RPSBLAST alignment for GI: 254780432 and conserved domain: PRK08117

>gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional. Length = 433
 Score =  295 bits (758), Expect = 1e-80
 Identities = 153/410 (37%), Positives = 226/410 (55%), Gaps = 43/410 (10%)

Query: 12  DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV-SNL 70
           D  ++   KG+G + +  +G  +LDF SGIAV ++GH HP++V  +K Q++KL H  S +
Sbjct: 23  DHPNLPVVKGEGCYYYGVDGKEYLDFTSGIAVANVGHRHPKVVQAIKEQADKLMHGPSGV 82

Query: 71  YQSTQQEIFANHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFE 128
                    A  L   T    D  FF+NSGAE++E A+K A+        T +  I++F 
Sbjct: 83  IYYESILKLAEELAEITPGGLDCFFFSNSGAEAIEGALKLAKHV------TKRPYIISFT 136

Query: 129 GAFHGRTLATIS-AGGKLQYLEGFGPKIEGFDQA--------------------KFCDLQ 167
           G FHGRTL  +S    K +Y + + P +    QA                       DL+
Sbjct: 137 GCFHGRTLGALSVTTSKSKYRKYYQPLLGSVYQAPYPYCDRCPKGEDPEVCFLECLRDLE 196

Query: 168 SL-KNQISND-TAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRT 225
           SL K+Q++ +  AA++IEP+ GEGG    P+ FL++LR+ICD    LLIFDEVQTG+GRT
Sbjct: 197 SLFKHQVTPEEVAAVIIEPVLGEGGYIVPPKSFLKKLREICDRHGILLIFDEVQTGFGRT 256

Query: 226 GKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLG 285
           G+ FA +   V PDIMTIAKG+  G P+ A +A+ E+      GSHG+T+GGN +A    
Sbjct: 257 GEWFAAQTFGVVPDIMTIAKGIASGLPLSAVVASKELMEQWPLGSHGTTFGGNPVACAAA 316

Query: 286 EKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF---SPA 342
              L +I+ +  L+N   +     E L  +K + P +  +VRG GL+IG++ V     P 
Sbjct: 317 LATLEVIKEEKLLDNANEMGAYALERLEVLKEKHP-VIGDVRGIGLMIGIEIVDPDGEPD 375

Query: 343 -LLAAKFRDECL------LTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
                K  D+CL          ++ NV+R++PPLT+T EEI EGL+ ++ 
Sbjct: 376 GDAVEKILDKCLEKGLLFYLCGNAGNVLRMIPPLTVTKEEIDEGLDILDE 425