYLPLAATLCTAEIFEAFYSDDRAKAFMHSPSYTANPLA 312

Query: 282 MVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP 341
                  L++ + +  LE V  ++  L EGL   ++  P    +VR  G  IG   +  P
Sbjct: 313 CAAANASLDLFEDEPVLERVAALSAGLAEGLEPFRD-LPG-VADVRVLG-AIGAVELDRP 369

Query: 342 AL------LAAKFRDECLLTAPSSDNVVRILPPLTITAEEI 376
            L      L A   +  +L  P   N + ++PP  ITAEE+
Sbjct: 370 VLERDGPALRAFALERGVLLRPLG-NTIYLMPPYIITAEEL 409