RPSBLAST alignment for GI: 254780432 and conserved domain: PRK09792

>gnl|CDD|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional. Length = 421
 Score =  192 bits (488), Expect = 2e-49
 Identities = 131/392 (33%), Positives = 191/392 (48%), Gaps = 43/392 (10%)

Query: 31  GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFA------NHLI 84
           G  ++DFA+GIAV + GH HP+LVA ++ Q ++  H +  YQ    E +       N L 
Sbjct: 39  GNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTA--YQIVPYESYVTLAEKINALA 96

Query: 85  HSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK 144
             +   +  F  +GAE+VE A+K AR +      T +  ++ F G FHGRT  T++  GK
Sbjct: 97  PVSGQAKTAFFTTGAEAVENAVKIARAH------TGRPGVIAFSGGFHGRTYMTMALTGK 150

Query: 145 LQ-YLEGFGPKIEGFDQAKF-CDLQSLKNQISNDT--------------AAILIEPIQGE 188
           +  Y  GFGP         +  DL  +  Q S D               AAI+ EP+QGE
Sbjct: 151 VAPYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAIIFEPVQGE 210

Query: 189 GGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMG 248
           GG    P+E +  +R++CD+   ++I DEVQ+G+ RTGKLFA +    KPD+MT+AK + 
Sbjct: 211 GGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLMTMAKSLA 270

Query: 249 GGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKIL 308
           GG P+   +    +      G  G TY GN LA+     VLNII  +   E    + + L
Sbjct: 271 GGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERANQLGQRL 330

Query: 309 FEGLTAIKNRFPNMFLEVRGQGLLIGL-----KTVFSPALLAAKFRDEC------LLTAP 357
              L   K   P +   VRG G +I       +T    A +A K +         LLT  
Sbjct: 331 KNTLIDAKESVPAI-AAVRGLGSMIAAEFNDPQTGEPSAAIAQKIQQRALAQGLLLLTCG 389

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIK 389
           +  NV+R L PLTI   +    + +I + A+ 
Sbjct: 390 AYGNVIRFLYPLTIPDAQFDAAM-KILQDALS 420