RPSBLAST alignment for GI: 254780432 and conserved domain: PRK06918

>gnl|CDD|180748 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed. Length = 451
 Score =  218 bits (558), Expect = 1e-57
 Identities = 131/407 (32%), Positives = 208/407 (51%), Gaps = 50/407 (12%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS---NLYQSTQ 75
           +   GA +   +G  ++DFA  I   ++GHSHP++   L  Q ++  H      +Y+   
Sbjct: 41  QSANGALVTDVDGNQYIDFAGAIGTINVGHSHPKVKEALHKQVDQYIHTGFNVMMYEPYI 100

Query: 76  QEIFANHLIHST---FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFH 132
           +   A  L       F  +V F NSGAE+VE A+K AR+Y      T +  I++F   FH
Sbjct: 101 E--LAEKLAALAPGSFDKKVLFLNSGAEAVENAVKIARKY------TKRQGIISFSRGFH 152

Query: 133 GRTLATISAGGKLQ-YLEGFGP---------------KIEGFDQAKFCD--LQSLKN--- 171
           GRTL T++   K++ Y  GFGP               + EG  + ++ D  ++  KN   
Sbjct: 153 GRTLMTMTMTSKVKPYKFGFGPFAPEVYKAPFPYEYRRPEGLTEEQYDDFMIEEFKNFFI 212

Query: 172 -QISNDT-AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF 229
            +++ +T AA+++EP+QGEGG     ++F+Q++R IC +   L + DE+QTG+ RTGK F
Sbjct: 213 SEVAPETIAAVVMEPVQGEGGFIVPSKKFVQEVRNICSEHGILFVADEIQTGFARTGKYF 272

Query: 230 AYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVL 289
           A E  +V PD++T++K +G G PI   +   E+      G  G TY G+ L       VL
Sbjct: 273 AIEHFDVVPDLITVSKSLGAGVPISGVIGRKEIMDESAPGELGGTYAGSPLGCAAALAVL 332

Query: 290 NIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL------ 343
           +II+ +   +  I + K++      +KN++  +  +VRG G +   + V           
Sbjct: 333 DIIEKENLNDRAIELGKVVMNRFEEMKNKYNCIG-DVRGLGAMCAFELVQDRKTKEPDKT 391

Query: 344 LAAKFRDEC------LLTAPSSDNVVRILPPLTITAEEIHEGLERIE 384
           L A    E       LL+A +  NV+R+L PL IT E++ EGL  IE
Sbjct: 392 LTANICKEANKRGLLLLSAGTYGNVIRVLMPLVITDEQLEEGLTIIE 438