RPSBLAST alignment for GI: 254780432 and conserved domain: PRK06173

>gnl|CDD|180441 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional. Length = 429
 Score =  147 bits (373), Expect = 4e-36
 Identities = 111/393 (28%), Positives = 185/393 (47%), Gaps = 46/393 (11%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV-------SNLY 71
           E+  G  +  ++G   +D  S       G++HP L A   +Q  K+ H+           
Sbjct: 31  ERADGVMITLKDGRRLIDGMSSWWAALHGYNHPRLNAAATNQLAKMSHIMFGGFTHEPAV 90

Query: 72  QSTQQ--EIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
           +  Q+  EI    L      +++FF +SG+ +VE A+K A +Y    G+  + +  T   
Sbjct: 91  ELAQKLLEILPPSL------NKIFFADSGSVAVEVAMKMALQYQQAKGEVQRTKFATIRS 144

Query: 130 AFHGRTLATISAGGKLQYLEGF------------GPKIEGFDQA-KFCDLQSLKN---QI 173
            +HG T   +S    +  + G              P I+ F +      ++ L++   Q 
Sbjct: 145 GYHGDTWHAMSVCDPVTGMHGLFNHSLPVQYFLPQPSIK-FGEEWNDEAIEPLQDLLEQK 203

Query: 174 SNDTAAILIEPI-QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYE 232
            ++ AA+++EP+ QG GG+      +L + R++CD    LLIFDE+ TG+GRTGKLFA E
Sbjct: 204 GDEIAALILEPVVQGAGGMYFYSPTYLVKARELCDQYGVLLIFDEIATGFGRTGKLFALE 263

Query: 233 WANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS-----HGSTYGGNVLAMVLGE 286
            A V PDIM I K + GG+  + A + T  +A  +  G      HG T+  N LA  +  
Sbjct: 264 HAGVVPDIMCIGKALTGGYLTLSATITTEAIAQTICSGEAKCFMHGPTFMANPLACAIAA 323

Query: 287 KVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP---AL 343
           + + ++    + +N+  I   L + L A    F ++  EVR  G  IG+  +  P   A 
Sbjct: 324 ESIRLLLESPWQQNIQRIEAQLKQEL-APAAEFDSV-AEVRVLG-AIGVVEMKEPVNMAT 380

Query: 344 LAAKFRDECLLTAPSSDNVVRILPPLTITAEEI 376
           L  +F +  +   P    +V I+PP  I+ +E+
Sbjct: 381 LQPRFVEHGIWVRPFG-KLVYIMPPFIISPDEL 412