RPSBLAST alignment for GI: 254780432 and conserved domain: PRK06916

>gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional. Length = 460
 Score =  188 bits (478), Expect = 3e-48
 Identities = 129/416 (31%), Positives = 200/416 (48%), Gaps = 49/416 (11%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           E+G+G  L+  NG  + D  S I +N  GH  PEL   ++ Q  K+ H + L  +    I
Sbjct: 43  ERGEGRKLYDVNGNEYYDGVSSIWLNVHGHQVPELDEAIREQLNKIAHSTLLGLANVPSI 102

Query: 79  -FANHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
             A  LI        +VF+++SGA +VE AIK A +Y    GK  K R VT + A+HG T
Sbjct: 103 LLAEKLIEVVPEGLKKVFYSDSGATAVEIAIKMAFQYWQNKGKPKKQRFVTLKNAYHGDT 162

Query: 136 LATISAGGKLQYLEGFGP------KI---------EGFDQAKFCD-----LQSLKNQISN 175
           +  +S G    + + +        K+          G D+A+        L+ L  +   
Sbjct: 163 IGAVSVGAIDLFHQVYSSLLFEAIKMPYPYTYRSPYGNDKAEIVKKHLEELEELLKEKHE 222

Query: 176 DTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA 234
           + AAI++EP +QG GG+  +P+ +L+ LR +C   + L I DEV TG+GRTGK+FA E  
Sbjct: 223 EIAAIIVEPLVQGAGGMITMPKGYLKGLRNLCTKYNVLFITDEVATGFGRTGKMFACEHE 282

Query: 235 NVKPDIMTIAKGMGGGF-PIGACLATNEV-----AACMNQGS--HGSTYGGNVLAMVLGE 286
           NV PDIMT  KG+ GG+ PI   + T+E+          Q +  HG +Y GN L   +  
Sbjct: 283 NVTPDIMTAGKGLTGGYLPIAITVTTDEIYNAFYGDYEEQKTFFHGHSYTGNPLGCAVAL 342

Query: 287 KVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL--- 343
             L + +    +E V    + +   L  +         ++R  GL++G++ V +      
Sbjct: 343 ANLELYEKTNLIEQVARKTEYVATQLEDLFAL--KHVGDIRQLGLMVGIELVKNKETKEP 400

Query: 344 ----------LAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIK 389
                     +  + R+  +LT P  + +V  +PPL  T +E+ E L RI   AI 
Sbjct: 401 FEWTERVGVQVCKRSRELGMLTRPLGNTIV-FMPPLASTIDELDEML-RILYKAIS 454